1RLYA

Rdc-derived models of the zinc ribbon domain of human general transcription tfiib (zinc bound structures)
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
58
structure length
58
Chain Sequence
ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Transcription initiation factor IIB
publication title Probing Zn2+-binding effects on the zinc-ribbon domain of human general transcription factor TFIIB.
pubmed doi rcsb
source organism Homo sapiens
total genus 1
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rlyA00
3ESWA 4X6AI 2JA5I 3GTMS 4A3MI 1I3QI 2DE6A 2E2HI 4A3DI 4A3EI 2F4OA 2NVXI 2E2JI 4NBFA 3S15I 3I07A 1PFTA 3HOUI 2BJOA 3HOYI 4NBBA 1TWFI 4A3JI 2JA8I 2JNYA 3HOVI 2R93I 1X3WA 4A3FI 3I4NI 1USPA 2P3YA 1ZB8A 3VB9A 1TWHI 2E2II 2J6AA 3VMHA 3EERA 3Q87A 2K5RA 3GTGI 4A3CI 1SFOI 1Y1VI 4QTTA 3VMIA 3K7AI 1X3ZA 4A93I 2NVYI 1RLYA 1TFIA 4NBCA 1WCMI 1RO4A 4BY1I 2B63I 3S16I 1LQLA 3H0GI 3GTOI 3RZDI 5IP9I 2JA7I 2KPIA 4NBEA 1YUAA 3LUSA 4A3GI 3I4MI 5FLMI 4NOZA 5C4JI 4A3KI 1WW9A 3HOXI 3U50C 3S17I 2NVTI 1QYPA 4NBDA 2PK7A 2DE5A 3GTJI 3HOWI 4BBRI 5IP7I 5C4XI 3D6WA 3GTQI 1DL6A 1TWAI 1VLAA 3GTLI 2HF1A 4QTUA 2JA6I 4NB8A 3PO3I 3S2DI 3HOZI 1USPB 5CM2M 1N2FA 2JS4A 2RBLA 3S1MI 5C44I 2DE7A 3S1QI 3GKQA 4NBGA 5C3EI 3GTPI 3GTMI 3RZOI 2AKLA 1R9TI 1I50I 3H3VJ 3M3YI 3M4OI 2YU9I 1ML8A 3S1RI 3S14I 3GCFA 4Y52I 1TWGI 2JR6A 1ZB9A 2R7ZI 2NVQI 1Y1VS 4NBHA 4A3II 4BY7I 3PO2I 1NUIA 3CQZI 2R92I 3FKII 3GTKI 4NBAA 4XX2A 3S2HI 1I6HI 4A3LI 2F4MA 4MH4A 4BBSI 1Y1WI 2VUMI 1TWCI 4A3BI 4BXXI 3PO3S 4Y7NI 3VMGA 3S1NI 1K83I 1L1OC 4NB9A
chains in the Genus database with same CATH superfamily
1QVFZ 3ESWA 4X6AI 1YI21 2JA5I 3IF8A 4A3MI 4A3DI 1K8A2 1Y8CA 5D1OB 4E32A 5IT9f 3CCJ1 3I07A 1VQKZ 2BJOA 3J80f 3CCUZ 3CCS1 4NBBA 4A3JI 3G711 2R93I 2JIPA 3VTNA 3F3FC 2P3YA 3NDJA 1Z03A 3EERA 3JAMb 3J81b 3CCLZ 3I56Z 5T6BA 1ZH1A 2RIQA 1VQP1 1Q7Y2 4RV9A 1YJ9Z 2JA7I 1VQOZ 4AYBA 3CC7Z 3T4NB 4HGYA 5C4JI 1YIJZ 4RVHA 2PK7A 1VQ51 1YI2Z 4HGZA 3HOWI 4BBRI 1VQ41 3CCV1 1RQFA 5LL6f 4MD7A 2HF1A 1WIIA 3CCJZ 2P28A 1KD11 3FQQA 3CCSZ 5CM2M 2AKLA 3CCR1 1I50I 3TDHB 5FLXb 4RVFA 3S1RI 3CD61 3G6E1 2IZ3A 1VQM1 1ZB9A 4E2ZA 1YUKA 2JIOA 1Q812 1Q16A 3PO2I 1NUIA 3CQZI 1VQPZ 3NDIA 3JAMf 2Q4ZA 