1RLYA

Rdc-derived models of the zinc ribbon domain of human general transcription tfiib (zinc bound structures)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
58
structure length
58
Chain Sequence
ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor IIB
publication title Probing Zn2+-binding effects on the zinc-ribbon domain of human general transcription factor TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 1
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rlyA00
3VMHA 1NUIA 2JA5I 4NBEA 1L1OC 4A3JI 2AKLA 4A3CI 3S15I 1USPA 3GTOI 2JA7I 5C4JI 3D6WA 3S2DI 2K5RA 4A3II 4A3FI 2P3YA 1RLYA 1ML8A 3RZDI 5C3EI 2JR6A 1ZB8A 2VUMI 1TWGI 3GCFA 2J6AA 1TWCI 2PK7A 4BY7I 2NVXI 2R7ZI 4NBAA 3I4NI 4QTTA 4NB9A 2NVQI 3LUSA 1R9TI 3I4MI 1ZB9A 3HOZI 3M4OI 3S17I 3HOUI 3PO3S 4X6AI 3GKQA 3M3YI 1VLAA 3HOVI 3GTGI 2NVTI 4NBBA 1Y1VI 1I50I 1N2FA 1K83I 3HOXI 3S14I 3RZOI 3S2HI 1TWFI 3ESWA 5C4XI 5C44I 3EERA 1I6HI 4Y7NI 1DL6A 3VMGA 1X3WA 5IP7I 1WW9A 4MH4A 4BBSI 3VMIA 3S1NI 3H3VJ 2F4MA 4BBRI 4BY1I 3PO2I 3K7AI 3S1RI 3FKII 3U50C 3HOWI 2DE5A 2NVYI 4A3KI 1TWHI 2JS4A 2E2JI 3I07A 4NBGA 4A3EI 2JA6I 3GTPI 1X3ZA 1PFTA 3GTJI 4NBFA 4Y52I 2F4OA 4A93I 5IP9I 2DE7A 1Y1VS 3S1QI 4QTUA 2R92I 2YU9I 1QYPA 4A3BI 2B63I 3CQZI 1LQLA 1Y1WI 3S1MI 2E2HI 4A3MI 4A3DI 1USPB 4A3LI 4NB8A 4NOZA 1RO4A 3GTLI 3HOYI 2HF1A 1TFIA 4BXXI 3S16I 2JA8I 1TWAI 4NBCA 5CM2M 1SFOI 3GTKI 3Q87A 1WCMI 2E2II 3H0GI 3GTQI 2RBLA 2KPIA 4NBDA 1YUAA 4XX2A 3GTMI 2JNYA 1I3QI 2BJOA 5FLMI 4NBHA 3VB9A 3PO3I 2DE6A 2R93I 3GTMS 4A3GI
chains in the Genus database with same CATH superfamily
1Q7Y1 2QRDB 4NBEA 1AA6A 3I551 1YJNZ 3NDIA 3CPWZ 1USPA 2JA7I 5C4JI 2JIRA 2K5RA 2V8KA 1N8R2 3IR7A 3P5JB 5C3EI 2JR6A 1QXFA 3GCFA 1TWCI 2W03A 2QREB 1KC82 1QF8A 5T67A 2NVXI 1VQ91 5LL6f 1K8A2 3BG1B 1M901 5FLXf 3I561 3M4OI 5AN9F 1VQ61 3GKQA 3J7A4 3M3YI 1VLAA 3G6EZ 2IZ3A 2NVTI 4E32A 4E2ZA 1Y1VI 3CCE1 3HOXI 3RZOI 2GTHA 2Q51A 1TWFI 2ZAEB 3I55Z 3NDJA 4NH1C 5C4XI 1I6HI 4Y7NI 2IZ4A 3HKZA 1K732 4HH4A 3TDHB 1P9NA 1VQNZ 1Q16A 1QVFZ 1VQ9Z 2QRCB 4DGLA 4BY1I 3J81f 3CXCY 1VQP1 2DE5A 2E2JI 1Z02A 2LIYA 3IX0A 3I56Z 2IV2X 2M48A 1X3ZA 5IP9I 2DE7A 2W04A 1QVGY 1N8R1 3CD61 4AYBA 2P28A 2H85A 3KIHA 3S1MI 2E2HI 1YJW1 2OTL1 