1RLYA

Rdc-derived models of the zinc ribbon domain of human general transcription tfiib (zinc bound structures)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
58
structure length
58
Chain Sequence
b'ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor IIB
publication title Probing Zn2+-binding effects on the zinc-ribbon domain of human general transcription factor TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 1
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rlyA00
1DL6A 1QYPA 1USPB 3S15I 3GTGI 1ZB9A 3GTMI 3EERA 2F4MA 3H0GI 3I4MI 3GTMS 2JS4A 2PK7A 3FKII 3S14I 4A3LI 4A3KI 2AKLA 1I6HI 3S1MI 1RO4A 3Q87A 2NVYI 3VMIA 1PFTA 5C4XI 2DE6A 4NBBA 1TWAI 1Y1VI 2P3YA 2E2II 2JA8I 3RZDI 3VMHA 3S1NI 3ESWA 3S2DI 1X3ZA 4A93I 2JR6A 4NBFA 2R93I 2B63I 1NUIA 4NB9A 4A3FI 3GTQI 2BJOA 1USPA 3I07A 1WCMI 3VB9A 3S2HI 2DE5A 5C4JI 3GTKI 4A3BI 4QTTA 3LUSA 2E2JI 2HF1A 1WW9A 4NB8A 3GKQA 4QTUA 5FLMI 3HOWI 4X6AI 3S1QI 5C3EI 2RBLA 4BXXI 2K5RA 1TWFI 1RLYA 2R92I 3GTOI 3VMGA 3HOYI 3PO2I 3HOUI 4A3MI 1VLAA 2E2HI 3U50C 2J6AA 2JA5I 4NBAA 5IP7I 2NVTI 1I3QI 1TWCI 4XX2A 1X3WA 3HOZI 2YU9I 2DE7A 4Y7NI 1TFIA 3S1RI 1TWHI 3M4OI 2JA7I 3RZOI 3K7AI 3S16I 4A3GI 4Y52I 1LQLA 2JA6I 2JNYA 2NVQI 3PO3I 4A3DI 4NBHA 4A3JI 2R7ZI 1ZB8A 3D6WA 3I4NI 3PO3S 4NBEA 3M3YI 2F4OA 3HOVI 1I50I 3CQZI 1SFOI 4A3CI 2VUMI 3GTPI 4BBSI 4MH4A 4BY7I 4BBRI 1TWGI 5CM2M 1N2FA 1YUAA 3GTJI 1L1OC 1R9TI 4NBDA 3S17I 3HOXI 3H3VJ 4A3EI 2KPIA 1Y1WI 1ML8A 4NOZA 4A3II 3GTLI 4NBGA 4BY1I 5IP9I 1K83I 5C44I 1Y1VS 3GCFA 4NBCA 2NVXI
chains in the Genus database with same CATH superfamily
1DL6A 2JIRA 1YIT1 2AYDA 1USPB 3GTGI 1Y8CA 1ZB9A 2RPRA 3H0GI 3CME1 3GTMS 2G2KA 3CCE1 3D2LA 3FKII 1VQN1 5C4XI 4TNUA 1RQFA 2JIQA 2E2II 3G6E1 3S2DI 4A93I 2QKDA 4NBFA 2B63I 2V45A 4RVDA 2OTL1 1WCMI 1X0TA 4QTTA 3IR7A 4NB8A 2JIOA 3HOWI 2VPXA 4HGZA 2GTIA 4BXXI 2RIQA 2JIPA 2QRDB 2VPWA 3F3PC 3HOYI 2PMZA 2E2HI 3U50C 2KI7B 4E2YA 3CCUZ 2DE7A 4HGYA 4Y7NI 1TFIA 1Q7Y2 3S1RI 2RHBA 2V8JA 2I3CA 3K7AI 5T67A 4E2WA 4E2ZA 1KQSY 4A3GI 2QREB 1Q822 1SIWA 3PO3I 3F3FC 2R7ZI 3D6WA 3OW2Y 3IF8A 1Q811 2GTHA 4DK1A 1YI21 2VUMI 1Q7Y1 1VQP1 3G71Z 1Z01A 4MRIA 2R6MA 1Q821 1N2FA 1YUAA 3GTJI 3CXCY 3G4SZ 2O4HA 3CMAZ 3CC41 3HOXI 1QVFZ 