1RLYA

Rdc-derived models of the zinc ribbon domain of human general transcription tfiib (zinc bound structures)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
58
structure length
58
Chain Sequence
ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Zn2+-binding effects on the zinc-ribbon domain of human general transcription factor TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Transcription initiation factor IIB
total genus 1
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rlyA00
3GTLI 2E2JI 2RBLA 3S1RI 1I6HI 4NBHA 1TFIA 2DE6A 2B63I 3LUSA 1WW9A 1LQLA 3D6WA 1SFOI 4BBRI 5IP7I 2E2HI 3HOWI 4BBSI 2R7ZI 1QYPA 3I07A 3VMIA 3I4NI 3H3VJ 1ZB9A 1Y1WI 1N2FA 2DE5A 2PK7A 2NVQI 3M3YI 2JA8I 4A3KI 1VLAA 4MH4A 3GTQI 3M4OI 4QTUA 4NBEA 4NBAA 4A3MI 2F4MA 1Y1VS 2NVXI 4QTTA 4A3EI 2P3YA 2DE7A 2BJOA 4A93I 3CQZI 4NOZA 3GTPI 3GTMS 5C44I 5C4XI 4A3DI 3HOUI 2KPIA 1RLYA 3H0GI 1ZB8A 3RZOI 4A3LI 4NBDA 3S2HI 1TWAI 2J6AA 2R93I 1TWCI 3S17I 1TWFI 2AKLA 4NBCA 3GKQA 3Q87A 1NUIA 4A3JI 3RZDI 4BY7I 3GCFA 4BXXI 1TWGI 2HF1A 1I50I 5FLMI 3PO2I 3PO3S 3S14I 2NVTI 3VMGA 1I3QI 1X3WA 5C3EI 3HOXI 3GTKI 4A3CI 3S15I 3ESWA 4Y52I 3K7AI 2R92I 4XX2A 3S1NI 1YUAA 4A3II 4NB8A 3HOZI 1TWHI 4Y7NI 2NVYI 3GTJI 1USPB 3GTOI 1USPA 3S1MI 4A3FI 2JA7I 2JA5I 3U50C 1PFTA 2YU9I 4NBGA 1L1OC 1WCMI 1Y1VI 1ML8A 2E2II 5C4JI 4NB9A 3S2DI 1K83I 3GTMI 3I4MI 3S1QI 2JNYA 1RO4A 5CM2M 2K5RA 2JR6A 3GTGI 3FKII 1R9TI 4A3GI 1X3ZA 4NBFA 4X6AI 5IP9I 3EERA 2JA6I 2JS4A 3VMHA 2F4OA 4NBBA 4A3BI 3S16I 3HOVI 2VUMI 4BY1I 3VB9A 1DL6A 3HOYI 3PO3I
chains in the Genus database with same CATH superfamily
2W04A 3CCE1 4DGLA 3CXCZ 2IZ4A 1Q7Y2 2B63I 4NFRA 4AYBA 5D1OA 1VQL1 3NH4A 2OOXB 4BBSI 3NFZA 5T6BA 1Y1WI 1RNIA 3CC4Z 1VQ81 3M4OI 2F4MA 2Q51A 2QA41 1YHQZ 2NVXI 4A3EI 1YIJ1 3NDIA 3CCU1 3GTPI 5D1PA 3NH8A 4CL1A 1VQ71 2VPWA 2KPIA 2ZAEB 1VQKZ 5IT9b 1JJ2Y 4A3LI 2E9HA 1YJW1 1Z03A 2R6MA 1KD12 4E2ZA 1M902 4BXXI 1KQSZ 4E32A 1I50I 3PO2I 3TE5B 3S14I 3NH5A 2WAQA 3J80f 2M6NA 1VQN1 4E31A 3S15I 2RPRA 4Y52I 2OTJZ 3CCR1 3CC41 1YUAA 4A3II 3BG1B 3F3FC 1YJN1 1VQMZ 4E2XA 1USPB 3JAMf 4A3FI 4EWCA 1Q7Y1 1K9M2 4E2WA 2QREB 4NB9A 3P5JB 3KIFA 3GTMI 1QVGY 3CCL1 1X0TA 2QR1B 1RO2A 3FKII 4A3GI 1K8A1 2AYDA 2H85A 3EERA 