1JWHC 1I6HI 4BXXI 1AA6A 2JMOA 4Y7NI 3VMGA 2JIQA 3CC21 2IV2X 1I3QI 2DE6A 1KD12 2GTHA 2VPXA 2IZ4A 1VQ5Z 1YJNZ 2E2JI 3BG0B 1VQ91 1VQ4Z 3HOUI 2E7ZA 3CCVZ 3P5JB 2JNYA 2H85A 4A3FI 3IFUA 1K731 2JIRA 2W04A 3CMA1 4A3CI 1Y1VI 3CCRZ 2NVYI 3CD6Z 4NBCA 3G6EZ 2B63I 1VQMZ 2QRDB 4MD9A 3GTOI 2VPWA 3RZDI 4DK1A 3CME1 5IP9I 4RVGA 3EEDA 1RO0A 4RS4A 3G4S1 3F3PC 5FLXf 1YHQ1 2LIYA 3KIHA 3I4MI 4E2WA 5A2Qb 4A3KI 1RO2A 4E33A 1Q821 3FQMA 3U50C 1QYPA 4NBDA 2K3RA 2DE5A 3CC2Z 2VUGA 3GTJI 1Q861 2VPZA 1K732 3D9XA 2OZKA 1TWAI 1VLAA 3CXCZ 2JA6I 4NB8A 1VQ9Z 3HOZI 1N8R1 1N2FA 2JS4A 3S1MI 3GKQA 4NBGA 3GTMI 3RZOI 1FDOA 3CMAZ 3M4OI 1KC81 2YU9I 2LFUA 4EWCA 1TWGI 4NBHA 4A3II 4BY7I 2O4HA 1K9M1 1Q822 2GU2A 4A3LI 3CMEZ 1Y1WI 2VUMI 1TWCI 4A3BI 2WB1A 1Q862 3G71Z 1QVGY 3G4SZ 1P9NA 1VQ81 1YHQZ 1K83I 1L1OC 2QA41 4E2XA 4DGLA 2NAPA 3GTMS 3I551 2E2HI 3CC41 1VQN1 4MRIA 3CCE1 2OOXB 5AN9F 3S15I 1PFTA 1TWFI 1KC82 3HOVI 2PMZA 5IT9b 3OW2Y 3I4NI 3J81f 2Q51A 3VB9A 1TWHI 1WZNA 4DQYB 2KI7B 2K5RA 2I3CA 3GTGI 1QVGZ 4QTTA 3VMIA 3K7AI 1K9M2 4E31A 3CPWZ 1W2BY 4HH4A 1X3ZA 1M901 4A93I 1TFIA 1S721 1LQLA 1VQ61 2LEXA 1NJI1 2EGTA 2KPIA 4NBEA 2ZAEB 1YUAA 2M48A 3LUSA 3MZKB 4A3GI 2QKDA 1KRLA 2OTL1 1JJ2Y 3BG1B 2V3VA 5FLMI 3NH5A 3OW2Z 1WW9A 1VQ8Z 3S17I 2QA4Z 4MD8A 3I55Z 2V45A 3CXCY 1W2BZ 2RHBA 3NH8A 2Y0SA 3CC4Z 1VQNZ 3GTQI 1DL6A 3CCEZ 2M6NA 4QTUA 3GTLI 2WAQA 3S2DI 1M902 2YADA 2RBLA 5C44I 3S1QI 3GTPI 1X0TA 3CCM1 1R9TI 2QR1B 4NFRA 4TNUA 2OTJ1 1JJ2Z 3H3VJ 1Z01A 3M3YI 1ML8A 1NJI2 2JUBA 3S14I 3GCFA 2JR6A 2R7ZI 4CL1A 1Y1VS 1S72Z 3FKII 1VQ6Z 3GTKI 2QRCB 2F4MA 3MONA 2E9HA 5T64A 2OTLZ 2V8IA 1S7MA 2PM9A 4MXUA 2V8KA 2G2KA 1VQL1 4A3EI 2F4OA 2O53A 1NP6A 2NVXI 4NBFA 3HOYI 4MONA 1VQ71 2JA8I 2R6MA 3IR7A 1X3WA 2AYDA 4E2YA 1USPA 2QEX1 1ZB8A 1YJW1 2QREB 1Q811 2E2II 2J6AA 3VMHA 1QXFA 3Q87A 1M1K1 3CCQ1 3CPWY 1SFOI 3CCMZ 2VF1A 1WJ2A 4RVDA 2OTJZ 1YJN1 3KIFA 1RLYA 4S1TA 1N8R2 1WCMI 1RO4A 4BY1I 3S16I 1SIWA 3H0GI 1FDIA 3QWUA 5A2Qf 2V8JA 2QLVB 1YIT1 5T67A 3J80b 4NOZA 4NH1C 3MZLB 3HOXI 1KQSY 2NVTI 1QF8A 3J7A4 1VQLZ 1VQK1 2W03A 5IP7I 5C4XI 5D1OA 3CCU1 3D6WA 1M1K2 4E30A 3IX0A 3PO3I 1K8A1 2JIMA 2HU9A 2RPRA 3D2LA 1VQ7Z 1USPB 2GTIA 1QVFY 2DE7A 3NH4A 2QEXZ 1YJWZ 5C3EI 3CCL1 3I561 2VPYA 3CCQZ 2RT9A 1Z02A 4Y52I 1KQSZ 1RNIA 2NVQI 2OOYB 1YJ91 3HKZA 1VQO1 3NFZA 2R92I 4NBAA 4XX2A 3S2HI 3CC71 5D1PA 4MH4A 4BBSI 3TE5B 3PO3S 1YIJ1 1Q7Y1 1YITZ 3S1NI 4NB9A