4A3EI 1YITZ 2V8KA 1NP6A 1Y1WI 4NFRA 4NOZA 2LFUA 1K732 1VQ71 4BY1I 1K83I 2PM9A 4E31A 3CMEZ 2GU2A 1NJI1 1K8A2 2WAQA 3S15I 5T64A 5IT9b 2JS4A 1QVGY 1I6HI 1WZNA 3VMIA 1PFTA 2V3VA 1VQ91 1YIJ1 2OTLZ 1K8A1 3MZLB 3CC71 5LL6f 3RZDI 1KRLA 3VMHA 3S1NI 2YADA 1RO0A 1Q16A 3BG1B 2R93I 4NB9A 2IZ3A 4MXUA 3T4NB 3I561 3I07A 5C4JI 1S721 2OTJ1 4RVHA 2HF1A 3NH8A 1K9M2 1AA6A 5FLMI 3GKQA 4QTUA 1M901 3J80b 2RBLA 1VQ6Z 3CCJ1 2K5RA 2R92I 1S7MA 3CPWZ 1VQ41 3HOUI 3CD6Z 1M1K2 1VQLZ 1KC82 3I55Z 3P5JB 2J6AA 1K9M1 5IP7I 1I3QI 3CCL1 1JJ2Y 1YJN1 1YI2Z 3RZOI 3VTNA 3S16I 2OOXB 3MONA 1Z03A 2JA6I 2JNYA 3NDJA 2P28A 1M1K1 4NBHA 1YHQZ 4RV9A 1ZB8A 1KC81 3PO3S 4NBEA 2QA41 3M3YI 3CQZI 1VQ51 4S1TA 1SFOI 1VQK1 3GTPI 4BY7I 5D1OA 3TE5B 2V8IA 3NH5A 1L1OC 3CCQ1 1W2BZ 3MZKB 4MD9A 1VQM1 2WB1A 4A3II 4MD8A 2Q4ZA 4NBGA 1Z02A 5C44I 1Y1VS 3J7A4 4NBCA 1QYPA 4RS4A 3CCRZ 3D9XA 1VQ8Z 4RVFA 1VQ9Z 2HU9A 4AYBA 3JAMb 1P9NA 3EERA 1QF8A 1YJWZ 2F4MA 1Q862 3I4MI 3CC21 2IZ4A 4A3LI 3HKZA 1FDOA 1N8R2 3I56Z 2QRCB 1TWAI 1Y1VI 5A2Qb 1S72Z 2OTJZ 2JA8I 2RT9A 3FQQA 5IT9f 3ESWA 3CCEZ 1YUKA 5FLXb 1Q861 1VQNZ 1NUIA 2H85A 3KIHA 3GTQI 4E33A 1USPA 3VB9A 3CCJZ 1N8R1 2DE5A 4A3BI 1K731 3G6EZ 2E2JI 2M6NA 1WW9A 4X6AI 5AN9F 2JIMA 5C3EI 3CCLZ 3CCU1 3BG0B 2E9HA 1RLYA 1YJNZ 3PO2I 3NH4A 3CCM1 2JA5I 2O53A 4NBAA 1QVFY 2VUGA 1X3WA 3HOZI 3J80f 2YU9I 3FQMA 1TWHI 1VQO1 4MONA 1VQ5Z 4EWCA 3EEDA 3G711 4A3DI 4A3JI 2LEXA 1ZH1A 3G4S1 2F4OA 3HOVI 2OZKA 3CCQZ 2EGTA 2QEX1 3CCS1 3CCV1 4CL1A 4A3CI 1VQMZ 1RO2A 2VF1A 3J81b 2LIYA 4MH4A 4HH4A 4DGLA 1TWGI 1R9TI 2KPIA 1ML8A 1WJ2A 1VQPZ 4E30A 4RVGA 5IP9I 1KQSZ 3CC2Z 2IV2X 3QWUA 2NVXI 3CC4Z 2QLVB 3OW2Z 1QXFA 1YJ91 1VQ7Z 3GTMI 1KD12 2ZAEB 4MD7A 2PK7A 3S14I 4A3KI 2AKLA 3NFZA 3S1MI 1RO4A 3Q87A 2NVYI 1WIIA 5D1PA 3CPWY 3CXCZ 2DE6A 4NBBA 2JUBA 2P3YA 3JAMf 1X3ZA 2Y0SA 1RNIA 2JR6A 2NAPA 1KD11 1Q812 4A3FI 2BJOA 1YIJZ 1VQ61 3S2HI 3GTKI 2K3RA 3LUSA 3CC7Z 5A2Qf 3CD61 3CCMZ 2QR1B 1VQL1 3I551 3S1QI 2JMOA 5FLXf 1QVGZ 2E7ZA 2OOYB 1TWFI 3GTOI 2W03A 1VQOZ 3VMGA 2VPZA 4A3MI 1VLAA 2M48A 3KIFA 1NJI2 2NVTI 5D1OB 1YHQ1 1W2BY 1TWCI 4DQYB 4XX2A 4E32A 3M4OI 2JA7I 2QEXZ 3CCSZ 3CCVZ 1VQ4Z 4Y52I 1LQLA 2NVQI 3IFUA 3I4NI 1FDIA 1I50I 4BBSI 2Q51A 4NH1C 2W04A 3NDIA 4BBRI 5CM2M 2QA4Z 3S17I 4NBDA 3CCR1 3H3VJ 1VQ81 2VPYA 1JJ2Z 1VQKZ 1JWHC 1YJ9Z 4E2XA 3GTLI 1YJW1 3J81f 3TDHB 1M902 5T6BA 3GCFA 3CMA1 3IX0A