2JA6I 3VTNA 1QXFA 1KC81 3T4NB 3FQMA 4NBBA 1P9NA 4RVHA 3IFUA 3MZLB 1NJI2 3GTLI 1VQPZ 1WIIA 1I6HI 4NBHA 2YADA 1TFIA 2NAPA 3G711 3CC21 2I3CA 2V8IA 1K731 2P28A 4NH1C 4BBRI 5IP7I 3IX0A 3I4NI 1RQFA 3H3VJ 2HU9A 2PK7A 2NVQI 3M3YI 4QTUA 4NBEA 3CXCY 1Y1VS 2O4HA 2Y0SA 1KD11 1Q811 2IV2X 1YJ91 4A3DI 2GTHA 4DK1A 3HOUI 1YJ9Z 2JIPA 4E33A 4MD9A 2JIQA 4NBDA 3I561 3EEDA 1KQSY 4MRIA 1VQ7Z 4TNUA 2R93I 2JMOA 2JIOA 4NBCA 1NUIA 3J80b 4BY7I 5FLMI 3CCEZ 2K3RA 5C3EI 1X3WA 3G4SZ 1KRLA 3GTKI 1S72Z 4A3CI 3ESWA 4XX2A 3S1NI 3HKZA 5D1OB 2V8KA 5A2Qf 3CMEZ 1N8R2 4Y7NI 3I55Z 3OW2Y 1USPA 3CD6Z 4RVFA 3S1MI 3CCQZ 3CCVZ 4NBGA 1L1OC 1WCMI 1Y1VI 3S2DI 5T67A 1M1K1 1K9M1 1K83I 5IT9f 2JNYA 1RO4A 3G71Z 3CC71 2M48A 3CCJ1 1X3ZA 2JIMA 4NBFA 4X6AI 3CCS1 5IP9I 1VQ91 2JS4A 3I551 1YJWZ 2F4OA 4A3BI 4MONA 1KC82 2E2JI 1VQ5Z 3CCQ1 5FLXf 3LUSA 2QA4Z 1QVGZ 1QF8A 1WW9A 2RIQA 3JAMb 3J81b 2PMZA 3QWUA 2QEXZ 2JIRA 2R7ZI 3VMIA 3I07A 1VQM1 2E7ZA 3IF8A 1ZB9A 3CC7Z 1N2FA 2OTL1 2JA8I 4MH4A 3GTQI 4NBAA 4QTTA 2BJOA 3CQZI 4NOZA 5AN9F 1YI21 3CMA1 1Y8CA 2VPYA 3CCSZ 3CPWY 4MXUA 3GTMS 1NP6A 1VQO1 5C44I 1VQ51 1YITZ 3CD61 1VQLZ 1RLYA 1QVFY 3H0GI 1ZB8A 3RZOI 3KIHA 3S2HI 1TWAI 3CME1 2J6AA 2QLVB 1TWCI 4RV9A 5LL6f 1VQ8Z 1TWFI 1AA6A 1M901 2QRDB 3OW2Z 1VQ6Z 3RZDI 2LEXA 2OTJ1 3VMGA 3HOXI 2OTLZ 1Q821 3HOZI 3GTJI 1VQOZ 3GTOI 4RS4A 2JA7I 1SIWA 2YU9I 1ML8A 3BG0B 2E2II 2WB1A 1Q822 2RT9A 2QEX1 1YIJZ 3I4MI 3S1QI 5CM2M 3D9XA 4E30A 1YHQ1 2JR6A 3GTGI 1R9TI 1Z02A 1JWHC 1FDIA 3CCLZ 4MD7A 2VF1A 4RVDA 3I56Z 1Q16A 3G4S1 3VMHA 2G2KA 4BY1I 3J7A4 3PO3I 3MZKB 4HGZA 2RBLA 3G6EZ 2OZKA 3S1RI 2PM9A 1VQ4Z 1ZH1A 2DE6A 2V45A 4S1TA 1YJNZ 3CCV1 1LQLA 3D6WA 1SFOI 2KI7B 3CCUZ 1VQP1 1JJ2Z 2E2HI 3HOWI 1VQNZ 1QYPA 5A2Qb 1S7MA 2DE5A 4E2YA 4A3KI 1VLAA 2O53A 3CC2Z 4A3MI 1VQ61 3IR7A 2P3YA 2DE7A 4A93I 1YUKA 4HGYA 3TDHB 5C4XI 1VQ9Z 2W03A 1Q812 2GU2A 2V3VA 1S721 2QRCB 1YIT1 2IZ3A 1YI2Z 2LFUA 3S17I 2AKLA 3G6E1 2JUBA 3GKQA 3Q87A 4A3JI 3GCFA 2Q4ZA 1TWGI 2HF1A 3PO3S 1WJ2A 2NVTI 1I3QI 4MD8A 3J81f 2VUGA 3K7AI 1M1K2 2R92I 2LIYA 1Q862 4DQYB 3CCMZ 3CPWZ 3MONA 3D2LA 4NB8A 5FLXb 1W2BZ 1TWHI 2V8JA 2NVYI 3CCM1 1Q861 2QKDA 2JA5I 3U50C 1PFTA 1VQ41 2GTIA 3CMAZ 1N8R1 3FQQA 1RO0A 3F3PC 5C4JI 1NJI1 2VPXA 1Z01A 2K5RA 5T64A 1K732 3CCRZ 1W2BY 2EGTA 4HH4A 2OOYB 1K8A2 1QVFZ 4RVGA 2RHBA 1VQK1 3S16I 3HOVI 2VUMI 3VB9A 1DL6A 1WZNA 3HOYI 3CCJZ 1FDOA 2VPZA 3NDJA
