1Q861

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q86100
1VQOZ 3CD61 1KC81 3CC2Z 1YHQZ 1S72Z 2OTLZ 1VQ61 1VQN1 3CCQ1 3CME1 1Q862 3CCU1 2QA41 1VQ9Z 1QVFZ 1K9M2 1VQL1 1Q861 3CMEZ 1YJN1 1N8R2 3I551 2OTL1 3CCLZ 1K9M1 3CCUZ 2QA4Z 3CC71 1N8R1 1NJI2 1VQ4Z 1VQKZ 1YIT1 1VQLZ 1YJNZ 1VQ91 3I55Z 1YIJ1 3CCR1 1NJI1 3CCE1 1K732 3CC41 3CCV1 1VQ81 3CC7Z 3CCS1 3CCL1 3I561 1YITZ 1W2BZ 1K731 1VQ41 1YIJZ 1VQK1 3CCRZ 3CCEZ 1W2BY 1Q822 3CC4Z 3CCVZ 1VQ8Z 3G711 1VQM1 3CCSZ 3CXCZ 1KQSY 3I56Z 3CPWY 1Q821 3CXCY 1M1K2 1JJ2Y 1YJW1 1Q812 3G71Z 1VQMZ 3CCM1 1M1K1 1VQ5Z 3CMAZ 1Q811 1M902 1YJWZ 3CCJ1 3CCMZ 1YJ91 1M901 3G6E1 1KQSZ 1VQ71 3CPWZ 3OW2Z 1VQ51 1JJ2Z 3OW2Y 1KD12 1K8A2 3CCJZ 3CMA1 2OTJ1 1YJ9Z 3G4S1 3G6EZ 1QVGZ 1VQ7Z 1KD11 1K8A1 2QEX1 1QVGY 1VQP1 1Q7Y2 3CD6Z 1YI21 2OTJZ 1VQ6Z 1VQNZ 3G4SZ 3CCQZ 1VQO1 1QVFY 3CC21 1YHQ1 1S721 1Q7Y1 2QEXZ 1VQPZ 1KC82 1YI2Z
chains in the Genus database with same CATH superfamily
1KC81 2JA8I 1Y1VI 3J7A4 3HKZA 1VLAA 3CME1 1Q862 4E31A 1K9M2 1VQL1 2YADA 5IP7I 1Q861 1YJN1 2QREB 2GU2A 1K9M1 2VUMI 2NVQI 1NJI2 5D1OB 1YIT1 2I3CA 3NH8A 3HOVI 4MONA 3I55Z 1Z01A 2PMZA 1NJI1 1I6HI 3S15I 1K732 3CCV1 1ML8A 3CCS1 4NBEA 3F3FC 1W2BZ 4NBFA 1K731 5D1PA 2JS4A 1YIJZ 3CCRZ 2K3RA 2JIMA 3CC4Z 4NOZA 1VQ8Z 4A3EI 1VQM1 1KQSY 3I56Z 4MXUA 3MONA 1TWHI 4NBBA 2W03A 2H85A 4RS4A 1VQ5Z 4A3DI 4BBRI 2K5RA 3EEDA 5A2Qf 3CCMZ 4A3CI 1YUAA 3ESWA 3BG1B 1S7MA 1JJ2Z 1KD12 4BXXI 3CCJZ 3CMA1 1YJ9Z 2E7ZA 3G4S1 2JUBA 4QTUA 4RVHA 1KD11 1QVGY 3VMHA 1Q7Y2 3U50C 1Y1VS 4EWCA 1VQNZ 1R9TI 1I3QI 2O53A 2R6MA 3S1MI 1Q7Y1 2HU9A 3TDHB 1SFOI 4A3JI 4MRIA 2R92I 4HGYA 1VQOZ 3NH5A 2VPZA 3S2DI 1YHQZ 2OOXB 2OTLZ 1VQ61 3CCQ1 3Q87A 5FLXf 4NBAA 5C44I 2R93I 3VTNA 3S17I 5C4XI 3RZDI 