chains in the Genus database with same CATH topology
1DL6A 1YIT1 1USPB 3GTGI 1ZB9A 2RPRA 3H0GI 3CME1 3GTMS 2G2KA 3CCE1 3FKII 1VQN1 5C4XI 4TNUA 1RQFA 2E2II 3G6E1 3S2DI 4A93I 2QKDA 4NBFA 2B63I 4RVDA 2OTL1 1WCMI 1X0TA 4QTTA 4NB8A 3HOWI 4HGZA 2GTIA 4BXXI 2RIQA 2QRDB 3F3PC 3HOYI 2PMZA 2E2HI 3U50C 2KI7B 4E2YA 3CCUZ 2DE7A 4HGYA 4Y7NI 1TFIA 1Q7Y2 3S1RI 2RHBA 2V8JA 2I3CA 3K7AI 5T67A 4E2WA 4E2ZA 1KQSY 4A3GI 2QREB 1Q822 3PO3I 3F3FC 2R7ZI 3D6WA 3OW2Y 3IF8A 1Q811 2GTHA 4DK1A 1YI21 2VUMI 1Q7Y1 1VQP1 3G71Z 1Z01A 4MRIA 2R6MA 1Q821 1N2FA 1YUAA 3GTJI 3CXCY 3G4SZ 2O4HA 3CMAZ 3CC41 3HOXI 1QVFZ 4A3EI 1YITZ 2V8KA 1NP6A 1Y1WI 4NFRA 4NOZA 2LFUA 1K732 1VQ71 4BY1I 1K83I 2PM9A 4E31A 3CMEZ 2GU2A 1NJI1 1K8A2 2WAQA 3S15I 5T64A 5IT9b 2JS4A 1QVGY 1I6HI 3VMIA 1PFTA 1VQ91 1YIJ1 2OTLZ 1K8A1 3MZLB 3CC71 5LL6f 3RZDI 1KRLA 3VMHA 3S1NI 2YADA 1RO0A 3BG1B 2R93I 4NB9A 2IZ3A 4MXUA 3T4NB 3I561 3I07A 5C4JI 1S721 2OTJ1 4RVHA 2HF1A 3NH8A 1K9M2 5FLMI 3GKQA 4QTUA 1M901 3J80b 2RBLA 1VQ6Z 3CCJ1 2K5RA 2R92I 1S7MA 3CPWZ 1VQ41 3HOUI 3CD6Z 1M1K2 1VQLZ 1KC82 3I55Z 3P5JB 2J6AA 1K9M1 5IP7I 1I3QI 3CCL1 1JJ2Y 1YJN1 1YI2Z 3RZOI 3VTNA 3S16I 2OOXB 3MONA 1Z03A 2JA6I 2JNYA 3NDJA 2P28A 1M1K1 4NBHA 1YHQZ 4RV9A 1ZB8A 1KC81 3PO3S 4NBEA 2QA41 3M3YI 3CQZI 1VQ51 4S1TA 1SFOI 1VQK1 3GTPI 4BY7I 5D1OA 3TE5B 2V8IA 3NH5A 1L1OC 3CCQ1 1W2BZ 3MZKB 4MD9A 1VQM1 2WB1A 4A3II 4MD8A 2Q4ZA 4NBGA 1Z02A 5C44I 1Y1VS 3J7A4 4NBCA 1QYPA 4RS4A 3CCRZ 3D9XA 1VQ8Z 4RVFA 1VQ9Z 2HU9A 4AYBA 3JAMb 1P9NA 3EERA 1QF8A 1YJWZ 2F4MA 1Q862 3I4MI 3CC21 2IZ4A 4A3LI 3HKZA 1N8R2 3I56Z 2QRCB 1TWAI 1Y1VI 5A2Qb 1S72Z 2OTJZ 2JA8I 2RT9A 3FQQA 5IT9f 3ESWA 3CCEZ 1YUKA 5FLXb 1Q861 1VQNZ 1NUIA 2H85A 3KIHA 3GTQI 4E33A 1USPA 3VB9A 3CCJZ 1N8R1 2DE5A 4A3BI 1K731 3G6EZ 2E2JI 2M6NA 1WW9A 4X6AI 5AN9F 5C3EI 3CCLZ 3CCU1 3BG0B 2E9HA 1RLYA 1YJNZ 3PO2I 3NH4A 3CCM1 2JA5I 2O53A 4NBAA 1QVFY 2VUGA 1X3WA 3HOZI 3J80f 2YU9I 3FQMA 1TWHI 1VQO1 4MONA 1VQ5Z 4EWCA 3EEDA 3G711 4A3DI 4A3JI 1ZH1A 3G4S1 2F4OA 3HOVI 2OZKA 3CCQZ 2EGTA 2QEX1 3CCS1 3CCV1 4CL1A 4A3CI 1VQMZ 1RO2A 2VF1A 3J81b 2LIYA 4MH4A 4HH4A 4DGLA 1TWGI 1R9TI 2KPIA 1ML8A 