1Q861

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q86100
1VQ41 3CMA1 3CD6Z 1YJNZ 1VQ91 3CCE1 1YIT1 1KD11 1VQM1 3OW2Z 3CC21 1K732 3CXCY 1YHQ1 1YJW1 3CCRZ 1Q812 1S721 1VQLZ 1K9M2 1Q822 2QA41 1Q861 1M902 3I561 2QEX1 1K8A1 3CCSZ 1N8R2 3CC4Z 3CCVZ 3CCM1 1KC82 3CPWZ 1VQP1 3CCQZ 1YIJZ 1JJ2Z 3G4S1 1VQ7Z 1YJ91 3CC71 1VQ81 1W2BY 1VQKZ 3CME1 1M1K1 1KQSY 1QVGZ 1VQOZ 1QVFZ 3CD61 3CCUZ 3G71Z 1VQ4Z 3G6E1 3I551 1VQNZ 1VQ9Z 3CCEZ 2OTLZ 1VQMZ 3CC2Z 2QA4Z 1Q7Y2 3CCS1 3CCL1 3I56Z 2QEXZ 3CCV1 2OTJZ 1VQ5Z 3CCJZ 1K731 3OW2Y 1K9M1 3CCMZ 1W2BZ 1Q811 1KD12 1VQ61 1Q821 3CCQ1 3CXCZ 1YIJ1 1YI21 1M901 1VQPZ 1NJI1 1Q862 3G4SZ 1N8R1 1YJN1 1YJ9Z 1K8A2 3CMAZ 3CC7Z 1KC81 1YITZ 3CCR1 1VQL1 3CMEZ 3CPWY 1YJWZ 1YHQZ 1S72Z 3G711 1JJ2Y 1VQN1 3CC41 2OTL1 3G6EZ 3I55Z 1QVGY 1M1K2 1KQSZ 1QVFY 1NJI2 1VQ71 3CCLZ 2OTJ1 1VQ51 3CCJ1 1VQK1 1VQ8Z 1VQ6Z 1VQO1 1Q7Y1 1YI2Z 3CCU1
chains in the Genus database with same CATH superfamily
1TWFI 2RIQA 4EWCA 1PFTA 3CC21 3GTLI 2QREB 1S721 1VQLZ 2IZ3A 4HGYA 1Q861 1M902 3CCSZ 2VPWA 3CC4Z 3JAMb 3CCM1 2NVQI 2E7ZA 4RV9A 3IX0A 2Q51A 2PMZA 3GTMS 3I07A 3VMHA 3S1RI 3KIFA 3S2HI 4MD9A 3QWUA 2OOXB 2GTIA 1QVGZ 2P28A 1QVFZ 1ML8A 1WZNA 3I4MI 1RNIA 2P3YA 3CCEZ 2Q4ZA 2OTLZ 3S15I 2QA4Z 3CCS1 2QEXZ 2GU2A 1VQ5Z 2KPIA 3D2LA 1SIWA 1Y8CA 3OW2Y 1K731 1W2BZ 1K9M1 4RVFA 1VQ61 5FLXf 1VQPZ 1YUAA 3T4NB 5C3EI 5A2Qf 3G4SZ 2J6AA 1YJ9Z 4QTTA 3CCR1 3NH4A 2HF1A 1WCMI 4A3EI 2QLVB 4A3GI 3LUSA 2OTL1 2B63I 3G6EZ 5IT9b 1ZB9A 3RZDI 2OOYB 1M1K2 4NBAA 3HOUI 3PO3I 1VQ51 3GTOI 3NFZA 4RVGA 1TWHI 1VQ8Z 2JUBA 1X3ZA 1Q7Y1 2QR1B 2JIQA 1SFOI 3CCU1 2WB1A 1VQ41 2R92I 2RPRA 4NOZA 1VQ91 5D1OB 1JWHC 2G2KA 3OW2Z 4A3DI 3CXCY 1Q812 4NBCA 1Q822 3M3YI 4Y52I 5T64A 1K8A1 4MD8A 2IV2X 3CCVZ 3IR7A 3IF8A 1KC82 3TE5B 2R93I 3NDJA 1I50I 2DE7A 1ZH1A 1VQ7Z 3EEDA 3D9XA 1VQ81 2JA7I 1R9TI 2JNYA 1W2BY 1VQKZ 3HOVI 3GCFA 2R6MA 3HOZI 2LIYA 1VQOZ 3U50C 3J80f 5C4JI 3I551 1VQNZ 1QYPA 4TNUA 4MD7A 1ZB8A 4A3CI 1FDIA 2AYDA 1VQMZ 1I6HI 1Y1VI 3ESWA 1WIIA 1RO0A 3CCL1 2NVXI 3D6WA 3I56Z 2V45A 2QRDB 2JIRA 3CCV1 2F4OA 4BXXI 3CCJZ 1KD12 2QRCB 4A3FI 3NH5A 3CXCZ 1M901 2OZKA 