chains in the Genus database with same CATH topology
1QVFZ 3ESWA 4X6AI 1YI21 2JA5I 3IF8A 4A3MI 4A3DI 1K8A2 5D1OB 4E32A 5IT9f 3CCJ1 3I07A 1VQKZ 2BJOA 3J80f 3CCUZ 3CCS1 4NBBA 4A3JI 3G711 2R93I 3VTNA 3F3FC 2P3YA 3NDJA 1Z03A 3EERA 3JAMb 3J81b 3CCLZ 3I56Z 5T6BA 1ZH1A 2RIQA 1VQP1 1Q7Y2 4RV9A 1YJ9Z 2JA7I 1VQOZ 4AYBA 3CC7Z 3T4NB 4HGYA 5C4JI 1YIJZ 4RVHA 2PK7A 1VQ51 1YI2Z 4HGZA 3HOWI 4BBRI 1VQ41 3CCV1 1RQFA 5LL6f 4MD7A 2HF1A 1WIIA 3CCJZ 2P28A 1KD11 3FQQA 3CCSZ 5CM2M 2AKLA 3CCR1 1I50I 3TDHB 5FLXb 4RVFA 3S1RI 3CD61 3G6E1 2IZ3A 1VQM1 1ZB9A 4E2ZA 1YUKA 1Q812 3PO2I 1NUIA 3CQZI 1VQPZ 3NDIA 3JAMf 2Q4ZA 1JWHC 1I6HI 4BXXI 2JMOA 4Y7NI 3VMGA 3CC21 1I3QI 2DE6A 1KD12 2GTHA 2IZ4A 1VQ5Z 1YJNZ 2E2JI 3BG0B 1VQ91 1VQ4Z 3HOUI 3CCVZ 3P5JB 2JNYA 2H85A 4A3FI 3IFUA 1K731 2W04A 3CMA1 4A3CI 1Y1VI 3CCRZ 2NVYI 3CD6Z 4NBCA 3G6EZ 2B63I 1VQMZ 2QRDB 4MD9A 3GTOI 3RZDI 4DK1A 3CME1 5IP9I 4RVGA 3EEDA 1RO0A 4RS4A 3G4S1 3F3PC 5FLXf 1YHQ1 2LIYA 3KIHA 3I4MI 4E2WA 5A2Qb 4A3KI 1RO2A 4E33A 1Q821 3FQMA 3U50C 1QYPA 4NBDA 2K3RA 2DE5A 3CC2Z 2VUGA 3GTJI 1Q861 1K732 3D9XA 2OZKA 1TWAI 1VLAA 3CXCZ 2JA6I 4NB8A 1VQ9Z 3HOZI 1N8R1 1N2FA 2JS4A 3S1MI 3GKQA 4NBGA 3GTMI 3RZOI 3CMAZ 3M4OI 1KC81 2YU9I 2LFUA 4EWCA 1TWGI 4NBHA 4A3II 4BY7I 2O4HA 1K9M1 1Q822 2GU2A 4A3LI 3CMEZ 1Y1WI 2VUMI 1TWCI 4A3BI 2WB1A 1Q862 3G71Z 1QVGY 3G4SZ 1P9NA 1VQ81 1YHQZ 1K83I 1L1OC 2QA41 4E2XA 4DGLA 3GTMS 3I551 2E2HI 3CC41 1VQN1 4MRIA 3CCE1 2OOXB 5AN9F 3S15I 1PFTA 1TWFI 1KC82 3HOVI 2PMZA 5IT9b 3OW2Y 3I4NI 3J81f 2Q51A 3VB9A 1TWHI 4DQYB 2KI7B 2K5RA 2I3CA 3GTGI 1QVGZ 4QTTA 3VMIA 3K7AI 1K9M2 4E31A 3CPWZ 1W2BY 4HH4A 1X3ZA 1M901 4A93I 1TFIA 1S721 1LQLA 1VQ61 1NJI1 2EGTA 2KPIA 4NBEA 2ZAEB 1YUAA 2M48A 3LUSA 3MZKB 4A3GI 2QKDA 1KRLA 2OTL1 1JJ2Y 3BG1B 5FLMI 3NH5A 3OW2Z 1WW9A 1VQ8Z 3S17I 2QA4Z 4MD8A 3I55Z 3CXCY 1W2BZ 2RHBA 3NH8A 2Y0SA 3CC4Z 1VQNZ 3GTQI 1DL6A 3CCEZ 2M6NA 4QTUA 3GTLI 2WAQA 3S2DI 1M902 2YADA 2RBLA 5C44I 3S1QI 3GTPI 1X0TA 3CCM1 1R9TI 2QR1B 4NFRA 4TNUA 2OTJ1 1JJ2Z 3H3VJ 1Z01A 3M3YI 1ML8A 1NJI2 2JUBA 3S14I 3GCFA 2JR6A 2R7ZI 4CL1A 1Y1VS 1S72Z 3FKII 1VQ6Z 3GTKI 2QRCB 