1VQPZ 4E30A 4RVGA 5IP9I 1KQSZ 3CC2Z 3QWUA 2NVXI 3CC4Z 2QLVB 3OW2Z 1YJ91 1VQ7Z 3GTMI 1KD12 2ZAEB 4MD7A 2PK7A 3S14I 4A3KI 2AKLA 3NFZA 3S1MI 1RO4A 3Q87A 2NVYI 1WIIA 5D1PA 3CPWY 3CXCZ 2DE6A 4NBBA 2JUBA 2P3YA 3JAMf 1X3ZA 2Y0SA 2JR6A 1RNIA 1KD11 1Q812 4A3FI 2BJOA 1YIJZ 1VQ61 3S2HI 3GTKI 2K3RA 3LUSA 3CC7Z 5A2Qf 3CD61 3CCMZ 2QR1B 1VQL1 3I551 3S1QI 2JMOA 5FLXf 1QVGZ 2OOYB 1TWFI 3GTOI 2W03A 1VQOZ 3VMGA 4A3MI 1VLAA 2M48A 3KIFA 1NJI2 2NVTI 5D1OB 1YHQ1 1W2BY 1TWCI 4DQYB 4XX2A 4E32A 3M4OI 2JA7I 2QEXZ 3CCSZ 3CCVZ 1VQ4Z 4Y52I 1LQLA 2NVQI 3IFUA 3I4NI 1I50I 4BBSI 2Q51A 4NH1C 2W04A 3NDIA 4BBRI 5CM2M 2QA4Z 3S17I 4NBDA 3CCR1 3H3VJ 1VQ81 1JJ2Z 1VQKZ 1JWHC 1YJ9Z 4E2XA 3GTLI 1YJW1 3J81f 3TDHB 1M902 5T6BA 3GCFA 3CMA1 3IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DL6 A;  1QYP A;  1USP B;  3S15 I;  3GTG I;  1ZB9 A;  3GTM I;  3EER A;  2F4M A;  3H0G I;  3I4M I;  3GTM S;  2JS4 A;  2PK7 A;  3FKI I;  3S14 I;  4A3L I;  4A3K I;  2AKL A;  1I6H I;  3S1M I;  1RO4 A;  3Q87 A;  2NVY I;  3VMI A;  1PFT A;  5C4X I;  2DE6 A;  4NBB A;  1TWA I;  1Y1V I;  2P3Y A;  2E2I I;  2JA8 I;  3RZD I;  3VMH A;  3S1N I;  3ESW A;  3S2D I;  1X3Z A;  4A93 I;  2JR6 A;  4NBF A;  2R93 I;  2B63 I;  1NUI A;  4NB9 A;  4A3F I;  3GTQ I;  2BJO A;  1USP A;  3I07 A;  1WCM I;  3VB9 A;  3S2H I;  2DE5 A;  5C4J I;  3GTK I;  4A3B I;  4QTT A;  3LUS A;  2E2J I;  2HF1 A;  1WW9 A;  4NB8 A;  3GKQ A;  4QTU A;  5FLM I;  3HOW I;  4X6A I;  3S1Q I;  5C3E I;  2RBL A;  4BXX I;  2K5R A;  1TWF I;  1RLY A;  2R92 I;  3GTO I;  3VMG A;  3HOY I;  3PO2 I;  3HOU I;  4A3M I;  1VLA A;  2E2H I;  3U50 C;  2J6A A;  2JA5 I;  4NBA A;  5IP7 I;  2NVT I;  1I3Q I;  1TWC I;  4XX2 A;  1X3W A;  3HOZ I;  2YU9 I;  2DE7 A;  4Y7N I;  1TFI A;  3S1R I;  1TWH I;  3M4O I;  2JA7 I;  3RZO I;  3K7A I;  3S16 I;  4A3G I;  4Y52 I;  1LQL A;  2JA6 I;  2JNY A;  2NVQ I;  3PO3 I;  4A3D I;  4NBH A;  4A3J I;  2R7Z I;  1ZB8 A;  3D6W A;  3I4N I;  3PO3 S;  4NBE A;  3M3Y I;  2F4O A;  3HOV I;  1I50 I;  3CQZ I;  1SFO I;  4A3C I;  2VUM I;  3GTP I;  4BBS I;  4MH4 A;  4BY7 I;  4BBR I;  1TWG I;  5CM2 M;  1N2F A;  1YUA A;  3GTJ I;  1L1O C;  1R9T I;  4NBD A;  3S17 I;  3HOX I;  3H3V J;  4A3E I;  2KPI A;  1Y1W I;  1ML8 A;  4NOZ A;  4A3I I;  3GTL I;  4NBG A;  4BY1 I;  5IP9 I;  1K83 I;  5C44 I;  1Y1V S;  3GCF A;  4NBC A;  2NVX I; 