1Z03A 4Y7NI 4E2ZA 4X6AI 2M6NA 5FLXb 3CQZI 3CC7Z 2R7ZI 1YITZ 4E32A 4DQYB 1VQL1 2RT9A 3CMEZ 3CPWY 3FKII 5A2Qb 1YJWZ 1JJ2Y 2V8IA 1AA6A 3MZLB 4E30A 1VQN1 4MONA 3CC41 3GTJI 3JAMf 1KRLA 1RQFA 2PK7A 5T6BA 4NBEA 5FLMI 4QTUA 1TWAI 5CM2M 3CCJ1 3HOYI 2PM9A 3S17I 2JS4A 2V8JA 2E2JI 3F3PC 1USPB 1X0TA 5T67A 4A3LI 3NDIA 1YI2Z 2EGTA 1TFIA 2WAQA 2JIOA 4NH1C 2JR6A 1RLYA 3CD6Z 1YJNZ 3CCE1 1YIT1 1FDOA 4MXUA 2I3CA 1YJW1 2E2II 2JA5I 2QA41 3VB9A 2QEX1 3M4OI 1QF8A 4E31A 3PO3S 1LQLA 4XX2A 1N8R2 2YU9I 3S2DI 4RVHA 3K7AI 4NB9A 1TWGI 3CPWZ 1RO4A 1VQP1 3CCQZ 2K3RA 1JJ2Z 3S1NI 4NBBA 3J81f 3G4S1 1YJ91 2AKLA 4HGZA 4MH4A 4E33A 1NUIA 3S16I 5D1PA 4A3BI 1M1K1 3VTNA 2VPYA 3CD61 2H85A 3G71Z 1TWCI 3G6E1 5IP9I 3J7A4 3GTKI 2JA6I 2NAPA 3CC2Z 5D1OA 3TDHB 4RVDA 2BJOA 1WJ2A 2IZ4A 2NVYI 1P9NA 4A3II 3HOWI 2VPXA 2RBLA 1YUKA 1L1OC 2V8KA 3CCMZ 1Q811 1Q821 3MZKB 3CCQ1 4S1TA 3EERA 4BBRI 1Q862 1NJI1 2W03A 3GTGI 1DL6A 5C44I 3CMAZ 1KC81 4NFRA 3BG1B 2DE5A 2O4HA 1Y1VS 3NH8A 1YHQZ 3G711 5IP7I 1Z01A 1RO2A 1Q16A 4NBHA 2ZAEB 3S1MI 2LFUA 1VQ71 2O53A 3BG0B 1VQK1 1VQ6Z 5LL6f 1VQO1 4BY7I 3GTMI 4A3MI 3CMA1 4NBDA 2V3VA 3P5JB 1KD11 1VQM1 1K732 1K9M2 3IFUA 1YHQ1 3CCRZ 2JA8I 1N2FA 4E2YA 3I561 3Q87A 3H0GI 2VUMI 1WW9A 5AN9F 3F3FC 2E9HA 2VUGA 4E2XA 2KI7B 4DK1A 2LEXA 1YIJZ 3KIHA 5C4XI 1VLAA 3FQMA 3CC71 3CME1 3S1QI 4A3JI 1USPA 3J81b 1KQSY 3CCUZ 2NVTI 3I4NI 1VQ4Z 3RZOI 1S7MA 1VQ9Z 3HOXI 4CL1A 2GTHA 4BBSI 2YADA 4A3KI 1NP6A 2K5RA 4RS4A 3VMIA 1Q7Y2 1Y1WI 1K83I 3PO2I 2QKDA 4NBGA 2OTJZ 2Y0SA 3MONA 3VMGA 2E2HI 2F4MA 4AYBA 4A93I 2RHBA 1I3QI 1YIJ1 1YI21 2DE6A 1N8R1 4DGLA 1YJN1 1K8A2 3GTQI 2HU9A 4BY1I 2VF1A 5IT9f 3H3VJ 4NBFA 2JMOA 1S72Z 3J80b 3GKQA 2VPZA 3I55Z 2M48A 3S14I 3FQQA 1QVGY 2W04A 1KQSZ 1QVFY 1X3WA 4E2WA 2JIMA 1NJI2 4NB8A 3CCLZ 2OTJ1 4MRIA 3HKZA 1QXFA 2JIPA 4HH4A 3GTPI 1Z02A
chains in the Genus database with same CATH topology