1KC81 4NB8A 3KIFA 3G711 3TE5B 3CCUZ 1K8A1 1VQ71 1RO4A 2YADA 1RNIA 4HGZA 2HF1A 1TFIA 4RVGA 3GTKI 3CC21 1NJI2 2E2II 1SIWA 2KPIA 4E2WA 4NBDA 1I3QI 2Q4ZA 1VQ51 2O4HA 5D1OB 3PO3I 1S721 3CC41 1YJ9Z 3CXCZ 3VMHA 1NUIA 1K731 3CD6Z 2OOXB 2JA5I 2AKLA 4E30A 4A3CI 5IT9b 3GTOI 1YUKA 4DQYB 1YJWZ 3D6WA 2OTLZ 2M6NA 1VQO1 4DK1A 1Z01A 3CCR1 1RO2A 2WB1A 3G71Z 1ML8A 3RZDI 1VQ4Z 1VQ7Z 4EWCA 2R7ZI 1KRLA 4NBAA 1YIT1 2JMOA 2NVQI 3LUSA 1R9TI 3CCSZ 1WJ2A 3HOZI 3S17I 1S72Z 2V45A 4NBBA 1I50I 3S14I 5C44I 4RVFA 2VUGA 2VPXA 2E9HA 3CCL1 3CC71 2QLVB 1VQOZ 1WZNA 1VQ8Z 1DL6A 1W2BY 1NJI1 4RVDA 4MONA 3VMIA 1JJ2Z 3S1RI 1YI2Z 4E2XA 3FKII 4MD7A 3CCQ1 1VQM1 3G4SZ 1K9M2 4A3EI 2V3VA 3GTPI 3GTJI 2OOYB 2F4OA 1KD12 1Y1VS 2HU9A 5IT9f 3NH8A 1YHQ1 4A3BI 1Y1WI 4A3MI 4A3DI 2JIPA 2VPZA 1USPB 2JUBA 4NOZA 3CCJ1 2OZKA 3MZLB 2R6MA 2PMZA 2LFUA 2QEX1 3GTLI 3HOYI 2GU2A 4BXXI 2JA8I 4E31A 2WAQA 1TWAI 5A2Qb 3CCQZ 1VQMZ 1VQ6Z 1WCMI 3H0GI 2I3CA 4HGYA 2O53A 1M1K2 3CCEZ 5FLMI 3VB9A 1JWHC 2VF1A 2DE6A 2RHBA 3CCM1 2R93I 2JIMA 2OTJ1 1L1OC 2JIQA 3MONA 4A3II 1Q822 3NFZA 5T6BA 1VQPZ 2QEXZ 3FQMA 1ZB8A 1TWGI 2J6AA 4RVHA 2PK7A 4BY7I 2QA41 3I4NI 2G2KA 1RQFA 1Z03A 3JAMb 3IFUA 3FQQA 1X0TA 3HOUI 3PO3S 3HOVI 3CME1 3J80b 2OTJZ 2RIQA 2KI7B 1M902 1VQK1 1QVGZ 3VMGA 1X3WA 1ZH1A 1YJN1 3CC2Z 4MH4A 4S1TA 4BBSI 3S1NI 4MRIA 1M1K1 3PO2I 3K7AI 1VQ5Z 1WIIA 5A2Qf 1VQL1 3U50C 2NAPA 2NVYI 3CC4Z 1TWHI 2JS4A 3I07A 4NBGA 4E33A 4RS4A 3BG0B 1PFTA 4NBFA 4Y52I 3CMEZ 1Q821 3S1QI 3CCRZ 1QYPA 3CQZI 3CMA1 2Y0SA 4MD9A 2RT9A 2E7ZA 1QVFY 1Q812 3F3FC 2V8JA 4MD8A 1YITZ 4CL1A 4TNUA 3CCV1 1SFOI 1VQLZ 1NP6A 5D1PA 3Q87A 2AYDA 1VQN1 2PM9A 3VTNA 3JAMf 3GTMI 2BJOA 2V8IA 3CCLZ 3GTMS 3CC7Z 3J80f 1Q862 4A3JI 4NFRA 3S15I 3CMAZ 3S2DI 5T64A 4A3FI 2P3YA 3NH5A 1RLYA 3OW2Y 1KQSY 2RPRA 2VUMI 3NH4A 1W2BZ 2QR1B 3CCVZ 4QTTA 3CCU1 4NB9A 3I4MI 5D1OA 1Y8CA 1ZB9A 3QWUA 4X6AI 1FDIA 1YHQZ 3GTGI 4E2YA 3MZKB 1YIJ1 1N2FA 1K83I 3S2HI 1Q811 3ESWA 3CCJZ 3EEDA 1YJ91 3EERA 1Q7Y2 2K3RA 5IP7I 1K9M1 1WW9A 3H3VJ 2F4MA 4BBRI 1KD11 1VQ41 2LEXA 1RO0A 3HOWI 3CCMZ 4A3KI 3CPWY 5FLXb 3OW2Z 3T4NB 1Q861 1KQSZ 2EGTA 3IF8A 2JA6I 2VPWA 1FDOA 4MXUA 2VPYA 3CCS1 4A93I 2JIOA 1YIJZ 4RV9A 3F3PC 4QTUA 2R92I 2YU9I 2B63I 1LQLA 1JJ2Y 4A3LI 2QA4Z 1VQ81 3D9XA 3S16I 3J81b 4NBCA 5CM2M 2QKDA 3D2LA 1S7MA 3GTQI 2RBLA 4XX2A 1YUAA 2JNYA 1YI21 4NBHA 2GTIA 3G4S1 1VQKZ 3G6E1 4A3GI