#chains in the Genus database with same CATH topology
 1DL6 A;  2JIR A;  1YIT 1;  2AYD A;  1USP B;  3GTG I;  1Y8C A;  1ZB9 A;  2RPR A;  3H0G I;  3CME 1;  3GTM S;  2G2K A;  3CCE 1;  3D2L A;  3FKI I;  1VQN 1;  5C4X I;  4TNU A;  1RQF A;  2JIQ A;  2E2I I;  3G6E 1;  3S2D I;  4A93 I;  2QKD A;  4NBF A;  2B63 I;  2V45 A;  4RVD A;  2OTL 1;  1WCM I;  1X0T A;  4QTT A;  3IR7 A;  4NB8 A;  2JIO A;  3HOW I;  2VPX A;  4HGZ A;  2GTI A;  4BXX I;  2RIQ A;  2JIP A;  2QRD B;  2VPW A;  3F3P C;  3HOY I;  2PMZ A;  2E2H I;  3U50 C;  2KI7 B;  4E2Y A;  3CCU Z;  2DE7 A;  4HGY A;  4Y7N I;  1TFI A;  1Q7Y 2;  3S1R I;  2RHB A;  2V8J A;  2I3C A;  3K7A I;  5T67 A;  4E2W A;  4E2Z A;  1KQS Y;  4A3G I;  2QRE B;  1Q82 2;  1SIW A;  3PO3 I;  3F3F C;  2R7Z I;  3D6W A;  3OW2 Y;  3IF8 A;  1Q81 1;  2GTH A;  4DK1 A;  1YI2 1;  2VUM I;  1Q7Y 1;  1VQP 1;  3G71 Z;  1Z01 A;  4MRI A;  2R6M A;  1Q82 1;  1N2F A;  1YUA A;  3GTJ I;  3CXC Y;  3G4S Z;  2O4H A;  3CMA Z;  3CC4 1;  3HOX I;  1QVF Z;  4A3E I;  1YIT Z;  2V8K A;  1NP6 A;  1Y1W I;  4NFR A;  4NOZ A;  2LFU A;  1K73 2;  1VQ7 1;  4BY1 I;  1K83 I;  2PM9 A;  4E31 A;  3CME Z;  2GU2 A;  1NJI 1;  1K8A 2;  2WAQ A;  3S15 I;  5T64 A;  5IT9 b;  2JS4 A;  1QVG Y;  1I6H I;  1WZN A;  3VMI A;  1PFT A;  2V3V A;  1VQ9 1;  1YIJ 1;  2OTL Z;  1K8A 1;  3MZL B;  3CC7 1;  5LL6 f;  3RZD I;  1KRL A;  3VMH A;  3S1N I;  2YAD A;  1RO0 A;  1Q16 A;  3BG1 B;  2R93 I;  4NB9 A;  2IZ3 A;  4MXU A;  3T4N B;  3I56 1;  3I07 A;  5C4J I;  1S72 1;  2OTJ 1;  4RVH A;  2HF1 A;  3NH8 A;  1K9M 2;  1AA6 A;  5FLM I;  3GKQ A;  4QTU A;  1M90 1;  3J80 b;  2RBL A;  1VQ6 Z;  3CCJ 1;  2K5R A;  2R92 I;  1S7M A;  3CPW Z;  1VQ4 1;  3HOU I;  3CD6 Z;  1M1K 2;  1VQL Z;  1KC8 2;  3I55 Z;  3P5J B;  2J6A A;  1K9M 1;  5IP7 I;  1I3Q I;  3CCL 1;  1JJ2 Y;  1YJN 1;  1YI2 Z;  3RZO I;  3VTN A;  3S16 I;  2OOX B;  3MON A;  1Z03 A;  2JA6 I;  2JNY A;  3NDJ A;  2P28 A;  1M1K 1;  4NBH A;  1YHQ Z;  4RV9 A;  1ZB8 A;  1KC8 1;  3PO3 S;  4NBE A;  2QA4 1;  3M3Y I;  3CQZ I;  1VQ5 1;  4S1T A;  1SFO I;  1VQK 1;  3GTP I;  4BY7 I;  5D1O A;  3TE5 B;  2V8I A;  3NH5 A;  1L1O C;  3CCQ 1;  