1TWFI 2RIQA 4EWCA 1PFTA 3CC21 3GTLI 2QREB 1S721 1VQLZ 2IZ3A 4HGYA 1Q861 1M902 3CCSZ 3CC4Z 3JAMb 3CCM1 2NVQI 4RV9A 3IX0A 2Q51A 2PMZA 3GTMS 3I07A 3VMHA 3S1RI 3KIFA 3S2HI 4MD9A 3QWUA 2OOXB 2GTIA 1QVGZ 2P28A 1QVFZ 1ML8A 3I4MI 1RNIA 2P3YA 3CCEZ 2Q4ZA 2OTLZ 3S15I 2QA4Z 3CCS1 2QEXZ 2GU2A 1VQ5Z 2KPIA 1K731 3OW2Y 1K9M1 1W2BZ 1VQ61 4RVFA 5FLXf 1VQPZ 1YUAA 3T4NB 5C3EI 5A2Qf 3G4SZ 2J6AA 1YJ9Z 4QTTA 3CCR1 3NH4A 2HF1A 1WCMI 4A3EI 2QLVB 4A3GI 3LUSA 2OTL1 2B63I 3G6EZ 5IT9b 1ZB9A 3RZDI 2OOYB 1M1K2 4NBAA 3HOUI 3PO3I 1VQ51 3GTOI 3NFZA 4RVGA 1TWHI 1VQ8Z 2JUBA 1X3ZA 1Q7Y1 2QR1B 1SFOI 3CCU1 2WB1A 1VQ41 2R92I 2RPRA 4NOZA 1VQ91 5D1OB 1JWHC 2G2KA 3OW2Z 4A3DI 3CXCY 1Q812 4NBCA 1Q822 3M3YI 4Y52I 5T64A 1K8A1 4MD8A 3CCVZ 3IF8A 1KC82 3TE5B 2R93I 3NDJA 1I50I 2DE7A 1ZH1A 1VQ7Z 3EEDA 3D9XA 1VQ81 2JA7I 1R9TI 2JNYA 1W2BY 1VQKZ 3HOVI 3GCFA 2R6MA 3HOZI 2LIYA 1VQOZ 3U50C 3J80f 5C4JI 3I551 1VQNZ 1QYPA 4TNUA 4MD7A 1ZB8A 4A3CI 1VQMZ 1I6HI 1Y1VI 3ESWA 1WIIA 1RO0A 3CCL1 2NVXI 3D6WA 3I56Z 2QRDB 3CCV1 2F4OA 4BXXI 3CCJZ 1KD12 2QRCB 4A3FI 3NH5A 3CXCZ 1M901 2OZKA 1Z03A 4Y7NI 4E2ZA 4X6AI 2M6NA 5FLXb 3CQZI 3CC7Z 2R7ZI 1YITZ 4E32A 4DQYB 1VQL1 2RT9A 3CMEZ 3CPWY 3FKII 5A2Qb 1YJWZ 1JJ2Y 2V8IA 3MZLB 4E30A 1VQN1 4MONA 3CC41 3GTJI 3JAMf 1KRLA 1RQFA 2PK7A 5T6BA 4NBEA 5FLMI 4QTUA 1TWAI 5CM2M 3CCJ1 3HOYI 2PM9A 3S17I 2JS4A 2V8JA 2E2JI 3F3PC 1USPB 1X0TA 5T67A 4A3LI 3NDIA 1YI2Z 2EGTA 1TFIA 2WAQA 4NH1C 2JR6A 1RLYA 3CD6Z 1YJNZ 3CCE1 1YIT1 4MXUA 2I3CA 1YJW1 2E2II 2JA5I 2QA41 3VB9A 2QEX1 3M4OI 1QF8A 4E31A 3PO3S 1LQLA 4XX2A 1N8R2 2YU9I 3S2DI 4RVHA 3K7AI 4NB9A 1TWGI 3CPWZ 1RO4A 1VQP1 3CCQZ 2K3RA 1JJ2Z 3S1NI 4NBBA 3J81f 3G4S1 1YJ91 2AKLA 4HGZA 4MH4A 4E33A 1NUIA 3S16I 5D1PA 4A3BI 1M1K1 3VTNA 3CD61 2H85A 3G71Z 1TWCI 3G6E1 5IP9I 3J7A4 3GTKI 2JA6I 3CC2Z 5D1OA 3TDHB 4RVDA 2BJOA 2IZ4A 2NVYI 1P9NA 4A3II 3HOWI 2RBLA 1YUKA 1L1OC 2V8KA 3CCMZ 1Q811 1Q821 3MZKB 3CCQ1 4S1TA 3EERA 4BBRI 1Q862 1NJI1 2W03A 3GTGI 1DL6A 5C44I 3CMAZ 1KC81 4NFRA 3BG1B 2DE5A 2O4HA 1Y1VS 3NH8A 1YHQZ 3G711 5IP7I 1Z01A 1RO2A 4NBHA 2ZAEB 3S1MI 2LFUA 1VQ71 2O53A 3BG0B 1VQK1 1VQ6Z 5LL6f 1VQO1 4BY7I 3GTMI 4A3MI 3CMA1 4NBDA 3P5JB 1KD11 1VQM1 1K732 1K9M2 3IFUA 1YHQ1 3CCRZ 2JA8I 1N2FA 4E2YA 3I561 3Q87A 3H0GI 2VUMI 1WW9A 5AN9F 3F3FC 2E9HA 2VUGA 4E2XA 2KI7B 4DK1A 1YIJZ 3KIHA 5C4XI 1VLAA 3FQMA 3CC71 3CME1 3S1QI 4A3JI 1USPA 3J81b 