chains in the Genus database with same CATH topology
1Q7Y1 2QRDB 4NBEA 3I551 1YJNZ 3NDIA 3CPWZ 1USPA 2JA7I 5C4JI 2K5RA 2V8KA 1N8R2 3P5JB 5C3EI 2JR6A 3GCFA 1TWCI 2W03A 2QREB 1KC82 1QF8A 5T67A 2NVXI 1VQ91 5LL6f 1K8A2 3BG1B 1M901 5FLXf 3I561 3M4OI 5AN9F 1VQ61 3GKQA 3J7A4 3M3YI 1VLAA 3G6EZ 2IZ3A 2NVTI 4E32A 4E2ZA 1Y1VI 3CCE1 3HOXI 3RZOI 2GTHA 2Q51A 1TWFI 2ZAEB 3I55Z 3NDJA 4NH1C 5C4XI 1I6HI 4Y7NI 2IZ4A 3HKZA 1K732 4HH4A 3TDHB 1P9NA 1VQNZ 1QVFZ 1VQ9Z 2QRCB 4DGLA 4BY1I 3J81f 3CXCY 1VQP1 2DE5A 2E2JI 1Z02A 2LIYA 3IX0A 3I56Z 2M48A 1X3ZA 5IP9I 2DE7A 2W04A 1QVGY 1N8R1 3CD61 4AYBA 2P28A 2H85A 3KIHA 3S1MI 2E2HI 1YJW1 2OTL1 1KC81 4NB8A 3KIFA 3G711 3TE5B 3CCUZ 1K8A1 1VQ71 1RO4A 2YADA 1RNIA 4HGZA 2HF1A 1TFIA 4RVGA 3GTKI 3CC21 1NJI2 2E2II 2KPIA 4E2WA 4NBDA 1I3QI 2Q4ZA 1VQ51 2O4HA 5D1OB 3PO3I 1S721 3CC41 1YJ9Z 3CXCZ 3VMHA 1NUIA 1K731 3CD6Z 2OOXB 2JA5I 2AKLA 4E30A 4A3CI 5IT9b 3GTOI 1YUKA 4DQYB 1YJWZ 3D6WA 2OTLZ 2M6NA 1VQO1 4DK1A 1Z01A 3CCR1 1RO2A 2WB1A 3G71Z 1ML8A 3RZDI 1VQ4Z 1VQ7Z 4EWCA 2R7ZI 1KRLA 4NBAA 1YIT1 2JMOA 2NVQI 3LUSA 1R9TI 3CCSZ 3HOZI 3S17I 1S72Z 4NBBA 1I50I 3S14I 5C44I 4RVFA 2VUGA 3CCL1 2E9HA 3CC71 2QLVB 1VQOZ 1DL6A 1VQ8Z 1W2BY 1NJI1 4RVDA 4MONA 3VMIA 1JJ2Z 3S1RI 1YI2Z 4E2XA 3FKII 4MD7A 3CCQ1 1VQM1 3G4SZ 1K9M2 4A3EI 3GTPI 3GTJI 2OOYB 2F4OA 1KD12 1Y1VS 2HU9A 5IT9f 3NH8A 1YHQ1 4A3BI 1Y1WI 4A3MI 4A3DI 1USPB 2JUBA 4NOZA 3CCJ1 2OZKA 3MZLB 2R6MA 2PMZA 2LFUA 2QEX1 3GTLI 3HOYI 2GU2A 4BXXI 2JA8I 4E31A 2WAQA 1TWAI 5A2Qb 3CCQZ 1VQMZ 1VQ6Z 1WCMI 3H0GI 2I3CA 4HGYA 2O53A 1M1K2 3CCEZ 5FLMI 3VB9A 1JWHC 2VF1A 2DE6A 2RHBA 3CCM1 2R93I 2OTJ1 1L1OC 3MONA 4A3II 1Q822 3NFZA 5T6BA 1VQPZ 2QEXZ 3FQMA 1ZB8A 1TWGI 2J6AA 4RVHA 2PK7A 4BY7I 2QA41 3I4NI 2G2KA 1RQFA 1Z03A 3JAMb 3IFUA 3FQQA 1X0TA 3HOUI 3PO3S 3HOVI 3CME1 3J80b 2OTJZ 2RIQA 2KI7B 1M902 1VQK1 1QVGZ 3VMGA 1X3WA 1ZH1A 1YJN1 3CC2Z 4MH4A 4S1TA 4BBSI 3S1NI 4MRIA 1M1K1 3PO2I 3K7AI 1VQ5Z 1WIIA 5A2Qf 1VQL1 3U50C 2NVYI 3CC4Z 1TWHI 2JS4A 3I07A 4NBGA 4E33A 4RS4A 3BG0B 1PFTA 4NBFA 4Y52I 3CMEZ 1Q821 3S1QI 3CCRZ 1QYPA 3CQZI 3CMA1 2Y0SA 4MD9A 2RT9A 1QVFY 1Q812 3F3FC 2V8JA 4MD8A 1YITZ 