chains in the Genus database with same CATH topology
2W04A 3CCE1 4DGLA 3CXCZ 2IZ4A 1Q7Y2 2B63I 4NFRA 4AYBA 5D1OA 1VQL1 3NH4A 2OOXB 4BBSI 3NFZA 5T6BA 1Y1WI 1RNIA 3CC4Z 1VQ81 3M4OI 2F4MA 2Q51A 2QA41 1YHQZ 2NVXI 4A3EI 1YIJ1 3NDIA 3CCU1 3GTPI 5D1PA 3NH8A 4CL1A 1VQ71 2KPIA 2ZAEB 1VQKZ 5IT9b 1JJ2Y 4A3LI 2E9HA 1YJW1 1Z03A 2R6MA 1KD12 4E2ZA 1M902 4BXXI 1KQSZ 4E32A 1I50I 3PO2I 3TE5B 3S14I 3NH5A 2WAQA 3J80f 2M6NA 1VQN1 4E31A 3S15I 2RPRA 4Y52I 2OTJZ 3CCR1 3CC41 1YUAA 4A3II 3BG1B 3F3FC 1YJN1 1VQMZ 4E2XA 1USPB 3JAMf 4A3FI 4EWCA 1Q7Y1 1K9M2 4E2WA 2QREB 4NB9A 3P5JB 3KIFA 3GTMI 1QVGY 3CCL1 1X0TA 2QR1B 1RO2A 3FKII 4A3GI 1K8A1 2H85A 3EERA 2JA6I 3VTNA 1KC81 3T4NB 3FQMA 4NBBA 1P9NA 4RVHA 3IFUA 3MZLB 1NJI2 3GTLI 1VQPZ 1WIIA 1I6HI 4NBHA 2YADA 1TFIA 3G711 3CC21 2I3CA 2V8IA 1K731 2P28A 4NH1C 4BBRI 5IP7I 3IX0A 3I4NI 1RQFA 3H3VJ 2HU9A 2PK7A 2NVQI 3M3YI 4QTUA 4NBEA 3CXCY 1Y1VS 2O4HA 2Y0SA 1KD11 1Q811 1YJ91 4A3DI 2GTHA 4DK1A 3HOUI 1YJ9Z 4E33A 4MD9A 4NBDA 3I561 3EEDA 1KQSY 4MRIA 1VQ7Z 4TNUA 2R93I 2JMOA 4NBCA 1NUIA 3J80b 4BY7I 5FLMI 3CCEZ 2K3RA 5C3EI 1X3WA 3G4SZ 1KRLA 3GTKI 1S72Z 4A3CI 3ESWA 4XX2A 3S1NI 3HKZA 5D1OB 2V8KA 5A2Qf 3CMEZ 1N8R2 4Y7NI 3I55Z 3OW2Y 1USPA 3CD6Z 4RVFA 3S1MI 3CCQZ 3CCVZ 4NBGA 1L1OC 1WCMI 1Y1VI 3S2DI 5T67A 1M1K1 1K9M1 1K83I 5IT9f 2JNYA 1RO4A 3G71Z 3CC71 2M48A 3CCJ1 1X3ZA 4NBFA 4X6AI 3CCS1 5IP9I 1VQ91 2JS4A 3I551 1YJWZ 2F4OA 4A3BI 4MONA 1KC82 2E2JI 1VQ5Z 3CCQ1 5FLXf 3LUSA 2QA4Z 1QVGZ 1QF8A 1WW9A 2RIQA 3JAMb 3J81b 2PMZA 3QWUA 2QEXZ 2R7ZI 3VMIA 3I07A 1VQM1 3IF8A 1ZB9A 3CC7Z 1N2FA 2OTL1 2JA8I 4MH4A 3GTQI 4NBAA 4QTTA 2BJOA 3CQZI 4NOZA 5AN9F 1YI21 3CMA1 3CCSZ 3CPWY 4MXUA 3GTMS 1NP6A 1VQO1 5C44I 1VQ51 1YITZ 3CD61 1VQLZ 1RLYA 1QVFY 3H0GI 1ZB8A 3RZOI 3KIHA 3S2HI 1TWAI 3CME1 2J6AA 2QLVB 1TWCI 4RV9A 5LL6f 1VQ8Z 1TWFI 1M901 2QRDB 3OW2Z 1VQ6Z 3RZDI 2OTJ1 3VMGA 3HOXI 2OTLZ 1Q821 3HOZI 3GTJI 1VQOZ 3GTOI 4RS4A 2JA7I 2YU9I 1ML8A 3BG0B 2E2II 2WB1A 1Q822 2RT9A 2QEX1 1YIJZ 3I4MI 3S1QI 5CM2M 3D9XA 4E30A 1YHQ1 2JR6A 3GTGI 1R9TI 1Z02A 1JWHC 3CCLZ 4MD7A 2VF1A 4RVDA 3I56Z 3G4S1 3VMHA 2G2KA 4BY1I 3J7A4 3PO3I 3MZKB 