1KQSY 3CCUZ 2NVTI 3I4NI 1VQ4Z 3RZOI 1S7MA 1VQ9Z 3HOXI 4CL1A 2GTHA 4BBSI 2YADA 4A3KI 1NP6A 2K5RA 4RS4A 3VMIA 1Q7Y2 1Y1WI 1K83I 3PO2I 2QKDA 4NBGA 2OTJZ 2Y0SA 3MONA 3VMGA 2E2HI 2F4MA 4AYBA 4A93I 2RHBA 1I3QI 1YIJ1 1YI21 2DE6A 1N8R1 4DGLA 1YJN1 1K8A2 3GTQI 2HU9A 4BY1I 2VF1A 5IT9f 3H3VJ 4NBFA 2JMOA 1S72Z 3J80b 3GKQA 3I55Z 2M48A 3S14I 3FQQA 1QVGY 2W04A 1KQSZ 1QVFY 1X3WA 4E2WA 1NJI2 4NB8A 3CCLZ 2OTJ1 4MRIA 3HKZA 4HH4A 3GTPI 1Z02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 1;  3CMA 1;  3CD6 Z;  1YJN Z;  1VQ9 1;  3CCE 1;  1YIT 1;  1KD1 1;  1VQM 1;  3OW2 Z;  3CC2 1;  1K73 2;  3CXC Y;  1YHQ 1;  1YJW 1;  3CCR Z;  1Q81 2;  1S72 1;  1VQL Z;  1K9M 2;  1Q82 2;  2QA4 1;  1Q86 1;  1M90 2;  3I56 1;  2QEX 1;  1K8A 1;  3CCS Z;  1N8R 2;  3CC4 Z;  3CCV Z;  3CCM 1;  1KC8 2;  3CPW Z;  1VQP 1;  3CCQ Z;  1YIJ Z;  1JJ2 Z;  3G4S 1;  1VQ7 Z;  1YJ9 1;  3CC7 1;  1VQ8 1;  1W2B Y;  1VQK Z;  3CME 1;  1M1K 1;  1KQS Y;  1QVG Z;  1VQO Z;  1QVF Z;  3CD6 1;  3CCU Z;  3G71 Z;  1VQ4 Z;  3G6E 1;  3I55 1;  1VQN Z;  1VQ9 Z;  3CCE Z;  2OTL Z;  1VQM Z;  3CC2 Z;  2QA4 Z;  1Q7Y 2;  3CCS 1;  3CCL 1;  3I56 Z;  2QEX Z;  3CCV 1;  2OTJ Z;  1VQ5 Z;  3CCJ Z;  1K73 1;  3OW2 Y;  1K9M 1;  3CCM Z;  1W2B Z;  1Q81 1;  1KD1 2;  1VQ6 1;  1Q82 1;  3CCQ 1;  3CXC Z;  1YIJ 1;  1YI2 1;  1M90 1;  1VQP Z;  1NJI 1;  1Q86 2;  3G4S Z;  1N8R 1;  1YJN 1;  1YJ9 Z;  1K8A 2;  3CMA Z;  3CC7 Z;  1KC8 1;  1YIT Z;  3CCR 1;  1VQL 1;  3CME Z;  3CPW Y;  1YJW Z;  1YHQ Z;  1S72 Z;  3G71 1;  1JJ2 Y;  1VQN 1;  3CC4 1;  2OTL 1;  3G6E Z;  3I55 Z;  1QVG Y;  1M1K 2;  1KQS Z;  1QVF Y;  1NJI 2;  1VQ7 1;  3CCL Z;  2OTJ 1;  1VQ5 1;  3CCJ 1;  1VQK 1;  1VQ8 Z;  1VQ6 Z;  1VQO 1;  1Q7Y 1;  1YI2 Z;  3CCU 1; 
#chains in the Genus database with same CATH topology
 1TWF I;  2RIQ A;  4EWC A;  1PFT A;  3CC2 1;  3GTL I;  2QRE B;  1S72 1;  1VQL Z;  2IZ3 A;  4HGY A;  1Q86 1;  1M90 2;  3CCS Z;  2VPW A;  3CC4 Z;  3JAM b;  3CCM 1;  2NVQ I;  2E7Z A;  4RV9 A;  3IX0 A;  2Q51 A;  2PMZ A;  3GTM S;  3I07 A;  3VMH A;  3S1R I;  3KIF A;  3S2H I;  4MD9 A;  3QWU A;  2OOX B;  2GTI A;  1QVG Z;  