4CL1A 4TNUA 3CCV1 1SFOI 1VQLZ 1NP6A 5D1PA 3Q87A 1VQN1 2PM9A 3VTNA 3JAMf 3GTMI 2BJOA 2V8IA 3CCLZ 3GTMS 3CC7Z 3J80f 1Q862 4A3JI 4NFRA 3S15I 3CMAZ 3S2DI 5T64A 4A3FI 2P3YA 3NH5A 1RLYA 3OW2Y 1KQSY 2RPRA 2VUMI 3NH4A 1W2BZ 2QR1B 3CCVZ 4QTTA 3CCU1 4NB9A 3I4MI 5D1OA 1ZB9A 3QWUA 4X6AI 1YHQZ 3GTGI 4E2YA 3MZKB 1YIJ1 1N2FA 1K83I 3S2HI 1Q811 3ESWA 3CCJZ 3EEDA 1YJ91 3EERA 1Q7Y2 2K3RA 5IP7I 1K9M1 1WW9A 3H3VJ 2F4MA 4BBRI 1KD11 1VQ41 1RO0A 3HOWI 3CCMZ 4A3KI 3CPWY 5FLXb 3OW2Z 3T4NB 1Q861 1KQSZ 2EGTA 3IF8A 2JA6I 4MXUA 3CCS1 4A93I 1YIJZ 4RV9A 3F3PC 4QTUA 2R92I 2YU9I 2B63I 1LQLA 1JJ2Y 4A3LI 2QA4Z 1VQ81 3D9XA 3S16I 3J81b 4NBCA 5CM2M 2QKDA 1S7MA 3GTQI 2RBLA 4XX2A 1YUAA 2JNYA 1YI21 4NBHA 2GTIA 3G4S1 1VQKZ 3G6E1 4A3GI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMH A;  1NUI A;  2JA5 I;  4NBE A;  1L1O C;  4A3J I;  2AKL A;  4A3C I;  3S15 I;  1USP A;  3GTO I;  2JA7 I;  5C4J I;  3D6W A;  3S2D I;  2K5R A;  4A3I I;  4A3F I;  2P3Y A;  1RLY A;  1ML8 A;  3RZD I;  5C3E I;  2JR6 A;  1ZB8 A;  2VUM I;  1TWG I;  3GCF A;  2J6A A;  1TWC I;  2PK7 A;  4BY7 I;  2NVX I;  2R7Z I;  4NBA A;  3I4N I;  4QTT A;  4NB9 A;  2NVQ I;  3LUS A;  1R9T I;  3I4M I;  1ZB9 A;  3HOZ I;  3M4O I;  3S17 I;  3HOU I;  3PO3 S;  4X6A I;  3GKQ A;  3M3Y I;  1VLA A;  3HOV I;  3GTG I;  2NVT I;  4NBB A;  1Y1V I;  1I50 I;  1N2F A;  1K83 I;  3HOX I;  3S14 I;  3RZO I;  3S2H I;  1TWF I;  3ESW A;  5C4X I;  5C44 I;  3EER A;  1I6H I;  4Y7N I;  1DL6 A;  3VMG A;  1X3W A;  5IP7 I;  1WW9 A;  4MH4 A;  4BBS I;  3VMI A;  3S1N I;  3H3V J;  2F4M A;  4BBR I;  4BY1 I;  3PO2 I;  3K7A I;  3S1R I;  3FKI I;  3U50 C;  3HOW I;  2DE5 A;  2NVY I;  4A3K I;  1TWH I;  2JS4 A;  2E2J I;  3I07 A;  4NBG A;  4A3E I;  2JA6 I;  3GTP I;  1X3Z A;  1PFT A;  3GTJ I;  4NBF A;  4Y52 I;  2F4O A;  4A93 I;  5IP9 I;  2DE7 A;  1Y1V S;  3S1Q I;  4QTU A;  2R92 I;  2YU9 I;  1QYP A;  4A3B I;  2B63 I;  3CQZ I;  1LQL A;  1Y1W I;  3S1M I;  2E2H I;  4A3M I;  4A3D I;  1USP B;  4A3L I;  4NB8 A;  4NOZ A;  1RO4 A;  3GTL I;  3HOY I;  2HF1 A;  1TFI A;  4BXX I;  3S16 I;  2JA8 I;  1TWA I;  4NBC A;  5CM2 M;  1SFO I;  3GTK I;  3Q87 A;  1WCM I;  2E2I I;  3H0G I;  3GTQ I;  2RBL A;  2KPI A;  4NBD A;  1YUA A;  4XX2 A;  3GTM I;  2JNY A;  1I3Q I;  2BJO A;  5FLM I;  4NBH A;  3VB9 A;  3PO3 I;  2DE6 A;  2R93 I;  3GTM S;  4A3G I; 