3IFUA 4E30A 2E2JI 3S1RI 5IT9f 4NBGA 1ZB8A 3I551 3CCLZ 1FDIA 2W04A 3CCUZ 2QA4Z 1N2FA 2JIOA 3KIFA 5A2Qb 2WAQA 1VQ91 4X6AI 1TWGI 2PM9A 1YIJ1 3CCR1 3D2LA 2QKDA 2J6AA 3CC41 2GTIA 1VQ81 2YU9I 3CC7Z 2VPWA 3I561 2DE6A 5IP9I 3NDIA 1I50I 3GTQI 2Y0SA 2BJOA 5C4JI 2E2II 1VQ41 1VQK1 1YUKA 2JA5I 3HOYI 3D6WA 3CCEZ 3IR7A 3S1NI 3GKQA 1SIWA 3S16I 2JIPA 3RZOI 2NVYI 3I4NI 3CQZI 3CXCY 1WJ2A 4HGZA 3S2HI 3GTKI 1Q812 1RO0A 3G71Z 3CCM1 4E32A 2NVXI 2IV2X 2IZ4A 4NBCA 1Q811 3H0GI 4S1TA 2AYDA 1WIIA 2M48A 3JAMf 3CCJ1 1YJ91 2E9HA 5FLXb 5T67A 1RQFA 3CPWZ 3GTGI 4NFRA 4A3LI 2JIQA 3OW2Y 5IT9b 3MZKB 3G6EZ 1QVGZ 4BY1I 4E33A 1P9NA 2EGTA 1NUIA 1VQO1 2JNYA 1YHQ1 3J80f 2V8KA 1L1OC 1VQPZ 4BBSI 2Q4ZA 2OOYB 1WW9A 4XX2A 3IX0A 1YI2Z 3H3VJ 2P28A 4TNUA 3HOUI 2VPXA 1Y1WI 3CD61 1S72Z 2VUGA 4NBDA 4A3II 4DGLA 3CCU1 2QA41 2QRDB 4Y52I 1QVFZ 3GCFA 4E2ZA 1RNIA 2QRCB 1RO2A 2KI7B 3CC71 5T6BA 2JR6A 3T4NB 2F4MA 1WCMI 3JAMb 1X3ZA 2DE7A 4QTTA 2AKLA 2LIYA 3P5JB 3CCE1 1ZB9A 2QLVB 1RO4A 1NP6A 4RVDA 2JA7I 1TFIA 4E2XA 3HOWI 3GTMS 2JIRA 3IF8A 2V45A 1Q822 3F3PC 2GTHA 3G711 3CXCZ 2VPYA 2G2KA 1USPB 1TWCI 4Y7NI 3J81f 1Q821 1M1K2 4RVFA 1JJ2Y 3J80b 3S1QI 2R7ZI 1M1K1 1JWHC 3HOXI 1X3WA 4MD7A 3CMAZ 2NVTI 4NH1C 1YJWZ 2RHBA 2B63I 1WZNA 2V3VA 3M3YI 3FQMA 3G6E1 2V8JA 1KQSZ 4RV9A 3K7AI 3OW2Z 2DE5A 1VQ51 3LUSA 4A3KI 1VQ7Z 4DQYB 5AN9F 1VQP1 3GTMI 2RT9A 1YI21 2OTJZ 1VQ6Z 3NH4A 3CCQZ 1KRLA 3D9XA 1X0TA 1S721 1Y8CA 2QEXZ 3PO2I 2RBLA 1FDOA 3NDJA 1QF8A 3NFZA 4MD9A 3GTJI 3PO3S 3KIHA 1QYPA 3CC2Z 1VQN1 2RIQA 5C3EI 3GTPI 1PFTA 2V8IA 1K83I 2M6NA 4A3FI 3FKII 3J81b 3EERA 1VQ9Z 3M4OI 4MD8A 1AA6A 1TWAI 2PK7A 3VMGA 5CM2M 3CMEZ 1RLYA 4MH4A 1N8R2 2OTL1 4NB8A 1TWFI 4E2WA 1QXFA 1N8R1 1VQ4Z 1VQKZ 5LL6f 2O4HA 2Q51A 4RVGA 