2F4MA 3MONA 2E9HA 5T64A 2OTLZ 2V8IA 1S7MA 2PM9A 4MXUA 2V8KA 2G2KA 1VQL1 4A3EI 2F4OA 2O53A 1NP6A 2NVXI 4NBFA 3HOYI 4MONA 1VQ71 2JA8I 2R6MA 1X3WA 4E2YA 1USPA 2QEX1 1ZB8A 1YJW1 2QREB 1Q811 2E2II 2J6AA 3VMHA 3Q87A 1M1K1 3CCQ1 3CPWY 1SFOI 3CCMZ 2VF1A 4RVDA 2OTJZ 1YJN1 3KIFA 1RLYA 4S1TA 1N8R2 1WCMI 1RO4A 4BY1I 3S16I 3H0GI 3QWUA 5A2Qf 2V8JA 2QLVB 1YIT1 5T67A 3J80b 4NOZA 4NH1C 3MZLB 3HOXI 1KQSY 2NVTI 1QF8A 3J7A4 1VQLZ 1VQK1 2W03A 5IP7I 5C4XI 5D1OA 3CCU1 3D6WA 1M1K2 4E30A 3IX0A 3PO3I 1K8A1 2HU9A 2RPRA 1VQ7Z 1USPB 2GTIA 1QVFY 2DE7A 3NH4A 2QEXZ 1YJWZ 5C3EI 3CCL1 3I561 3CCQZ 2RT9A 1Z02A 4Y52I 1KQSZ 1RNIA 2NVQI 2OOYB 1YJ91 3HKZA 1VQO1 3NFZA 2R92I 4NBAA 4XX2A 3S2HI 3CC71 5D1PA 4MH4A 4BBSI 3TE5B 3PO3S 1YIJ1 1Q7Y1 1YITZ 3S1NI 4NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESW A;  4X6A I;  2JA5 I;  3GTM S;  4A3M I;  1I3Q I;  2DE6 A;  2E2H I;  4A3D I;  4A3E I;  2F4O A;  2NVX I;  2E2J I;  4NBF A;  3S15 I;  3I07 A;  1PFT A;  3HOU I;  2BJO A;  3HOY I;  4NBB A;  1TWF I;  4A3J I;  2JA8 I;  2JNY A;  3HOV I;  2R93 I;  1X3W A;  4A3F I;  3I4N I;  1USP A;  2P3Y A;  1ZB8 A;  3VB9 A;  1TWH I;  2E2I I;  2J6A A;  3VMH A;  3EER A;  3Q87 A;  2K5R A;  3GTG I;  4A3C I;  1SFO I;  1Y1V I;  4QTT A;  3VMI A;  3K7A I;  1X3Z A;  4A93 I;  2NVY I;  1RLY A;  1TFI A;  4NBC A;  1WCM I;  1RO4 A;  4BY1 I;  2B63 I;  3S16 I;  1LQL A;  3H0G I;  3GTO I;  3RZD I;  5IP9 I;  2JA7 I;  2KPI A;  4NBE A;  1YUA A;  3LUS A;  4A3G I;  3I4M I;  5FLM I;  4NOZ A;  5C4J I;  4A3K I;  1WW9 A;  3HOX I;  3U50 C;  3S17 I;  2NVT I;  1QYP A;  4NBD A;  2PK7 A;  2DE5 A;  3GTJ I;  3HOW I;  4BBR I;  5IP7 I;  5C4X I;  3D6W A;  3GTQ I;  1DL6 A;  1TWA I;  1VLA A;  3GTL I;  2HF1 A;  4QTU A;  2JA6 I;  4NB8 A;  3PO3 I;  3S2D I;  3HOZ I;  1USP B;  5CM2 M;  1N2F A;  2JS4 A;  2RBL A;  3S1M I;  5C44 I;  2DE7 A;  3S1Q I;  3GKQ A;  4NBG A;  5C3E I;  3GTP I;  3GTM I;  3RZO I;  2AKL A;  1R9T I;  1I50 I;  3H3V J;  3M3Y I;  3M4O I;  2YU9 I;  1ML8 A;  3S1R I;  3S14 I;  3GCF A;  4Y52 I;  1TWG I;  2JR6 A;  1ZB9 A;  2R7Z I;  2NVQ I;  1Y1V S;  4NBH A;  4A3I I;  4BY7 I;  3PO2 I;  1NUI A;  3CQZ I;  2R92 I;  3FKI I;  3GTK I;  4NBA A;  4XX2 A;  3S2H I;  1I6H I;  4A3L I;  2F4M A;  4MH4 A;  4BBS I;  1Y1W I;  2VUM I;  1TWC I;  4A3B I;  4BXX I;  3PO3 S;  4Y7N I;  3VMG A;  3S1N I;  1K83 I;  1L1O C;  4NB9 A; 