1W2B Z;  3MZK B;  4MD9 A;  1VQM 1;  2WB1 A;  4A3I I;  4MD8 A;  2Q4Z A;  4NBG A;  1Z02 A;  5C44 I;  1Y1V S;  3J7A 4;  4NBC A;  1QYP A;  4RS4 A;  3CCR Z;  3D9X A;  1VQ8 Z;  4RVF A;  1VQ9 Z;  2HU9 A;  4AYB A;  3JAM b;  1P9N A;  3EER A;  1QF8 A;  1YJW Z;  2F4M A;  1Q86 2;  3I4M I;  3CC2 1;  2IZ4 A;  4A3L I;  3HKZ A;  1FDO A;  1N8R 2;  3I56 Z;  2QRC B;  1TWA I;  1Y1V I;  5A2Q b;  1S72 Z;  2OTJ Z;  2JA8 I;  2RT9 A;  3FQQ A;  5IT9 f;  3ESW A;  3CCE Z;  1YUK A;  5FLX b;  1Q86 1;  1VQN Z;  1NUI A;  2H85 A;  3KIH A;  3GTQ I;  4E33 A;  1USP A;  3VB9 A;  3CCJ Z;  1N8R 1;  2DE5 A;  4A3B I;  1K73 1;  3G6E Z;  2E2J I;  2M6N A;  1WW9 A;  4X6A I;  5AN9 F;  2JIM A;  5C3E I;  3CCL Z;  3CCU 1;  3BG0 B;  2E9H A;  1RLY A;  1YJN Z;  3PO2 I;  3NH4 A;  3CCM 1;  2JA5 I;  2O53 A;  4NBA A;  1QVF Y;  2VUG A;  1X3W A;  3HOZ I;  3J80 f;  2YU9 I;  3FQM A;  1TWH I;  1VQO 1;  4MON A;  1VQ5 Z;  4EWC A;  3EED A;  3G71 1;  4A3D I;  4A3J I;  2LEX A;  1ZH1 A;  3G4S 1;  2F4O A;  3HOV I;  2OZK A;  3CCQ Z;  2EGT A;  2QEX 1;  3CCS 1;  3CCV 1;  4CL1 A;  4A3C I;  1VQM Z;  1RO2 A;  2VF1 A;  3J81 b;  2LIY A;  4MH4 A;  4HH4 A;  4DGL A;  1TWG I;  1R9T I;  2KPI A;  1ML8 A;  1WJ2 A;  1VQP Z;  4E30 A;  4RVG A;  5IP9 I;  1KQS Z;  3CC2 Z;  2IV2 X;  3QWU A;  2NVX I;  3CC4 Z;  2QLV B;  3OW2 Z;  1QXF A;  1YJ9 1;  1VQ7 Z;  3GTM I;  1KD1 2;  2ZAE B;  4MD7 A;  2PK7 A;  3S14 I;  4A3K I;  2AKL A;  3NFZ A;  3S1M I;  1RO4 A;  3Q87 A;  2NVY I;  1WII A;  5D1P A;  3CPW Y;  3CXC Z;  2DE6 A;  4NBB A;  2JUB A;  2P3Y A;  3JAM f;  1X3Z A;  2Y0S A;  1RNI A;  2JR6 A;  2NAP A;  1KD1 1;  1Q81 2;  4A3F I;  2BJO A;  1YIJ Z;  1VQ6 1;  3S2H I;  3GTK I;  2K3R A;  3LUS A;  3CC7 Z;  5A2Q f;  3CD6 1;  3CCM Z;  2QR1 B;  1VQL 1;  3I55 1;  3S1Q I;  2JMO A;  5FLX f;  1QVG Z;  2E7Z A;  2OOY B;  1TWF I;  3GTO I;  2W03 A;  1VQO Z;  3VMG A;  2VPZ A;  4A3M I;  1VLA A;  2M48 A;  3KIF A;  1NJI 2;  2NVT I;  5D1O B;  1YHQ 1;  1W2B Y;  1TWC I;  4DQY B;  4XX2 A;  4E32 A;  3M4O I;  2JA7 I;  2QEX Z;  3CCS Z;  3CCV Z;  1VQ4 Z;  4Y52 I;  1LQL A;  2NVQ I;  3IFU A;  3I4N I;  1FDI A;  1I50 I;  4BBS I;  2Q51 A;  4NH1 C;  2W04 A;  3NDI A;  4BBR I;  5CM2 M;  2QA4 Z;  3S17 I;  4NBD A;  3CCR 1;  3H3V J;  1VQ8 1;  2VPY A;  1JJ2 Z;  1VQK Z;  1JWH C;  1YJ9 Z;  4E2X A;  3GTL I;  1YJW 1;  3J81 f;  3TDH B;  1M90 2;  5T6B A;  3GCF A;  3CMA 1;  3IX0 A; 