1VQLZ 2E2HI 1YJNZ 3I4MI 3GTLI 2RPRA 4A3MI 2JMOA 1DL6A 4NB9A 1ZH1A 5T64A 3GTOI 3CCL1 4A93I 1YITZ 4A3BI 3FQQA 3PO3I 1W2BY 2F4OA 2IZ3A 3CCVZ 1USPA 3VMIA 1Z02A 3CCSZ 3TE5B 2P3YA 3CPWY 2NAPA 3HOZI 2HF1A 1YJW1 1VQMZ 2WB1A 1M902 3S14I 2QR1B 3I07A 4DK1A 1M901 2LFUA 2JA6I 1VQ71 1LQLA 2LEXA 2VF1A 3QWUA 3MZLB 3BG0B 1Z03A 1K8A2 2OTJ1 1Q16A 2OZKA 4NBHA 2ZAEB 4BY7I 4E2YA 4A3GI 1K8A1 2QEX1 4AYBA 3CD6Z 4CL1A 3G4SZ 5FLMI 1QVFY 3CC21 2KPIA 3VB9A 5D1OA 1KC82 4HH4A
chains in the Genus database with same CATH topology
1KC81 2JA8I 1Y1VI 3J7A4 3HKZA 1VLAA 3CME1 1Q862 4E31A 1K9M2 1VQL1 2YADA 5IP7I 1Q861 1YJN1 2QREB 2GU2A 1K9M1 2VUMI 2NVQI 1NJI2 5D1OB 1YIT1 2I3CA 3NH8A 3HOVI 4MONA 3I55Z 1Z01A 2PMZA 1NJI1 1I6HI 3S15I 1K732 3CCV1 1ML8A 3CCS1 4NBEA 3F3FC 1W2BZ 4NBFA 1K731 5D1PA 2JS4A 1YIJZ 3CCRZ 2K3RA 3CC4Z 4NOZA 1VQ8Z 4A3EI 1VQM1 1KQSY 3I56Z 4MXUA 3MONA 1TWHI 4NBBA 2W03A 2H85A 4RS4A 1VQ5Z 4A3DI 4BBRI 2K5RA 3EEDA 5A2Qf 3CCMZ 4A3CI 1YUAA 3ESWA 3BG1B 1S7MA 1JJ2Z 1KD12 4BXXI 3CCJZ 3CMA1 1YJ9Z 3G4S1 2JUBA 4QTUA 4RVHA 1KD11 1QVGY 3VMHA 1Q7Y2 3U50C 1Y1VS 4EWCA 1VQNZ 1R9TI 1I3QI 2O53A 2R6MA 3S1MI 1Q7Y1 2HU9A 3TDHB 1SFOI 4A3JI 4MRIA 2R92I 4HGYA 1VQOZ 3NH5A 3S2DI 1YHQZ 2OOXB 2OTLZ 1VQ61 3CCQ1 3Q87A 5FLXf 4NBAA 5C44I 2R93I 3VTNA 3S17I 5C4XI 3RZDI 3IFUA 4E30A 2E2JI 3S1RI 5IT9f 4NBGA 1ZB8A 3I551 3CCLZ 2W04A 3CCUZ 2QA4Z 1N2FA 3KIFA 5A2Qb 2WAQA 1VQ91 4X6AI 1TWGI 2PM9A 1YIJ1 3CCR1 2QKDA 2J6AA 3CC41 2GTIA 1VQ81 2YU9I 3CC7Z 3I561 2DE6A 5IP9I 3NDIA 1I50I 3GTQI 2Y0SA 2BJOA 5C4JI 2E2II 1VQ41 1VQK1 1YUKA 2JA5I 3HOYI 3D6WA 3CCEZ 3S1NI 3GKQA 3S16I 3RZOI 2NVYI 3I4NI 3CQZI 3CXCY 4HGZA 3S2HI 3GTKI 1Q812 1RO0A 3G71Z 3CCM1 4E32A 2NVXI 2IZ4A 4NBCA 1Q811 3H0GI 4S1TA 1WIIA 2M48A 