#chains in the Genus database with same CATH topology
 1QVF Z;  3ESW A;  4X6A I;  1YI2 1;  2JA5 I;  3IF8 A;  4A3M I;  4A3D I;  1K8A 2;  1Y8C A;  5D1O B;  4E32 A;  5IT9 f;  3CCJ 1;  3I07 A;  1VQK Z;  2BJO A;  3J80 f;  3CCU Z;  3CCS 1;  4NBB A;  4A3J I;  3G71 1;  2R93 I;  2JIP A;  3VTN A;  3F3F C;  2P3Y A;  3NDJ A;  1Z03 A;  3EER A;  3JAM b;  3J81 b;  3CCL Z;  3I56 Z;  5T6B A;  1ZH1 A;  2RIQ A;  1VQP 1;  1Q7Y 2;  4RV9 A;  1YJ9 Z;  2JA7 I;  1VQO Z;  4AYB A;  3CC7 Z;  3T4N B;  4HGY A;  5C4J I;  1YIJ Z;  4RVH A;  2PK7 A;  1VQ5 1;  1YI2 Z;  4HGZ A;  3HOW I;  4BBR I;  1VQ4 1;  3CCV 1;  1RQF A;  5LL6 f;  4MD7 A;  2HF1 A;  1WII A;  3CCJ Z;  2P28 A;  1KD1 1;  3FQQ A;  3CCS Z;  5CM2 M;  2AKL A;  3CCR 1;  1I50 I;  3TDH B;  5FLX b;  4RVF A;  3S1R I;  3CD6 1;  3G6E 1;  2IZ3 A;  1VQM 1;  1ZB9 A;  4E2Z A;  1YUK A;  2JIO A;  1Q81 2;  1Q16 A;  3PO2 I;  1NUI A;  3CQZ I;  1VQP Z;  3NDI A;  3JAM f;  2Q4Z A;  1JWH C;  1I6H I;  4BXX I;  1AA6 A;  2JMO A;  4Y7N I;  3VMG A;  2JIQ A;  3CC2 1;  2IV2 X;  1I3Q I;  2DE6 A;  1KD1 2;  2GTH A;  2VPX A;  2IZ4 A;  1VQ5 Z;  1YJN Z;  2E2J I;  3BG0 B;  1VQ9 1;  1VQ4 Z;  3HOU I;  2E7Z A;  3CCV Z;  3P5J B;  2JNY A;  2H85 A;  4A3F I;  3IFU A;  1K73 1;  2JIR A;  2W04 A;  3CMA 1;  4A3C I;  1Y1V I;  3CCR Z;  2NVY I;  3CD6 Z;  4NBC A;  3G6E Z;  2B63 I;  1VQM Z;  2QRD B;  4MD9 A;  3GTO I;  2VPW A;  3RZD I;  4DK1 A;  3CME 1;  5IP9 I;  4RVG A;  3EED A;  1RO0 A;  4RS4 A;  3G4S 1;  3F3P C;  5FLX f;  1YHQ 1;  2LIY A;  3KIH A;  3I4M I;  4E2W A;  5A2Q b;  4A3K I;  1RO2 A;  4E33 A;  1Q82 1;  3FQM A;  3U50 C;  1QYP A;  4NBD A;  2K3R A;  2DE5 A;  3CC2 Z;  2VUG A;  3GTJ I;  1Q86 1;  2VPZ A;  1K73 2;  3D9X A;  2OZK A;  1TWA I;  1VLA A;  3CXC Z;  2JA6 I;  4NB8 A;  1VQ9 Z;  3HOZ I;  1N8R 1;  1N2F A;  2JS4 A;  3S1M I;  3GKQ A;  4NBG A;  3GTM I;  3RZO I;  1FDO A;  3CMA Z;  3M4O I;  1KC8 1;  2YU9 I;  2LFU A;  4EWC A;  1TWG I;  4NBH A;  4A3I I;  4BY7 I;  2O4H A;  1K9M 1;  1Q82 2;  2GU2 A;  4A3L I;  3CME Z;  1Y1W I;  2VUM I;  1TWC I;  4A3B I;  2WB1 A;  1Q86 2;  3G71 Z;  1QVG Y;  3G4S Z;  1P9N A;  1VQ8 