#chains in the Genus database with same CATH topology
 1Q7Y 1;  2QRD B;  4NBE A;  1AA6 A;  3I55 1;  1YJN Z;  3NDI A;  3CPW Z;  1USP A;  2JA7 I;  5C4J I;  2JIR A;  2K5R A;  2V8K A;  1N8R 2;  3IR7 A;  3P5J B;  5C3E I;  2JR6 A;  1QXF A;  3GCF A;  1TWC I;  2W03 A;  2QRE B;  1KC8 2;  1QF8 A;  5T67 A;  2NVX I;  1VQ9 1;  5LL6 f;  1K8A 2;  3BG1 B;  1M90 1;  5FLX f;  3I56 1;  3M4O I;  5AN9 F;  1VQ6 1;  3GKQ A;  3J7A 4;  3M3Y I;  1VLA A;  3G6E Z;  2IZ3 A;  2NVT I;  4E32 A;  4E2Z A;  1Y1V I;  3CCE 1;  3HOX I;  3RZO I;  2GTH A;  2Q51 A;  1TWF I;  2ZAE B;  3I55 Z;  3NDJ A;  4NH1 C;  5C4X I;  1I6H I;  4Y7N I;  2IZ4 A;  3HKZ A;  1K73 2;  4HH4 A;  3TDH B;  1P9N A;  1VQN Z;  1Q16 A;  1QVF Z;  1VQ9 Z;  2QRC B;  4DGL A;  4BY1 I;  3J81 f;  3CXC Y;  1VQP 1;  2DE5 A;  2E2J I;  1Z02 A;  2LIY A;  3IX0 A;  3I56 Z;  2IV2 X;  2M48 A;  1X3Z A;  5IP9 I;  2DE7 A;  2W04 A;  1QVG Y;  1N8R 1;  3CD6 1;  4AYB A;  2P28 A;  2H85 A;  3KIH A;  3S1M I;  2E2H I;  1YJW 1;  2OTL 1;  1KC8 1;  4NB8 A;  3KIF A;  3G71 1;  3TE5 B;  3CCU Z;  1K8A 1;  1VQ7 1;  1RO4 A;  2YAD A;  1RNI A;  4HGZ A;  2HF1 A;  1TFI A;  4RVG A;  3GTK I;  3CC2 1;  1NJI 2;  2E2I I;  1SIW A;  2KPI A;  4E2W A;  4NBD A;  1I3Q I;  2Q4Z A;  1VQ5 1;  2O4H A;  5D1O B;  3PO3 I;  1S72 1;  3CC4 1;  1YJ9 Z;  3CXC Z;  3VMH A;  1NUI A;  1K73 1;  3CD6 Z;  2OOX B;  2JA5 I;  2AKL A;  4E30 A;  4A3C I;  5IT9 b;  3GTO I;  1YUK A;  4DQY B;  1YJW Z;  3D6W A;  2OTL Z;  2M6N A;  1VQO 1;  4DK1 A;  1Z01 A;  3CCR 1;  1RO2 A;  2WB1 A;  3G71 Z;  1ML8 A;  3RZD I;  1VQ4 Z;  1VQ7 Z;  4EWC A;  2R7Z I;  1KRL A;  4NBA A;  1YIT 1;  2JMO A;  2NVQ I;  3LUS A;  1R9T I;  3CCS Z;  1WJ2 A;  3HOZ I;  3S17 I;  1S72 Z;  2V45 A;  4NBB A;  1I50 I;  3S14 I;  5C44 I;  4RVF A;  2VUG A;  2VPX A;  2E9H A;  3CCL 1;  3CC7 1;  2QLV B;  1VQO Z;  1WZN A;  1VQ8 Z;  1DL6 A;  1W2B Y;  1NJI 1;  4RVD A;  4MON A;  3VMI A;  1JJ2 Z;  3S1R I;  1YI2 Z;  4E2X A;  3FKI I;  4MD7 A;  3CCQ 1;  1VQM 1;  3G4S Z;  1K9M 2;  4A3E I;  2V3V A;  3GTP I;  3GTJ I;  2OOY B;  2F4O A;  1KD1 2;  1Y1V S;  2HU9 A;  5IT9 f;  3NH8 A;  1YHQ 1;  4A3B I;  1Y1W I;  