#chains in the Genus database with same CATH homology
 1DL6 A;  1YIT 1;  1USP B;  3GTG I;  1ZB9 A;  2RPR A;  3H0G I;  3CME 1;  3GTM S;  2G2K A;  3CCE 1;  3FKI I;  1VQN 1;  5C4X I;  4TNU A;  1RQF A;  2E2I I;  3G6E 1;  3S2D I;  4A93 I;  2QKD A;  4NBF A;  2B63 I;  4RVD A;  2OTL 1;  1WCM I;  1X0T A;  4QTT A;  4NB8 A;  3HOW I;  4HGZ A;  2GTI A;  4BXX I;  2RIQ A;  2QRD B;  3F3P C;  3HOY I;  2PMZ A;  2E2H I;  3U50 C;  2KI7 B;  4E2Y A;  3CCU Z;  2DE7 A;  4HGY A;  4Y7N I;  1TFI A;  1Q7Y 2;  3S1R I;  2RHB A;  2V8J A;  2I3C A;  3K7A I;  5T67 A;  4E2W A;  4E2Z A;  1KQS Y;  4A3G I;  2QRE B;  1Q82 2;  3PO3 I;  3F3F C;  2R7Z I;  3D6W A;  3OW2 Y;  3IF8 A;  1Q81 1;  2GTH A;  4DK1 A;  1YI2 1;  2VUM I;  1Q7Y 1;  1VQP 1;  3G71 Z;  1Z01 A;  4MRI A;  2R6M A;  1Q82 1;  1N2F A;  1YUA A;  3GTJ I;  3CXC Y;  3G4S Z;  2O4H A;  3CMA Z;  3CC4 1;  3HOX I;  1QVF Z;  4A3E I;  1YIT Z;  2V8K A;  1NP6 A;  1Y1W I;  4NFR A;  4NOZ A;  2LFU A;  1K73 2;  1VQ7 1;  4BY1 I;  1K83 I;  2PM9 A;  4E31 A;  3CME Z;  2GU2 A;  1NJI 1;  1K8A 2;  2WAQ A;  3S15 I;  5T64 A;  5IT9 b;  2JS4 A;  1QVG Y;  1I6H I;  3VMI A;  1PFT A;  1VQ9 1;  1YIJ 1;  2OTL Z;  1K8A 1;  3MZL B;  3CC7 1;  5LL6 f;  3RZD I;  1KRL A;  3VMH A;  3S1N I;  2YAD A;  1RO0 A;  3BG1 B;  2R93 I;  4NB9 A;  2IZ3 A;  4MXU A;  3T4N B;  3I56 1;  3I07 A;  5C4J I;  1S72 1;  2OTJ 1;  4RVH A;  2HF1 A;  3NH8 A;  1K9M 2;  5FLM I;  3GKQ A;  4QTU A;  1M90 1;  3J80 b;  2RBL A;  1VQ6 Z;  3CCJ 1;  2K5R A;  2R92 I;  1S7M A;  3CPW Z;  1VQ4 1;  3HOU I;  3CD6 Z;  1M1K 2;  1VQL Z;  1KC8 2;  3I55 Z;  3P5J B;  2J6A A;  1K9M 1;  5IP7 I;  1I3Q I;  3CCL 1;  1JJ2 Y;  1YJN 1;  1YI2 Z;  3RZO I;  3VTN A;  3S16 I;  2OOX B;  3MON A;  1Z03 A;  2JA6 I;  2JNY A;  3NDJ A;  2P28 A;  1M1K 1;  4NBH A;  1YHQ Z;  4RV9 A;  1ZB8 A;  1KC8 1;  3PO3 S;  4NBE A;  2QA4 1;  3M3Y I;  3CQZ I;  1VQ5 1;  4S1T A;  1SFO I;  1VQK 1;  3GTP I;  4BY7 I;  5D1O A;  3TE5 B;  2V8I A;  3NH5 A;  1L1O C;  3CCQ 1;  1W2B Z;  3MZK B;  4MD9 A;  1VQM 1;  2WB1 A;  4A3I I;  4MD8 A;  2Q4Z A;  4NBG A;  1Z02 A;  5C44 