2P28 A;  1QVF Z;  1ML8 A;  1WZN A;  3I4M I;  1RNI A;  2P3Y A;  3CCE Z;  2Q4Z A;  2OTL Z;  3S15 I;  2QA4 Z;  3CCS 1;  2QEX Z;  2GU2 A;  1VQ5 Z;  2KPI A;  3D2L A;  1SIW A;  1Y8C A;  3OW2 Y;  1K73 1;  1W2B Z;  1K9M 1;  4RVF A;  1VQ6 1;  5FLX f;  1VQP Z;  1YUA A;  3T4N B;  5C3E I;  5A2Q f;  3G4S Z;  2J6A A;  1YJ9 Z;  4QTT A;  3CCR 1;  3NH4 A;  2HF1 A;  1WCM I;  4A3E I;  2QLV B;  4A3G I;  3LUS A;  2OTL 1;  2B63 I;  3G6E Z;  5IT9 b;  1ZB9 A;  3RZD I;  2OOY B;  1M1K 2;  4NBA A;  3HOU I;  3PO3 I;  1VQ5 1;  3GTO I;  3NFZ A;  4RVG A;  1TWH I;  1VQ8 Z;  2JUB A;  1X3Z A;  1Q7Y 1;  2QR1 B;  2JIQ A;  1SFO I;  3CCU 1;  2WB1 A;  1VQ4 1;  2R92 I;  2RPR A;  4NOZ A;  1VQ9 1;  5D1O B;  1JWH C;  2G2K A;  3OW2 Z;  4A3D I;  3CXC Y;  1Q81 2;  4NBC A;  1Q82 2;  3M3Y I;  4Y52 I;  5T64 A;  1K8A 1;  4MD8 A;  2IV2 X;  3CCV Z;  3IR7 A;  3IF8 A;  1KC8 2;  3TE5 B;  2R93 I;  3NDJ A;  1I50 I;  2DE7 A;  1ZH1 A;  1VQ7 Z;  3EED A;  3D9X A;  1VQ8 1;  2JA7 I;  1R9T I;  2JNY A;  1W2B Y;  1VQK Z;  3HOV I;  3GCF A;  2R6M A;  3HOZ I;  2LIY A;  1VQO Z;  3U50 C;  3J80 f;  5C4J I;  3I55 1;  1VQN Z;  1QYP A;  4TNU A;  4MD7 A;  1ZB8 A;  4A3C I;  1FDI A;  2AYD A;  1VQM Z;  1I6H I;  1Y1V I;  3ESW A;  1WII A;  1RO0 A;  3CCL 1;  2NVX I;  3D6W A;  3I56 Z;  2V45 A;  2QRD B;  2JIR A;  3CCV 1;  2F4O A;  4BXX I;  3CCJ Z;  1KD1 2;  2QRC B;  4A3F I;  3NH5 A;  3CXC Z;  1M90 1;  2OZK A;  1Z03 A;  4Y7N I;  4E2Z A;  4X6A I;  2M6N A;  5FLX b;  3CQZ I;  3CC7 Z;  2R7Z I;  1YIT Z;  4E32 A;  4DQY B;  1VQL 1;  2RT9 A;  3CME Z;  3CPW Y;  3FKI I;  5A2Q b;  1YJW Z;  1JJ2 Y;  2V8I A;  1AA6 A;  3MZL B;  4E30 A;  1VQN 1;  4MON A;  3CC4 1;  3GTJ I;  3JAM f;  1KRL A;  1RQF A;  2PK7 A;  5T6B A;  4NBE A;  5FLM I;  4QTU A;  1TWA I;  5CM2 M;  3CCJ 1;  3HOY I;  2PM9 A;  3S17 I;  2JS4 A;  2V8J A;  2E2J I;  3F3P C;  1USP B;  1X0T A;  5T67 A;  4A3L I;  3NDI A;  1YI2 Z;  2EGT A;  1TFI A;  2WAQ A;  2JIO A;  4NH1 C;  2JR6 A;  1RLY A;  3CD6 Z;  1YJN Z;  3CCE 1;  1YIT 1;  1FDO A;  4MXU A;  2I3C A;  1YJW 1;  2E2I I;  2JA5 I;  2QA4 1;  3VB9 A;  2QEX 1;  3M4O I;  1QF8 A;  