4A3M I;  4A3D I;  2JIP A;  2VPZ A;  1USP B;  2JUB A;  4NOZ A;  3CCJ 1;  2OZK A;  3MZL B;  2R6M A;  2PMZ A;  2LFU A;  2QEX 1;  3GTL I;  3HOY I;  2GU2 A;  4BXX I;  2JA8 I;  4E31 A;  2WAQ A;  1TWA I;  5A2Q b;  3CCQ Z;  1VQM Z;  1VQ6 Z;  1WCM I;  3H0G I;  2I3C A;  4HGY A;  2O53 A;  1M1K 2;  3CCE Z;  5FLM I;  3VB9 A;  1JWH C;  2VF1 A;  2DE6 A;  2RHB A;  3CCM 1;  2R93 I;  2JIM A;  2OTJ 1;  1L1O C;  2JIQ A;  3MON A;  4A3I I;  1Q82 2;  3NFZ A;  5T6B A;  1VQP Z;  2QEX Z;  3FQM A;  1ZB8 A;  1TWG I;  2J6A A;  4RVH A;  2PK7 A;  4BY7 I;  2QA4 1;  3I4N I;  2G2K A;  1RQF A;  1Z03 A;  3JAM b;  3IFU A;  3FQQ A;  1X0T A;  3HOU I;  3PO3 S;  3HOV I;  3CME 1;  3J80 b;  2OTJ Z;  2RIQ A;  2KI7 B;  1M90 2;  1VQK 1;  1QVG Z;  3VMG A;  1X3W A;  1ZH1 A;  1YJN 1;  3CC2 Z;  4MH4 A;  4S1T A;  4BBS I;  3S1N I;  4MRI A;  1M1K 1;  3PO2 I;  3K7A I;  1VQ5 Z;  1WII A;  5A2Q f;  1VQL 1;  3U50 C;  2NAP A;  2NVY I;  3CC4 Z;  1TWH I;  2JS4 A;  3I07 A;  4NBG A;  4E33 A;  4RS4 A;  3BG0 B;  1PFT A;  4NBF A;  4Y52 I;  3CME Z;  1Q82 1;  3S1Q I;  3CCR Z;  1QYP A;  3CQZ I;  3CMA 1;  2Y0S A;  4MD9 A;  2RT9 A;  2E7Z A;  1QVF Y;  1Q81 2;  3F3F C;  2V8J A;  4MD8 A;  1YIT Z;  4CL1 A;  4TNU A;  3CCV 1;  1SFO I;  1VQL Z;  1NP6 A;  5D1P A;  3Q87 A;  2AYD A;  1VQN 1;  2PM9 A;  3VTN A;  3JAM f;  3GTM I;  2BJO A;  2V8I A;  3CCL Z;  3GTM S;  3CC7 Z;  3J80 f;  1Q86 2;  4A3J I;  4NFR A;  3S15 I;  3CMA Z;  3S2D I;  5T64 A;  4A3F I;  2P3Y A;  3NH5 A;  1RLY A;  3OW2 Y;  1KQS Y;  2RPR A;  2VUM I;  3NH4 A;  1W2B Z;  2QR1 B;  3CCV Z;  4QTT A;  3CCU 1;  4NB9 A;  3I4M I;  5D1O A;  1Y8C A;  1ZB9 A;  3QWU A;  4X6A I;  1FDI A;  1YHQ Z;  3GTG I;  4E2Y A;  3MZK B;  1YIJ 1;  1N2F A;  1K83 I;  3S2H I;  1Q81 1;  3ESW A;  3CCJ Z;  3EED A;  1YJ9 1;  3EER A;  1Q7Y 2;  2K3R A;  5IP7 I;  1K9M 1;  1WW9 A;  3H3V J;  2F4M A;  4BBR I;  1KD1 1;  1VQ4 1;  2LEX A;  1RO0 A;  3HOW I;  3CCM Z;  4A3K I;  3CPW Y;  5FLX b;  3OW2 Z;  3T4N B;  1Q86 1;  1KQS Z;  2EGT A;  3IF8 A;  2JA6 I;  2VPW A;  1FDO A;  4MXU A;  2VPY A;  3CCS 1;  4A93 I;  2JIO A;  1YIJ Z;  4RV9 A;  3F3P C;  4QTU A;  2R92 I;  2YU9 I;  2B63 I;  1LQL A;  1JJ2 Y;  4A3L I;  2QA4 Z;  1VQ8 1;  3D9X A;  3S16 I;  3J81 b;  4NBC A;  5CM2 M;  2QKD A;  3D2L A;  1S7M A;  3GTQ I;  2RBL A;  4XX2 A;  1YUA A;  2JNY A;  1YI2 1;  4NBH A;  2GTI A;  3G4S 1;  1VQK Z;  3G6E 1;  4A3G I; 