4HGZA 2RBLA 3G6EZ 2OZKA 3S1RI 2PM9A 1VQ4Z 1ZH1A 2DE6A 4S1TA 1YJNZ 3CCV1 1LQLA 3D6WA 1SFOI 2KI7B 3CCUZ 1VQP1 1JJ2Z 2E2HI 3HOWI 1VQNZ 1QYPA 5A2Qb 1S7MA 2DE5A 4E2YA 4A3KI 1VLAA 2O53A 3CC2Z 4A3MI 1VQ61 2P3YA 2DE7A 4A93I 1YUKA 4HGYA 3TDHB 5C4XI 1VQ9Z 2W03A 1Q812 2GU2A 1S721 2QRCB 1YIT1 2IZ3A 2LFUA 1YI2Z 3S17I 2AKLA 3G6E1 2JUBA 3GKQA 3Q87A 4A3JI 3GCFA 2Q4ZA 1TWGI 2HF1A 3PO3S 2NVTI 1I3QI 4MD8A 3J81f 2VUGA 3K7AI 1M1K2 2R92I 2LIYA 1Q862 4DQYB 3CCMZ 3CPWZ 3MONA 4NB8A 5FLXb 1W2BZ 1TWHI 2V8JA 2NVYI 3CCM1 1Q861 2QKDA 2JA5I 3U50C 1PFTA 1VQ41 2GTIA 3CMAZ 1N8R1 3FQQA 1RO0A 3F3PC 5C4JI 1NJI1 1Z01A 2K5RA 5T64A 1K732 3CCRZ 1W2BY 2EGTA 4HH4A 2OOYB 1K8A2 1QVFZ 4RVGA 2RHBA 1VQK1 3S16I 3HOVI 2VUMI 3VB9A 1DL6A 3HOYI 3CCJZ 3NDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL I;  2E2J I;  2RBL A;  3S1R I;  1I6H I;  4NBH A;  1TFI A;  2DE6 A;  2B63 I;  3LUS A;  1WW9 A;  1LQL A;  3D6W A;  1SFO I;  4BBR I;  5IP7 I;  2E2H I;  3HOW I;  4BBS I;  2R7Z I;  1QYP A;  3I07 A;  3VMI A;  3I4N I;  3H3V J;  1ZB9 A;  1Y1W I;  1N2F A;  2DE5 A;  2PK7 A;  2NVQ I;  3M3Y I;  2JA8 I;  4A3K I;  1VLA A;  4MH4 A;  3GTQ I;  3M4O I;  4QTU A;  4NBE A;  4NBA A;  4A3M I;  2F4M A;  1Y1V S;  2NVX I;  4QTT A;  4A3E I;  2P3Y A;  2DE7 A;  2BJO A;  4A93 I;  3CQZ I;  4NOZ A;  3GTP I;  3GTM S;  5C44 I;  5C4X I;  4A3D I;  3HOU I;  2KPI A;  1RLY A;  3H0G I;  1ZB8 A;  3RZO I;  4A3L I;  4NBD A;  3S2H I;  1TWA I;  2J6A A;  2R93 I;  1TWC I;  3S17 I;  1TWF I;  2AKL A;  4NBC A;  3GKQ A;  3Q87 A;  1NUI A;  4A3J I;  3RZD I;  4BY7 I;  3GCF A;  4BXX I;  1TWG I;  2HF1 A;  1I50 I;  5FLM I;  3PO2 I;  3PO3 S;  3S14 I;  2NVT I;  3VMG A;  1I3Q I;  1X3W A;  5C3E I;  3HOX I;  3GTK I;  4A3C I;  3S15 I;  3ESW A;  4Y52 I;  3K7A I;  2R92 I;  4XX2 A;  3S1N I;  1YUA A;  4A3I I;  4NB8 A;  3HOZ I;  1TWH I;  4Y7N I;  2NVY I;  3GTJ I;  1USP B;  3GTO I;  1USP A;  3S1M I;  4A3F I;  2JA7 I;  2JA5 I;  3U50 C;  1PFT A;  2YU9 I;  4NBG A;  1L1O C;  1WCM I;  1Y1V I;  1ML8 A;  2E2I I;  5C4J I;  4NB9 A;  3S2D I;  1K83 I;  3GTM I;  3I4M I;  3S1Q I;  2JNY A;  1RO4 A;  5CM2 M;  2K5R A;  2JR6 A;  3GTG I;  3FKI I;  1R9T I;  4A3G I;  1X3Z A;  4NBF A;  4X6A I;  5IP9 I;  3EER A;  2JA6 I;  2JS4 A;  3VMH A;  2F4O A;  4NBB A;  4A3B I;  3S16 I;  3HOV I;  2VUM I;  4BY1 I;  3VB9 A;  1DL6 A;  3HOY I;  3PO3 I; 