1;  1YHQ Z;  1K83 I;  1L1O C;  2QA4 1;  4E2X A;  4DGL A;  2NAP A;  3GTM S;  3I55 1;  2E2H I;  3CC4 1;  1VQN 1;  4MRI A;  3CCE 1;  2OOX B;  5AN9 F;  3S15 I;  1PFT A;  1TWF I;  1KC8 2;  3HOV I;  2PMZ A;  5IT9 b;  3OW2 Y;  3I4N I;  3J81 f;  2Q51 A;  3VB9 A;  1TWH I;  1WZN A;  4DQY B;  2KI7 B;  2K5R A;  2I3C A;  3GTG I;  1QVG Z;  4QTT A;  3VMI A;  3K7A I;  1K9M 2;  4E31 A;  3CPW Z;  1W2B Y;  4HH4 A;  1X3Z A;  1M90 1;  4A93 I;  1TFI A;  1S72 1;  1LQL A;  1VQ6 1;  2LEX A;  1NJI 1;  2EGT A;  2KPI A;  4NBE A;  2ZAE B;  1YUA A;  2M48 A;  3LUS A;  3MZK B;  4A3G I;  2QKD A;  1KRL A;  2OTL 1;  1JJ2 Y;  3BG1 B;  2V3V A;  5FLM I;  3NH5 A;  3OW2 Z;  1WW9 A;  1VQ8 Z;  3S17 I;  2QA4 Z;  4MD8 A;  3I55 Z;  2V45 A;  3CXC Y;  1W2B Z;  2RHB A;  3NH8 A;  2Y0S A;  3CC4 Z;  1VQN Z;  3GTQ I;  1DL6 A;  3CCE Z;  2M6N A;  4QTU A;  3GTL I;  2WAQ A;  3S2D I;  1M90 2;  2YAD A;  2RBL A;  5C44 I;  3S1Q I;  3GTP I;  1X0T A;  3CCM 1;  1R9T I;  2QR1 B;  4NFR A;  4TNU A;  2OTJ 1;  1JJ2 Z;  3H3V J;  1Z01 A;  3M3Y I;  1ML8 A;  1NJI 2;  2JUB A;  3S14 I;  3GCF A;  2JR6 A;  2R7Z I;  4CL1 A;  1Y1V S;  1S72 Z;  3FKI I;  1VQ6 Z;  3GTK I;  2QRC B;  2F4M A;  3MON A;  2E9H A;  5T64 A;  2OTL Z;  2V8I A;  1S7M A;  2PM9 A;  4MXU A;  2V8K A;  2G2K A;  1VQL 1;  4A3E I;  2F4O A;  2O53 A;  1NP6 A;  2NVX I;  4NBF A;  3HOY I;  4MON A;  1VQ7 1;  2JA8 I;  2R6M A;  3IR7 A;  1X3W A;  2AYD A;  4E2Y A;  1USP A;  2QEX 1;  1ZB8 A;  1YJW 1;  2QRE B;  1Q81 1;  2E2I I;  2J6A A;  3VMH A;  1QXF A;  3Q87 A;  1M1K 1;  3CCQ 1;  3CPW Y;  1SFO I;  3CCM Z;  2VF1 A;  1WJ2 A;  4RVD A;  2OTJ Z;  1YJN 1;  3KIF A;  1RLY A;  4S1T A;  1N8R 2;  1WCM I;  1RO4 A;  4BY1 I;  3S16 I;  1SIW A;  3H0G I;  1FDI A;  3QWU A;  5A2Q f;  2V8J A;  2QLV B;  1YIT 1;  5T67 A;  3J80 b;  4NOZ A;  4NH1 C;  3MZL B;  3HOX I;  1KQS Y;  2NVT I;  1QF8 A;  3J7A 4;  1VQL Z;  1VQK 1;  2W03 A;  5IP7 I;  5C4X I;  5D1O A;  3CCU 1;  3D6W A;  1M1K 2;  4E30 A;  3IX0 A;  3PO3 I;  1K8A 1;  2JIM A;  2HU9 A;  2RPR A;  3D2L A;  1VQ7 Z;  1USP B;  2GTI A;  1QVF Y;  2DE7 A;  3NH4 A;  2QEX Z;  1YJW Z;  5C3E I;  3CCL 1;  3I56 1;  2VPY A;  3CCQ Z;  2RT9 A;  1Z02 A;  4Y52 I;  1KQS Z;  1RNI A;  2NVQ I;  2OOY B;  1YJ9 1;  3HKZ A;  1VQO 1;  3NFZ A;  2R92 I;  4NBA A;  4XX2 A;  3S2H I;  3CC7 1;  5D1P A;  4MH4 A;  4BBS I;  3TE5 B;  3PO3 S;  1YIJ 1;  1Q7Y 1;  1YIT Z;  3S1N I;  4NB9 A; 