#chains in the Genus database with same CATH homology
 1Q7Y 1;  2QRD B;  4NBE A;  3I55 1;  1YJN Z;  3NDI A;  3CPW Z;  1USP A;  2JA7 I;  5C4J I;  2K5R A;  2V8K A;  1N8R 2;  3P5J B;  5C3E I;  2JR6 A;  3GCF A;  1TWC I;  2W03 A;  2QRE B;  1KC8 2;  1QF8 A;  5T67 A;  2NVX I;  1VQ9 1;  5LL6 f;  1K8A 2;  3BG1 B;  1M90 1;  5FLX f;  3I56 1;  3M4O I;  5AN9 F;  1VQ6 1;  3GKQ A;  3J7A 4;  3M3Y I;  1VLA A;  3G6E Z;  2IZ3 A;  2NVT I;  4E32 A;  4E2Z A;  1Y1V I;  3CCE 1;  3HOX I;  3RZO I;  2GTH A;  2Q51 A;  1TWF I;  2ZAE B;  3I55 Z;  3NDJ A;  4NH1 C;  5C4X I;  1I6H I;  4Y7N I;  2IZ4 A;  3HKZ A;  1K73 2;  4HH4 A;  3TDH B;  1P9N A;  1VQN Z;  1QVF Z;  1VQ9 Z;  2QRC B;  4DGL A;  4BY1 I;  3J81 f;  3CXC Y;  1VQP 1;  2DE5 A;  2E2J I;  1Z02 A;  2LIY A;  3IX0 A;  3I56 Z;  2M48 A;  1X3Z A;  5IP9 I;  2DE7 A;  2W04 A;  1QVG Y;  1N8R 1;  3CD6 1;  4AYB A;  2P28 A;  2H85 A;  3KIH A;  3S1M I;  2E2H I;  1YJW 1;  2OTL 1;  1KC8 1;  4NB8 A;  3KIF A;  3G71 1;  3TE5 B;  3CCU Z;  1K8A 1;  1VQ7 1;  1RO4 A;  2YAD A;  1RNI A;  4HGZ A;  2HF1 A;  1TFI A;  4RVG A;  3GTK I;  3CC2 1;  1NJI 2;  2E2I I;  2KPI A;  4E2W A;  4NBD A;  1I3Q I;  2Q4Z A;  1VQ5 1;  2O4H A;  5D1O B;  3PO3 I;  1S72 1;  3CC4 1;  1YJ9 Z;  3CXC Z;  3VMH A;  1NUI A;  1K73 1;  3CD6 Z;  2OOX B;  2JA5 I;  2AKL A;  4E30 A;  4A3C I;  5IT9 b;  3GTO I;  1YUK A;  4DQY B;  1YJW Z;  3D6W A;  2OTL Z;  2M6N A;  1VQO 1;  4DK1 A;  1Z01 A;  3CCR 1;  1RO2 A;  2WB1 A;  3G71 Z;  1ML8 A;  3RZD I;  1VQ4 Z;  1VQ7 Z;  4EWC A;  2R7Z I;  1KRL A;  4NBA A;  1YIT 1;  2JMO A;  2NVQ I;  3LUS A;  1R9T I;  3CCS Z;  3HOZ I;  3S17 I;  1S72 Z;  4NBB A;  1I50 I;  3S14 I;  5C44 I;  4RVF A;  2VUG A;  3CCL 1;  2E9H A;  3CC7 1;  2QLV B;  1VQO Z;  1DL6 A;  1VQ8 Z;  1W2B Y;  1NJI 1;  4RVD A;  4MON A;  3VMI A;  1JJ2 Z;  3S1R I;  1YI2 Z;  4E2X A;  3FKI I;  4MD7 A;  3CCQ 1;  1VQM 1;  3G4S Z;  1K9M 2;  4A3E I;  3GTP I;  3GTJ I;  2OOY B;  2F4O A;  1KD1 2;  1Y1V S;  2HU9 A;  5IT9 f;  3NH8 A;  1YHQ 1;  4A3B I;  1Y1W I;  4A3M I;  4A3D I;  1USP B;  2JUB A;  4NOZ A;  3CCJ 1;  2OZK A;  