#chains in the Genus database with same CATH topology
 2W04 A;  3CCE 1;  4DGL A;  3CXC Z;  2IZ4 A;  1Q7Y 2;  2B63 I;  4NFR A;  4AYB A;  5D1O A;  1VQL 1;  3NH4 A;  2OOX B;  4BBS I;  3NFZ A;  5T6B A;  1Y1W I;  1RNI A;  3CC4 Z;  1VQ8 1;  3M4O I;  2F4M A;  2Q51 A;  2QA4 1;  1YHQ Z;  2NVX I;  4A3E I;  1YIJ 1;  3NDI A;  3CCU 1;  3GTP I;  5D1P A;  3NH8 A;  4CL1 A;  1VQ7 1;  2VPW A;  2KPI A;  2ZAE B;  1VQK Z;  5IT9 b;  1JJ2 Y;  4A3L I;  2E9H A;  1YJW 1;  1Z03 A;  2R6M A;  1KD1 2;  4E2Z A;  1M90 2;  4BXX I;  1KQS Z;  4E32 A;  1I50 I;  3PO2 I;  3TE5 B;  3S14 I;  3NH5 A;  2WAQ A;  3J80 f;  2M6N A;  1VQN 1;  4E31 A;  3S15 I;  2RPR A;  4Y52 I;  2OTJ Z;  3CCR 1;  3CC4 1;  1YUA A;  4A3I I;  3BG1 B;  3F3F C;  1YJN 1;  1VQM Z;  4E2X A;  1USP B;  3JAM f;  4A3F I;  4EWC A;  1Q7Y 1;  1K9M 2;  4E2W A;  2QRE B;  4NB9 A;  3P5J B;  3KIF A;  3GTM I;  1QVG Y;  3CCL 1;  1X0T A;  2QR1 B;  1RO2 A;  3FKI I;  4A3G I;  1K8A 1;  2AYD A;  2H85 A;  3EER A;  2JA6 I;  3VTN A;  1QXF A;  1KC8 1;  3T4N B;  3FQM A;  4NBB A;  1P9N A;  4RVH A;  3IFU A;  3MZL B;  1NJI 2;  3GTL I;  1VQP Z;  1WII A;  1I6H I;  4NBH A;  2YAD A;  1TFI A;  2NAP A;  3G71 1;  3CC2 1;  2I3C A;  2V8I A;  1K73 1;  2P28 A;  4NH1 C;  4BBR I;  5IP7 I;  3IX0 A;  3I4N I;  1RQF A;  3H3V J;  2HU9 A;  2PK7 A;  2NVQ I;  3M3Y I;  4QTU A;  4NBE A;  3CXC Y;  1Y1V S;  2O4H A;  2Y0S A;  1KD1 1;  1Q81 1;  2IV2 X;  1YJ9 1;  4A3D I;  2GTH A;  4DK1 A;  3HOU I;  1YJ9 Z;  2JIP A;  4E33 A;  4MD9 A;  2JIQ A;  4NBD A;  3I56 1;  3EED A;  1KQS Y;  4MRI A;  1VQ7 Z;  4TNU A;  2R93 I;  2JMO A;  2JIO A;  4NBC A;  1NUI A;  3J80 b;  4BY7 I;  5FLM I;  3CCE Z;  2K3R A;  5C3E I;  1X3W A;  3G4S Z;  1KRL A;  3GTK I;  1S72 Z;  4A3C I;  3ESW A;  4XX2 A;  3S1N I;  3HKZ A;  5D1O B;  2V8K A;  5A2Q f;  3CME Z;  1N8R 2;  4Y7N I;  3I55 Z;  3OW2 Y;  1USP A;  3CD6 Z;  4RVF A;  3S1M I;  3CCQ Z;  3CCV Z;  4NBG A;  1L1O C;  1WCM I;  1Y1V I;  3S2D I;  5T67 A;  1M1K 1;  1K9M 1;  1K83 I;  5IT9 f;  2JNY A;  1RO4 A;  3G71 Z;  3CC7 1;  2M48 A;  3CCJ 1;  1X3Z A;  2JIM A;  4NBF A;  4X6A I;  3CCS 1;  5IP9 I;  1VQ9 1;  2JS4 