3JAMf 3CCJ1 1YJ91 2E9HA 5FLXb 5T67A 1RQFA 3CPWZ 3GTGI 4NFRA 4A3LI 3OW2Y 5IT9b 3MZKB 3G6EZ 1QVGZ 4BY1I 4E33A 1P9NA 2EGTA 1NUIA 1VQO1 2JNYA 1YHQ1 3J80f 2V8KA 1L1OC 1VQPZ 4BBSI 2Q4ZA 2OOYB 1WW9A 4XX2A 3IX0A 1YI2Z 3H3VJ 2P28A 4TNUA 3HOUI 1Y1WI 3CD61 1S72Z 2VUGA 4NBDA 4A3II 4DGLA 3CCU1 2QA41 2QRDB 4Y52I 1QVFZ 3GCFA 4E2ZA 1RNIA 2QRCB 2KI7B 1RO2A 3CC71 5T6BA 2JR6A 3T4NB 2F4MA 1WCMI 3JAMb 1X3ZA 2DE7A 4QTTA 2AKLA 2LIYA 3P5JB 3CCE1 1ZB9A 2QLVB 1RO4A 1NP6A 4RVDA 2JA7I 1TFIA 4E2XA 3HOWI 3GTMS 3IF8A 1Q822 3F3PC 2GTHA 3G711 3CXCZ 2G2KA 1USPB 1TWCI 4Y7NI 3J81f 1Q821 1M1K2 4RVFA 1JJ2Y 3J80b 3S1QI 2R7ZI 1M1K1 1JWHC 3HOXI 1X3WA 4MD7A 3CMAZ 2NVTI 4NH1C 1YJWZ 2RHBA 2B63I 3M3YI 3FQMA 3G6E1 2V8JA 1KQSZ 4RV9A 3K7AI 3OW2Z 2DE5A 1VQ51 3LUSA 4A3KI 1VQ7Z 4DQYB 5AN9F 1VQP1 3GTMI 2RT9A 1YI21 2OTJZ 1VQ6Z 3NH4A 3CCQZ 1KRLA 3D9XA 1X0TA 1S721 2QEXZ 3PO2I 2RBLA 3NFZA 3NDJA 1QF8A 4MD9A 3GTJI 3PO3S 3KIHA 1QYPA 3CC2Z 1VQN1 2RIQA 5C3EI 3GTPI 1PFTA 2V8IA 1K83I 2M6NA 4A3FI 3FKII 3J81b 3EERA 1VQ9Z 3M4OI 4MD8A 1TWAI 2PK7A 3VMGA 5CM2M 3CMEZ 1RLYA 4MH4A 1N8R2 2OTL1 4NB8A 1TWFI 4E2WA 1N8R1 1VQ4Z 1VQKZ 5LL6f 2O4HA 2Q51A 4RVGA 1VQLZ 2E2HI 1YJNZ 3I4MI 3GTLI 2RPRA 4A3MI 2JMOA 1DL6A 4NB9A 1ZH1A 5T64A 3GTOI 3CCL1 4A93I 1YITZ 4A3BI 3FQQA 3PO3I 1W2BY 2F4OA 2IZ3A 3CCVZ 1USPA 3VMIA 1Z02A 3CCSZ 3TE5B 2P3YA 3CPWY 3HOZI 2HF1A 1YJW1 1VQMZ 2WB1A 1M902 3S14I 2QR1B 3I07A 4DK1A 1M901 2LFUA 2JA6I 1VQ71 1LQLA 2VF1A 3QWUA 3MZLB 3BG0B 1Z03A 1K8A2 2OTJ1 2OZKA 4NBHA 2ZAEB 4BY7I 4E2YA 4A3GI 1K8A1 2QEX1 4AYBA 3CD6Z 4CL1A 3G4SZ 5FLMI 1QVFY 3CC21 2KPIA 3VB9A 5D1OA 1KC82 4HH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO Z;  3CD6 1;  1KC8 1;  3CC2 Z;  1YHQ Z;  1S72 Z;  2OTL Z;  1VQ6 