#chains in the Genus database with same CATH homology
 1QVF Z;  3ESW A;  4X6A I;  1YI2 1;  2JA5 I;  3IF8 A;  4A3M I;  4A3D I;  1K8A 2;  5D1O B;  4E32 A;  5IT9 f;  3CCJ 1;  3I07 A;  1VQK Z;  2BJO A;  3J80 f;  3CCU Z;  3CCS 1;  4NBB A;  4A3J I;  3G71 1;  2R93 I;  3VTN A;  3F3F C;  2P3Y A;  3NDJ A;  1Z03 A;  3EER A;  3JAM b;  3J81 b;  3CCL Z;  3I56 Z;  5T6B A;  1ZH1 A;  2RIQ A;  1VQP 1;  1Q7Y 2;  4RV9 A;  1YJ9 Z;  2JA7 I;  1VQO Z;  4AYB A;  3CC7 Z;  3T4N B;  4HGY A;  5C4J I;  1YIJ Z;  4RVH A;  2PK7 A;  1VQ5 1;  1YI2 Z;  4HGZ A;  3HOW I;  4BBR I;  1VQ4 1;  3CCV 1;  1RQF A;  5LL6 f;  4MD7 A;  2HF1 A;  1WII A;  3CCJ Z;  2P28 A;  1KD1 1;  3FQQ A;  3CCS Z;  5CM2 M;  2AKL A;  3CCR 1;  1I50 I;  3TDH B;  5FLX b;  4RVF A;  3S1R I;  3CD6 1;  3G6E 1;  2IZ3 A;  1VQM 1;  1ZB9 A;  4E2Z A;  1YUK A;  1Q81 2;  3PO2 I;  1NUI A;  3CQZ I;  1VQP Z;  3NDI A;  3JAM f;  2Q4Z A;  1JWH C;  1I6H I;  4BXX I;  2JMO A;  4Y7N I;  3VMG A;  3CC2 1;  1I3Q I;  2DE6 A;  1KD1 2;  2GTH A;  2IZ4 A;  1VQ5 Z;  1YJN Z;  2E2J I;  3BG0 B;  1VQ9 1;  1VQ4 Z;  3HOU I;  3CCV Z;  3P5J B;  2JNY A;  2H85 A;  4A3F I;  3IFU A;  1K73 1;  2W04 A;  3CMA 1;  4A3C I;  1Y1V I;  3CCR Z;  2NVY I;  3CD6 Z;  4NBC A;  3G6E Z;  2B63 I;  1VQM Z;  2QRD B;  4MD9 A;  3GTO I;  3RZD I;  4DK1 A;  3CME 1;  5IP9 I;  4RVG A;  3EED A;  1RO0 A;  4RS4 A;  3G4S 1;  3F3P C;  5FLX f;  1YHQ 1;  2LIY A;  3KIH A;  3I4M I;  4E2W A;  5A2Q b;  4A3K I;  1RO2 A;  4E33 A;  1Q82 1;  3FQM A;  3U50 C;  1QYP A;  4NBD A;  2K3R A;  2DE5 A;  3CC2 Z;  2VUG A;  3GTJ I;  1Q86 1;  1K73 2;  3D9X A;  2OZK A;  1TWA I;  1VLA A;  3CXC Z;  2JA6 I;  4NB8 A;  1VQ9 Z;  3HOZ I;  1N8R 1;  1N2F A;  2JS4 A;  3S1M I;  3GKQ A;  4NBG A;  3GTM I;  3RZO I;  3CMA Z;  3M4O I;  1KC8 1;  2YU9 I;  2LFU A;  4EWC A;  1TWG I;  4NBH A;  4A3I I;  4BY7 I;  2O4H A;  1K9M 1;  1Q82 2;  2GU2 A;  4A3L I;  3CME Z;  1Y1W I;  2VUM I;  1TWC I;  4A3B I;  2WB1 A;  1Q86 2;  3G71 Z;  1QVG Y;  3G4S Z;  1P9N A;  1VQ8 1;  1YHQ Z;  1K83 I;  1L1O C;  2QA4 1;  4E2X A;  4DGL A;  3GTM S;  3I55 1;  