A;  3I55 1;  1YJW Z;  2F4O A;  4A3B I;  4MON A;  1KC8 2;  2E2J I;  1VQ5 Z;  3CCQ 1;  5FLX f;  3LUS A;  2QA4 Z;  1QVG Z;  1QF8 A;  1WW9 A;  2RIQ A;  3JAM b;  3J81 b;  2PMZ A;  3QWU A;  2QEX Z;  2JIR A;  2R7Z I;  3VMI A;  3I07 A;  1VQM 1;  2E7Z A;  3IF8 A;  1ZB9 A;  3CC7 Z;  1N2F A;  2OTL 1;  2JA8 I;  4MH4 A;  3GTQ I;  4NBA A;  4QTT A;  2BJO A;  3CQZ I;  4NOZ A;  5AN9 F;  1YI2 1;  3CMA 1;  1Y8C A;  2VPY A;  3CCS Z;  3CPW Y;  4MXU A;  3GTM S;  1NP6 A;  1VQO 1;  5C44 I;  1VQ5 1;  1YIT Z;  3CD6 1;  1VQL Z;  1RLY A;  1QVF Y;  3H0G I;  1ZB8 A;  3RZO I;  3KIH A;  3S2H I;  1TWA I;  3CME 1;  2J6A A;  2QLV B;  1TWC I;  4RV9 A;  5LL6 f;  1VQ8 Z;  1TWF I;  1AA6 A;  1M90 1;  2QRD B;  3OW2 Z;  1VQ6 Z;  3RZD I;  2LEX A;  2OTJ 1;  3VMG A;  3HOX I;  2OTL Z;  1Q82 1;  3HOZ I;  3GTJ I;  1VQO Z;  3GTO I;  4RS4 A;  2JA7 I;  1SIW A;  2YU9 I;  1ML8 A;  3BG0 B;  2E2I I;  2WB1 A;  1Q82 2;  2RT9 A;  2QEX 1;  1YIJ Z;  3I4M I;  3S1Q I;  5CM2 M;  3D9X A;  4E30 A;  1YHQ 1;  2JR6 A;  3GTG I;  1R9T I;  1Z02 A;  1JWH C;  1FDI A;  3CCL Z;  4MD7 A;  2VF1 A;  4RVD A;  3I56 Z;  1Q16 A;  3G4S 1;  3VMH A;  2G2K A;  4BY1 I;  3J7A 4;  3PO3 I;  3MZK B;  4HGZ A;  2RBL A;  3G6E Z;  2OZK A;  3S1R I;  2PM9 A;  1VQ4 Z;  1ZH1 A;  2DE6 A;  2V45 A;  4S1T A;  1YJN Z;  3CCV 1;  1LQL A;  3D6W A;  1SFO I;  2KI7 B;  3CCU Z;  1VQP 1;  1JJ2 Z;  2E2H I;  3HOW I;  1VQN Z;  1QYP A;  5A2Q b;  1S7M A;  2DE5 A;  4E2Y A;  4A3K I;  1VLA A;  2O53 A;  3CC2 Z;  4A3M I;  1VQ6 1;  3IR7 A;  2P3Y A;  2DE7 A;  4A93 I;  1YUK A;  4HGY A;  3TDH B;  5C4X I;  1VQ9 Z;  2W03 A;  1Q81 2;  2GU2 A;  2V3V A;  1S72 1;  2QRC B;  1YIT 1;  2IZ3 A;  1YI2 Z;  2LFU A;  3S17 I;  2AKL A;  3G6E 1;  2JUB A;  3GKQ A;  3Q87 A;  4A3J I;  3GCF A;  2Q4Z A;  1TWG I;  2HF1 A;  3PO3 S;  1WJ2 A;  2NVT I;  1I3Q I;  4MD8 A;  3J81 f;  2VUG A;  3K7A I;  1M1K 2;  2R92 I;  2LIY A;  1Q86 2;  4DQY B;  3CCM Z;  3CPW Z;  3MON A;  3D2L A;  4NB8 A;  5FLX b;  1W2B Z;  1TWH I;  2V8J A;  2NVY I;  3CCM 1;  1Q86 1;  2QKD A;  2JA5 I;  3U50 C;  1PFT A;  1VQ4 1;  2GTI A;  3CMA Z;  1N8R 1;  3FQQ A;  1RO0 A;  3F3P C;  5C4J I;  1NJI 1;  2VPX A;  1Z01 A;  2K5R A;  5T64 A;  1K73 2;  3CCR Z;  1W2B Y;  2EGT A;  4HH4 A;  2OOY B;  1K8A 2;  1QVF Z;  4RVG A;  2RHB A;  1VQK 1;  3S16 I;  3HOV I;  2VUM I;  3VB9 A;  1DL6 A;  1WZN A;  3HOY I;  3CCJ Z;  1FDO A;  2VPZ A;  3NDJ A; 