4E31 A;  3PO3 S;  1LQL A;  4XX2 A;  1N8R 2;  2YU9 I;  3S2D I;  4RVH A;  3K7A I;  4NB9 A;  1TWG I;  3CPW Z;  1RO4 A;  1VQP 1;  3CCQ Z;  2K3R A;  1JJ2 Z;  3S1N I;  4NBB A;  3J81 f;  3G4S 1;  1YJ9 1;  2AKL A;  4HGZ A;  4MH4 A;  4E33 A;  1NUI A;  3S16 I;  5D1P A;  4A3B I;  1M1K 1;  3VTN A;  2VPY A;  3CD6 1;  2H85 A;  3G71 Z;  1TWC I;  3G6E 1;  5IP9 I;  3J7A 4;  3GTK I;  2JA6 I;  2NAP A;  3CC2 Z;  5D1O A;  3TDH B;  4RVD A;  2BJO A;  1WJ2 A;  2IZ4 A;  2NVY I;  1P9N A;  4A3I I;  3HOW I;  2VPX A;  2RBL A;  1YUK A;  1L1O C;  2V8K A;  3CCM Z;  1Q81 1;  1Q82 1;  3MZK B;  3CCQ 1;  4S1T A;  3EER A;  4BBR I;  1Q86 2;  1NJI 1;  2W03 A;  3GTG I;  1DL6 A;  5C44 I;  3CMA Z;  1KC8 1;  4NFR A;  3BG1 B;  2DE5 A;  2O4H A;  1Y1V S;  3NH8 A;  1YHQ Z;  3G71 1;  5IP7 I;  1Z01 A;  1RO2 A;  1Q16 A;  4NBH A;  2ZAE B;  3S1M I;  2LFU A;  1VQ7 1;  2O53 A;  3BG0 B;  1VQK 1;  1VQ6 Z;  5LL6 f;  1VQO 1;  4BY7 I;  3GTM I;  4A3M I;  3CMA 1;  4NBD A;  2V3V A;  3P5J B;  1KD1 1;  1VQM 1;  1K73 2;  1K9M 2;  3IFU A;  1YHQ 1;  3CCR Z;  2JA8 I;  1N2F A;  4E2Y A;  3I56 1;  3Q87 A;  3H0G I;  2VUM I;  1WW9 A;  5AN9 F;  3F3F C;  2E9H A;  2VUG A;  4E2X A;  2KI7 B;  4DK1 A;  2LEX A;  1YIJ Z;  3KIH A;  5C4X I;  1VLA A;  3FQM A;  3CC7 1;  3CME 1;  3S1Q I;  4A3J I;  1USP A;  3J81 b;  1KQS Y;  3CCU Z;  2NVT I;  3I4N I;  1VQ4 Z;  3RZO I;  1S7M A;  1VQ9 Z;  3HOX I;  4CL1 A;  2GTH A;  4BBS I;  2YAD A;  4A3K I;  1NP6 A;  2K5R A;  4RS4 A;  3VMI A;  1Q7Y 2;  1Y1W I;  1K83 I;  3PO2 I;  2QKD A;  4NBG A;  2OTJ Z;  2Y0S A;  3MON A;  3VMG A;  2E2H I;  2F4M A;  4AYB A;  4A93 I;  2RHB A;  1I3Q I;  1YIJ 1;  1YI2 1;  2DE6 A;  1N8R 1;  4DGL A;  1YJN 1;  1K8A 2;  3GTQ I;  2HU9 A;  4BY1 I;  2VF1 A;  5IT9 f;  3H3V J;  4NBF A;  2JMO A;  1S72 Z;  3J80 b;  3GKQ A;  2VPZ A;  3I55 Z;  2M48 A;  3S14 I;  3FQQ A;  1QVG Y;  2W04 A;  1KQS Z;  1QVF Y;  1X3W A;  4E2W A;  2JIM A;  1NJI 2;  4NB8 A;  3CCL Z;  2OTJ 1;  4MRI A;  3HKZ A;  1QXF A;  2JIP A;  4HH4 A;  3GTP I;  1Z02 A; 
#chains in the Genus database with same CATH homology