1;  1VQN 1;  3CCQ 1;  3CME 1;  1Q86 2;  3CCU 1;  2QA4 1;  1VQ9 Z;  1QVF Z;  1K9M 2;  1VQL 1;  1Q86 1;  3CME Z;  1YJN 1;  1N8R 2;  3I55 1;  2OTL 1;  3CCL Z;  1K9M 1;  3CCU Z;  2QA4 Z;  3CC7 1;  1N8R 1;  1NJI 2;  1VQ4 Z;  1VQK Z;  1YIT 1;  1VQL Z;  1YJN Z;  1VQ9 1;  3I55 Z;  1YIJ 1;  3CCR 1;  1NJI 1;  3CCE 1;  1K73 2;  3CC4 1;  3CCV 1;  1VQ8 1;  3CC7 Z;  3CCS 1;  3CCL 1;  3I56 1;  1YIT Z;  1W2B Z;  1K73 1;  1VQ4 1;  1YIJ Z;  1VQK 1;  3CCR Z;  3CCE Z;  1W2B Y;  1Q82 2;  3CC4 Z;  3CCV Z;  1VQ8 Z;  3G71 1;  1VQM 1;  3CCS Z;  3CXC Z;  1KQS Y;  3I56 Z;  3CPW Y;  1Q82 1;  3CXC Y;  1M1K 2;  1JJ2 Y;  1YJW 1;  1Q81 2;  3G71 Z;  1VQM Z;  3CCM 1;  1M1K 1;  1VQ5 Z;  3CMA Z;  1Q81 1;  1M90 2;  1YJW Z;  3CCJ 1;  3CCM Z;  1YJ9 1;  1M90 1;  3G6E 1;  1KQS Z;  1VQ7 1;  3CPW Z;  3OW2 Z;  1VQ5 1;  1JJ2 Z;  3OW2 Y;  1KD1 2;  1K8A 2;  3CCJ Z;  3CMA 1;  2OTJ 1;  1YJ9 Z;  3G4S 1;  3G6E Z;  1QVG Z;  1VQ7 Z;  1KD1 1;  1K8A 1;  2QEX 1;  1QVG Y;  1VQP 1;  1Q7Y 2;  3CD6 Z;  1YI2 1;  2OTJ Z;  1VQ6 Z;  1VQN Z;  3G4S Z;  3CCQ Z;  1VQO 1;  1QVF Y;  3CC2 1;  1YHQ 1;  1S72 1;  1Q7Y 1;  2QEX Z;  1VQP Z;  1KC8 2;  1YI2 Z; 
#chains in the Genus database with same CATH topology
 1KC8 1;  2JA8 I;  1Y1V I;  3J7A 4;  3HKZ A;  1VLA A;  3CME 1;  1Q86 2;  4E31 A;  1K9M 2;  1VQL 1;  2YAD A;  5IP7 I;  1Q86 1;  1YJN 1;  2QRE B;  2GU2 A;  1K9M 1;  2VUM I;  2NVQ I;  1NJI 2;  5D1O B;  1YIT 1;  2I3C A;  3NH8 A;  3HOV I;  4MON A;  3I55 Z;  1Z01 A;  2PMZ A;  1NJI 1;  1I6H I;  3S15 I;  1K73 2;  3CCV 1;  1ML8 A;  3CCS 1;  4NBE A;  3F3F C;  1W2B Z;  4NBF A;  1K73 1;  5D1P A;  2JS4 A;  1YIJ Z;  3CCR Z;  2K3R A;  2JIM A;  3CC4 Z;  4NOZ A;  1VQ8 Z;  4A3E I;  1VQM 1;  1KQS Y;  