#chains in the Genus database with same CATH homology
 2W04 A;  3CCE 1;  4DGL A;  3CXC Z;  2IZ4 A;  1Q7Y 2;  2B63 I;  4NFR A;  4AYB A;  5D1O A;  1VQL 1;  3NH4 A;  2OOX B;  4BBS I;  3NFZ A;  5T6B A;  1Y1W I;  1RNI A;  3CC4 Z;  1VQ8 1;  3M4O I;  2F4M A;  2Q51 A;  2QA4 1;  1YHQ Z;  2NVX I;  4A3E I;  1YIJ 1;  3NDI A;  3CCU 1;  3GTP I;  5D1P A;  3NH8 A;  4CL1 A;  1VQ7 1;  2KPI A;  2ZAE B;  1VQK Z;  5IT9 b;  1JJ2 Y;  4A3L I;  2E9H A;  1YJW 1;  1Z03 A;  2R6M A;  1KD1 2;  4E2Z A;  1M90 2;  4BXX I;  1KQS Z;  4E32 A;  1I50 I;  3PO2 I;  3TE5 B;  3S14 I;  3NH5 A;  2WAQ A;  3J80 f;  2M6N A;  1VQN 1;  4E31 A;  3S15 I;  2RPR A;  4Y52 I;  2OTJ Z;  3CCR 1;  3CC4 1;  1YUA A;  4A3I I;  3BG1 B;  3F3F C;  1YJN 1;  1VQM Z;  4E2X A;  1USP B;  3JAM f;  4A3F I;  4EWC A;  1Q7Y 1;  1K9M 2;  4E2W A;  2QRE B;  4NB9 A;  3P5J B;  3KIF A;  3GTM I;  1QVG Y;  3CCL 1;  1X0T A;  2QR1 B;  1RO2 A;  3FKI I;  4A3G I;  1K8A 1;  2H85 A;  3EER A;  2JA6 I;  3VTN A;  1KC8 1;  3T4N B;  3FQM A;  4NBB A;  1P9N A;  4RVH A;  3IFU A;  3MZL B;  1NJI 2;  3GTL I;  1VQP Z;  1WII A;  1I6H I;  4NBH A;  2YAD A;  1TFI A;  3G71 1;  3CC2 1;  2I3C A;  2V8I A;  1K73 1;  2P28 A;  4NH1 C;  4BBR I;  5IP7 I;  3IX0 A;  3I4N I;  1RQF A;  3H3V J;  2HU9 A;  2PK7 A;  2NVQ I;  3M3Y I;  4QTU A;  4NBE A;  3CXC Y;  1Y1V S;  2O4H A;  2Y0S A;  1KD1 1;  1Q81 1;  1YJ9 1;  4A3D I;  2GTH A;  4DK1 A;  3HOU I;  1YJ9 Z;  4E33 A;  4MD9 A;  4NBD A;  3I56 1;  3EED A;  1KQS Y;  4MRI A;  1VQ7 Z;  4TNU A;  2R93 I;  2JMO A;  4NBC A;  1NUI A;  3J80 b;  4BY7 I;  5FLM I;  3CCE Z;  2K3R A;  5C3E I;  1X3W A;  3G4S Z;  1KRL A;  3GTK I;  1S72 Z;  4A3C I;  3ESW A;  4XX2 A;  3S1N I;  3HKZ A;  5D1O B;  2V8K A;  5A2Q f;  3CME Z;  1N8R 2;  4Y7N I;  3I55 Z;  3OW2 Y;  1USP A;  3CD6 Z;  4RVF A;  3S1M I;  3CCQ Z;  3CCV Z;  4NBG A;  1L1O C;  1WCM I;  1Y1V I;  3S2D I;  5T67 A;  1M1K 1;  1K9M 1;  1K83 I;  5IT9 f;  2JNY A;  1RO4 A;  3G71 Z;  3CC7 1;  2M48 A;  3CCJ 1;  1X3Z A;  4NBF A;  4X6A I;  3CCS 1;  5IP9 I;  1VQ9 1;  2JS4 A;  3I55 1;  1YJW Z;  2F4O A;  4A3B