2E2H I;  3CC4 1;  1VQN 1;  4MRI A;  3CCE 1;  2OOX B;  5AN9 F;  3S15 I;  1PFT A;  1TWF I;  1KC8 2;  3HOV I;  2PMZ A;  5IT9 b;  3OW2 Y;  3I4N I;  3J81 f;  2Q51 A;  3VB9 A;  1TWH I;  4DQY B;  2KI7 B;  2K5R A;  2I3C A;  3GTG I;  1QVG Z;  4QTT A;  3VMI A;  3K7A I;  1K9M 2;  4E31 A;  3CPW Z;  1W2B Y;  4HH4 A;  1X3Z A;  1M90 1;  4A93 I;  1TFI A;  1S72 1;  1LQL A;  1VQ6 1;  1NJI 1;  2EGT A;  2KPI A;  4NBE A;  2ZAE B;  1YUA A;  2M48 A;  3LUS A;  3MZK B;  4A3G I;  2QKD A;  1KRL A;  2OTL 1;  1JJ2 Y;  3BG1 B;  5FLM I;  3NH5 A;  3OW2 Z;  1WW9 A;  1VQ8 Z;  3S17 I;  2QA4 Z;  4MD8 A;  3I55 Z;  3CXC Y;  1W2B Z;  2RHB A;  3NH8 A;  2Y0S A;  3CC4 Z;  1VQN Z;  3GTQ I;  1DL6 A;  3CCE Z;  2M6N A;  4QTU A;  3GTL I;  2WAQ A;  3S2D I;  1M90 2;  2YAD A;  2RBL A;  5C44 I;  3S1Q I;  3GTP I;  1X0T A;  3CCM 1;  1R9T I;  2QR1 B;  4NFR A;  4TNU A;  2OTJ 1;  1JJ2 Z;  3H3V J;  1Z01 A;  3M3Y I;  1ML8 A;  1NJI 2;  2JUB A;  3S14 I;  3GCF A;  2JR6 A;  2R7Z I;  4CL1 A;  1Y1V S;  1S72 Z;  3FKI I;  1VQ6 Z;  3GTK I;  2QRC B;  2F4M A;  3MON A;  2E9H A;  5T64 A;  2OTL Z;  2V8I A;  1S7M A;  2PM9 A;  4MXU A;  2V8K A;  2G2K A;  1VQL 1;  4A3E I;  2F4O A;  2O53 A;  1NP6 A;  2NVX I;  4NBF A;  3HOY I;  4MON A;  1VQ7 1;  2JA8 I;  2R6M A;  1X3W A;  4E2Y A;  1USP A;  2QEX 1;  1ZB8 A;  1YJW 1;  2QRE B;  1Q81 1;  2E2I I;  2J6A A;  3VMH A;  3Q87 A;  1M1K 1;  3CCQ 1;  3CPW Y;  1SFO I;  3CCM Z;  2VF1 A;  4RVD A;  2OTJ Z;  1YJN 1;  3KIF A;  1RLY A;  4S1T A;  1N8R 2;  1WCM I;  1RO4 A;  4BY1 I;  3S16 I;  3H0G I;  3QWU A;  5A2Q f;  2V8J A;  2QLV B;  1YIT 1;  5T67 A;  3J80 b;  4NOZ A;  4NH1 C;  3MZL B;  3HOX I;  1KQS Y;  2NVT I;  1QF8 A;  3J7A 4;  1VQL Z;  1VQK 1;  2W03 A;  5IP7 I;  5C4X I;  5D1O A;  3CCU 1;  3D6W A;  1M1K 2;  4E30 A;  3IX0 A;  3PO3 I;  1K8A 1;  2HU9 A;  2RPR A;  1VQ7 Z;  1USP B;  2GTI A;  1QVF Y;  2DE7 A;  3NH4 A;  2QEX Z;  1YJW Z;  5C3E I;  3CCL 1;  3I56 1;  3CCQ Z;  2RT9 A;  1Z02 A;  4Y52 I;  1KQS Z;  1RNI A;  2NVQ I;  2OOY B;  1YJ9 1;  3HKZ A;  1VQO 1;  3NFZ A;  2R92 I;  4NBA A;  4XX2 A;  3S2H I;  3CC7 1;  5D1P A;  4MH4 A;  4BBS I;  3TE5 B;  3PO3 S;  1YIJ 1;  1Q7Y 1;  1YIT Z;  3S1N I;  4NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...