I;  1Y1V S;  3J7A 4;  4NBC A;  1QYP A;  4RS4 A;  3CCR Z;  3D9X A;  1VQ8 Z;  4RVF A;  1VQ9 Z;  2HU9 A;  4AYB A;  3JAM b;  1P9N A;  3EER A;  1QF8 A;  1YJW Z;  2F4M A;  1Q86 2;  3I4M I;  3CC2 1;  2IZ4 A;  4A3L I;  3HKZ A;  1N8R 2;  3I56 Z;  2QRC B;  1TWA I;  1Y1V I;  5A2Q b;  1S72 Z;  2OTJ Z;  2JA8 I;  2RT9 A;  3FQQ A;  5IT9 f;  3ESW A;  3CCE Z;  1YUK A;  5FLX b;  1Q86 1;  1VQN Z;  1NUI A;  2H85 A;  3KIH A;  3GTQ I;  4E33 A;  1USP A;  3VB9 A;  3CCJ Z;  1N8R 1;  2DE5 A;  4A3B I;  1K73 1;  3G6E Z;  2E2J I;  2M6N A;  1WW9 A;  4X6A I;  5AN9 F;  5C3E I;  3CCL Z;  3CCU 1;  3BG0 B;  2E9H A;  1RLY A;  1YJN Z;  3PO2 I;  3NH4 A;  3CCM 1;  2JA5 I;  2O53 A;  4NBA A;  1QVF Y;  2VUG A;  1X3W A;  3HOZ I;  3J80 f;  2YU9 I;  3FQM A;  1TWH I;  1VQO 1;  4MON A;  1VQ5 Z;  4EWC A;  3EED A;  3G71 1;  4A3D I;  4A3J I;  1ZH1 A;  3G4S 1;  2F4O A;  3HOV I;  2OZK A;  3CCQ Z;  2EGT A;  2QEX 1;  3CCS 1;  3CCV 1;  4CL1 A;  4A3C I;  1VQM Z;  1RO2 A;  2VF1 A;  3J81 b;  2LIY A;  4MH4 A;  4HH4 A;  4DGL A;  1TWG I;  1R9T I;  2KPI A;  1ML8 A;  1VQP Z;  4E30 A;  4RVG A;  5IP9 I;  1KQS Z;  3CC2 Z;  3QWU A;  2NVX I;  3CC4 Z;  2QLV B;  3OW2 Z;  1YJ9 1;  1VQ7 Z;  3GTM I;  1KD1 2;  2ZAE B;  4MD7 A;  2PK7 A;  3S14 I;  4A3K I;  2AKL A;  3NFZ A;  3S1M I;  1RO4 A;  3Q87 A;  2NVY I;  1WII A;  5D1P A;  3CPW Y;  3CXC Z;  2DE6 A;  4NBB A;  2JUB A;  2P3Y A;  3JAM f;  1X3Z A;  2Y0S A;  2JR6 A;  1RNI A;  1KD1 1;  1Q81 2;  4A3F I;  2BJO A;  1YIJ Z;  1VQ6 1;  3S2H I;  3GTK I;  2K3R A;  3LUS A;  3CC7 Z;  5A2Q f;  3CD6 1;  3CCM Z;  2QR1 B;  1VQL 1;  3I55 1;  3S1Q I;  2JMO A;  5FLX f;  1QVG Z;  2OOY B;  1TWF I;  3GTO I;  2W03 A;  1VQO Z;  3VMG A;  4A3M I;  1VLA A;  2M48 A;  3KIF A;  1NJI 2;  2NVT I;  5D1O B;  1YHQ 1;  1W2B Y;  1TWC I;  4DQY B;  4XX2 A;  4E32 A;  3M4O I;  2JA7 I;  2QEX Z;  3CCS Z;  3CCV Z;  1VQ4 Z;  4Y52 I;  1LQL A;  2NVQ I;  3IFU A;  3I4N I;  1I50 I;  4BBS I;  2Q51 A;  4NH1 C;  2W04 A;  3NDI A;  4BBR I;  5CM2 M;  2QA4 Z;  3S17 I;  4NBD A;  3CCR 1;  3H3V J;  1VQ8 1;  1JJ2 Z;  1VQK Z;  1JWH C;  1YJ9 Z;  4E2X A;  3GTL I;  1YJW 1;  3J81 f;  3TDH B;  1M90 2;  5T6B A;  3GCF A;  3CMA 1;  3IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...