I;  4MON A;  1KC8 2;  2E2J I;  1VQ5 Z;  3CCQ 1;  5FLX f;  3LUS A;  2QA4 Z;  1QVG Z;  1QF8 A;  1WW9 A;  2RIQ A;  3JAM b;  3J81 b;  2PMZ A;  3QWU A;  2QEX Z;  2R7Z I;  3VMI A;  3I07 A;  1VQM 1;  3IF8 A;  1ZB9 A;  3CC7 Z;  1N2F A;  2OTL 1;  2JA8 I;  4MH4 A;  3GTQ I;  4NBA A;  4QTT A;  2BJO A;  3CQZ I;  4NOZ A;  5AN9 F;  1YI2 1;  3CMA 1;  3CCS Z;  3CPW Y;  4MXU A;  3GTM S;  1NP6 A;  1VQO 1;  5C44 I;  1VQ5 1;  1YIT Z;  3CD6 1;  1VQL Z;  1RLY A;  1QVF Y;  3H0G I;  1ZB8 A;  3RZO I;  3KIH A;  3S2H I;  1TWA I;  3CME 1;  2J6A A;  2QLV B;  1TWC I;  4RV9 A;  5LL6 f;  1VQ8 Z;  1TWF I;  1M90 1;  2QRD B;  3OW2 Z;  1VQ6 Z;  3RZD I;  2OTJ 1;  3VMG A;  3HOX I;  2OTL Z;  1Q82 1;  3HOZ I;  3GTJ I;  1VQO Z;  3GTO I;  4RS4 A;  2JA7 I;  2YU9 I;  1ML8 A;  3BG0 B;  2E2I I;  2WB1 A;  1Q82 2;  2RT9 A;  2QEX 1;  1YIJ Z;  3I4M I;  3S1Q I;  5CM2 M;  3D9X A;  4E30 A;  1YHQ 1;  2JR6 A;  3GTG I;  1R9T I;  1Z02 A;  1JWH C;  3CCL Z;  4MD7 A;  2VF1 A;  4RVD A;  3I56 Z;  3G4S 1;  3VMH A;  2G2K A;  4BY1 I;  3J7A 4;  3PO3 I;  3MZK B;  4HGZ A;  2RBL A;  3G6E Z;  2OZK A;  3S1R I;  2PM9 A;  1VQ4 Z;  1ZH1 A;  2DE6 A;  4S1T A;  1YJN Z;  3CCV 1;  1LQL A;  3D6W A;  1SFO I;  2KI7 B;  3CCU Z;  1VQP 1;  1JJ2 Z;  2E2H I;  3HOW I;  1VQN Z;  1QYP A;  5A2Q b;  1S7M A;  2DE5 A;  4E2Y A;  4A3K I;  1VLA A;  2O53 A;  3CC2 Z;  4A3M I;  1VQ6 1;  2P3Y A;  2DE7 A;  4A93 I;  1YUK A;  4HGY A;  3TDH B;  5C4X I;  1VQ9 Z;  2W03 A;  1Q81 2;  2GU2 A;  1S72 1;  2QRC B;  1YIT 1;  2IZ3 A;  2LFU A;  1YI2 Z;  3S17 I;  2AKL A;  3G6E 1;  2JUB A;  3GKQ A;  3Q87 A;  4A3J I;  3GCF A;  2Q4Z A;  1TWG I;  2HF1 A;  3PO3 S;  2NVT I;  1I3Q I;  4MD8 A;  3J81 f;  2VUG A;  3K7A I;  1M1K 2;  2R92 I;  2LIY A;  1Q86 2;  4DQY B;  3CCM Z;  3CPW Z;  3MON A;  4NB8 A;  5FLX b;  1W2B Z;  1TWH I;  2V8J A;  2NVY I;  3CCM 1;  1Q86 1;  2QKD A;  2JA5 I;  3U50 C;  1PFT A;  1VQ4 1;  2GTI A;  3CMA Z;  1N8R 1;  3FQQ A;  1RO0 A;  3F3P C;  5C4J I;  1NJI 1;  1Z01 A;  2K5R A;  5T64 A;  1K73 2;  3CCR Z;  1W2B Y;  2EGT A;  4HH4 A;  2OOY B;  1K8A 2;  1QVF Z;  4RVG A;  2RHB A;  1VQK 1;  3S16 I;  3HOV I;  2VUM I;  3VB9 A;  1DL6 A;  3HOY I;  3CCJ Z;  3NDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...