3MZL B;  2R6M A;  2PMZ A;  2LFU A;  2QEX 1;  3GTL I;  3HOY I;  2GU2 A;  4BXX I;  2JA8 I;  4E31 A;  2WAQ A;  1TWA I;  5A2Q b;  3CCQ Z;  1VQM Z;  1VQ6 Z;  1WCM I;  3H0G I;  2I3C A;  4HGY A;  2O53 A;  1M1K 2;  3CCE Z;  5FLM I;  3VB9 A;  1JWH C;  2VF1 A;  2DE6 A;  2RHB A;  3CCM 1;  2R93 I;  2OTJ 1;  1L1O C;  3MON A;  4A3I I;  1Q82 2;  3NFZ A;  5T6B A;  1VQP Z;  2QEX Z;  3FQM A;  1ZB8 A;  1TWG I;  2J6A A;  4RVH A;  2PK7 A;  4BY7 I;  2QA4 1;  3I4N I;  2G2K A;  1RQF A;  1Z03 A;  3JAM b;  3IFU A;  3FQQ A;  1X0T A;  3HOU I;  3PO3 S;  3HOV I;  3CME 1;  3J80 b;  2OTJ Z;  2RIQ A;  2KI7 B;  1M90 2;  1VQK 1;  1QVG Z;  3VMG A;  1X3W A;  1ZH1 A;  1YJN 1;  3CC2 Z;  4MH4 A;  4S1T A;  4BBS I;  3S1N I;  4MRI A;  1M1K 1;  3PO2 I;  3K7A I;  1VQ5 Z;  1WII A;  5A2Q f;  1VQL 1;  3U50 C;  2NVY I;  3CC4 Z;  1TWH I;  2JS4 A;  3I07 A;  4NBG A;  4E33 A;  4RS4 A;  3BG0 B;  1PFT A;  4NBF A;  4Y52 I;  3CME Z;  1Q82 1;  3S1Q I;  3CCR Z;  1QYP A;  3CQZ I;  3CMA 1;  2Y0S A;  4MD9 A;  2RT9 A;  1QVF Y;  1Q81 2;  3F3F C;  2V8J A;  4MD8 A;  1YIT Z;  4CL1 A;  4TNU A;  3CCV 1;  1SFO I;  1VQL Z;  1NP6 A;  5D1P A;  3Q87 A;  1VQN 1;  2PM9 A;  3VTN A;  3JAM f;  3GTM I;  2BJO A;  2V8I A;  3CCL Z;  3GTM S;  3CC7 Z;  3J80 f;  1Q86 2;  4A3J I;  4NFR A;  3S15 I;  3CMA Z;  3S2D I;  5T64 A;  4A3F I;  2P3Y A;  3NH5 A;  1RLY A;  3OW2 Y;  1KQS Y;  2RPR A;  2VUM I;  3NH4 A;  1W2B Z;  2QR1 B;  3CCV Z;  4QTT A;  3CCU 1;  4NB9 A;  3I4M I;  5D1O A;  1ZB9 A;  3QWU A;  4X6A I;  1YHQ Z;  3GTG I;  4E2Y A;  3MZK B;  1YIJ 1;  1N2F A;  1K83 I;  3S2H I;  1Q81 1;  3ESW A;  3CCJ Z;  3EED A;  1YJ9 1;  3EER A;  1Q7Y 2;  2K3R A;  5IP7 I;  1K9M 1;  1WW9 A;  3H3V J;  2F4M A;  4BBR I;  1KD1 1;  1VQ4 1;  1RO0 A;  3HOW I;  3CCM Z;  4A3K I;  3CPW Y;  5FLX b;  3OW2 Z;  3T4N B;  1Q86 1;  1KQS Z;  2EGT A;  3IF8 A;  2JA6 I;  4MXU A;  3CCS 1;  4A93 I;  1YIJ Z;  4RV9 A;  3F3P C;  4QTU A;  2R92 I;  2YU9 I;  2B63 I;  1LQL A;  1JJ2 Y;  4A3L I;  2QA4 Z;  1VQ8 1;  3D9X A;  3S16 I;  3J81 b;  4NBC A;  5CM2 M;  2QKD A;  1S7M A;  3GTQ I;  2RBL A;  4XX2 A;  1YUA A;  2JNY A;  1YI2 1;  4NBH A;  2GTI A;  3G4S 1;  1VQK Z;  3G6E 1;  4A3G I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...