 1TWF I;  2RIQ A;  4EWC A;  1PFT A;  3CC2 1;  3GTL I;  2QRE B;  1S72 1;  1VQL Z;  2IZ3 A;  4HGY A;  1Q86 1;  1M90 2;  3CCS Z;  3CC4 Z;  3JAM b;  3CCM 1;  2NVQ I;  4RV9 A;  3IX0 A;  2Q51 A;  2PMZ A;  3GTM S;  3I07 A;  3VMH A;  3S1R I;  3KIF A;  3S2H I;  4MD9 A;  3QWU A;  2OOX B;  2GTI A;  1QVG Z;  2P28 A;  1QVF Z;  1ML8 A;  3I4M I;  1RNI A;  2P3Y A;  3CCE Z;  2Q4Z A;  2OTL Z;  3S15 I;  2QA4 Z;  3CCS 1;  2QEX Z;  2GU2 A;  1VQ5 Z;  2KPI A;  1K73 1;  3OW2 Y;  1K9M 1;  1W2B Z;  1VQ6 1;  4RVF A;  5FLX f;  1VQP Z;  1YUA A;  3T4N B;  5C3E I;  5A2Q f;  3G4S Z;  2J6A A;  1YJ9 Z;  4QTT A;  3CCR 1;  3NH4 A;  2HF1 A;  1WCM I;  4A3E I;  2QLV B;  4A3G I;  3LUS A;  2OTL 1;  2B63 I;  3G6E Z;  5IT9 b;  1ZB9 A;  3RZD I;  2OOY B;  1M1K 2;  4NBA A;  3HOU I;  3PO3 I;  1VQ5 1;  3GTO I;  3NFZ A;  4RVG A;  1TWH I;  1VQ8 Z;  2JUB A;  1X3Z A;  1Q7Y 1;  2QR1 B;  1SFO I;  3CCU 1;  2WB1 A;  1VQ4 1;  2R92 I;  2RPR A;  4NOZ A;  1VQ9 1;  5D1O B;  1JWH C;  2G2K A;  3OW2 Z;  4A3D I;  3CXC Y;  1Q81 2;  4NBC A;  1Q82 2;  3M3Y I;  4Y52 I;  5T64 A;  1K8A 1;  4MD8 A;  3CCV Z;  3IF8 A;  1KC8 2;  3TE5 B;  2R93 I;  3NDJ A;  1I50 I;  2DE7 A;  1ZH1 A;  1VQ7 Z;  3EED A;  3D9X A;  1VQ8 1;  2JA7 I;  1R9T I;  2JNY A;  1W2B Y;  1VQK Z;  3HOV I;  3GCF A;  2R6M A;  3HOZ I;  2LIY A;  1VQO Z;  3U50 C;  3J80 f;  5C4J I;  3I55 1;  1VQN Z;  1QYP A;  4TNU A;  4MD7 A;  1ZB8 A;  4A3C I;  1VQM Z;  1I6H I;  1Y1V I;  3ESW A;  1WII A;  1RO0 A;  3CCL 1;  2NVX I;  3D6W A;  3I56 Z;  2QRD B;  3CCV 1;  2F4O A;  4BXX I;  3CCJ Z;  1KD1 2;  2QRC B;  4A3F I;  3NH5 A;  3CXC Z;  1M90 1;  2OZK A;  1Z03 A;  4Y7N I;  4E2Z A;  4X6A I;  2M6N A;  5FLX b;  3CQZ I;  3CC7 Z;  2R7Z I;  1YIT Z;  4E32 A;  4DQY B;  1VQL 1;  2RT9 A;  3CME Z;  3CPW Y;  3FKI I;  5A2Q b;  1YJW Z;  1JJ2 Y;  2V8I A;  3MZL B;  4E30 A;  1VQN 1;  4MON A;  3CC4 1;  3GTJ I;  3JAM f;  1KRL A;  1RQF A;  2PK7 A;  5T6B A;  4NBE A;  5FLM I;  4QTU A;  1TWA I;  5CM2 M;  3CCJ 1;  3HOY I;  2PM9 A;  3S17 I;  2JS4 A;  2V8J A;  2E2J I;  3F3P C;  1USP B;  1X0T A;  5T67 A;  4A3L I;  3NDI A;  1YI2 Z;  2EGT A;  1TFI A;  2WAQ A;  4NH1 C;  2JR6 A;  1RLY A;  3CD6 Z;  1YJN Z;  3CCE 1;  1YIT 1;  4MXU A;  2I3C A;  1YJW 1;  2E2I I;  2JA5 I;  2QA4 1;  3VB9 A;  2QEX 1;  3M4O I;  1QF8 A;  4E31 A;  3PO3 S;  1LQL A;  4XX2 A;  1N8R 2;  2YU9 I;  3S2D I;  4RVH A;  3K7A I;  4NB9 A;  1TWG I;  3CPW Z;  1RO4 A;  1VQP 1;  3CCQ Z;  2K3R A;  1JJ2 Z;  3S1N I;  4NBB A;  3J81 f;  3G4S 1;  1YJ9 1;  2AKL A;  4HGZ A;  4MH4 A;  4E33 A;  1NUI A;  3S16 I;  5D1P A;  4A3B I;  1M1K 1;  3VTN A;  3CD6 1;  2H85 A;  3G71 Z;  1TWC I;  3G6E 1;  5IP9 I;  3J7A 4;  3GTK I;  2JA6 I;  3CC2 Z;  5D1O A;  3TDH B;  4RVD A;  2BJO A;  2IZ4 A;  2NVY I;  1P9N A;  4A3I I;  3HOW I;  2RBL A;  1YUK A;  1L1O C;  2V8K A;  3CCM Z;  1Q81 1;  1Q82 1;  3MZK B;  3CCQ 1;  4S1T A;  3EER A;  4BBR I;  1Q86 2;  1NJI 1;  2W03 A;  3GTG I;  1DL6 A;  5C44 I;  3CMA Z;  1KC8 1;  4NFR A;  3BG1 B;  2DE5 A;  2O4H A;  1Y1V S;  3NH8 A;  1YHQ Z;  3G71 1;  5IP7 I;  1Z01 A;  1RO2 A;  4NBH A;  2ZAE B;  3S1M I;  2LFU A;  1VQ7 1;  2O53 A;  3BG0 B;  1VQK 1;  1VQ6 Z;  5LL6 f;  1VQO 1;  4BY7 I;  3GTM I;  4A3M I;  3CMA 1;  4NBD A;  3P5J B;  1KD1 1;  1VQM 1;  1K73 2;  1K9M 2;  3IFU A;  1YHQ 1;  3CCR Z;  2JA8 I;  1N2F A;  4E2Y A;  3I56 1;  3Q87 A;  3H0G I;  2VUM I;  1WW9 A;  5AN9 F;  3F3F C;  2E9H A;  2VUG A;  4E2X A;  2KI7 B;  4DK1 A;  1YIJ Z;  3KIH A;  5C4X I;  1VLA A;  3FQM A;  3CC7 1;  3CME 1;  3S1Q I;  4A3J I;  1USP A;  3J81 b;  1KQS Y;  3CCU Z;  2NVT I;  3I4N I;  1VQ4 Z;  3RZO I;  1S7M A;  1VQ9 Z;  3HOX I;  4CL1 A;  2GTH A;  4BBS I;  2YAD A;  4A3K I;  1NP6 A;  2K5R A;  4RS4 A;  3VMI A;  1Q7Y 2;  1Y1W I;  1K83 I;  3PO2 I;  2QKD A;  4NBG A;  2OTJ Z;  2Y0S A;  3MON A;  3VMG A;  2E2H I;  2F4M A;  4AYB A;  4A93 I;  2RHB A;  1I3Q I;  1YIJ 1;  1YI2 1;  2DE6 A;  1N8R 1;  4DGL A;  1YJN 1;  1K8A 2;  3GTQ I;  2HU9 A;  4BY1 I;  2VF1 A;  5IT9 f;  3H3V J;  4NBF A;  2JMO A;  1S72 Z;  3J80 b;  3GKQ A;  3I55 Z;  2M48 A;  3S14 I;  3FQQ A;  1QVG Y;  2W04 A;  1KQS Z;  1QVF Y;  1X3W A;  4E2W A;  1NJI 2;  4NB8 A;  3CCL Z;  2OTJ 1;  4MRI A;  3HKZ A;  4HH4 A;  3GTP I;  1Z02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...