3I56 Z;  4MXU A;  3MON A;  1TWH I;  4NBB A;  2W03 A;  2H85 A;  4RS4 A;  1VQ5 Z;  4A3D I;  4BBR I;  2K5R A;  3EED A;  5A2Q f;  3CCM Z;  4A3C I;  1YUA A;  3ESW A;  3BG1 B;  1S7M A;  1JJ2 Z;  1KD1 2;  4BXX I;  3CCJ Z;  3CMA 1;  1YJ9 Z;  2E7Z A;  3G4S 1;  2JUB A;  4QTU A;  4RVH A;  1KD1 1;  1QVG Y;  3VMH A;  1Q7Y 2;  3U50 C;  1Y1V S;  4EWC A;  1VQN Z;  1R9T I;  1I3Q I;  2O53 A;  2R6M A;  3S1M I;  1Q7Y 1;  2HU9 A;  3TDH B;  1SFO I;  4A3J I;  4MRI A;  2R92 I;  4HGY A;  1VQO Z;  3NH5 A;  2VPZ A;  3S2D I;  1YHQ Z;  2OOX B;  2OTL Z;  1VQ6 1;  3CCQ 1;  3Q87 A;  5FLX f;  4NBA A;  5C44 I;  2R93 I;  3VTN A;  3S17 I;  5C4X I;  3RZD I;  3IFU A;  4E30 A;  2E2J I;  3S1R I;  5IT9 f;  4NBG A;  1ZB8 A;  3I55 1;  3CCL Z;  1FDI A;  2W04 A;  3CCU Z;  2QA4 Z;  1N2F A;  2JIO A;  3KIF A;  5A2Q b;  2WAQ A;  1VQ9 1;  4X6A I;  1TWG I;  2PM9 A;  1YIJ 1;  3CCR 1;  3D2L A;  2QKD A;  2J6A A;  3CC4 1;  2GTI A;  1VQ8 1;  2YU9 I;  3CC7 Z;  2VPW A;  3I56 1;  2DE6 A;  5IP9 I;  3NDI A;  1I50 I;  3GTQ I;  2Y0S A;  2BJO A;  5C4J I;  2E2I I;  1VQ4 1;  1VQK 1;  1YUK A;  2JA5 I;  3HOY I;  3D6W A;  3CCE Z;  3IR7 A;  3S1N I;  3GKQ A;  1SIW A;  3S16 I;  2JIP A;  3RZO I;  2NVY I;  3I4N I;  3CQZ I;  3CXC Y;  1WJ2 A;  4HGZ A;  3S2H I;  3GTK I;  1Q81 2;  1RO0 A;  3G71 Z;  3CCM 1;  4E32 A;  2NVX I;  2IV2 X;  2IZ4 A;  4NBC A;  1Q81 1;  3H0G I;  4S1T A;  2AYD A;  1WII A;  2M48 A;  3JAM f;  3CCJ 1;  1YJ9 1;  2E9H A;  5FLX b;  5T67 A;  1RQF A;  3CPW Z;  3GTG I;  4NFR A;  4A3L I;  2JIQ A;  3OW2 Y;  5IT9 b;  3MZK B;  3G6E Z;  1QVG Z;  4BY1 I;  4E33 A;  1P9N A;  2EGT A;  1NUI A;  1VQO 1;  2JNY A;  1YHQ 1;  3J80 f;  2V8K A;  1L1O C;  1VQP Z;  4BBS I;  2Q4Z A;  2OOY B;  1WW9 A;  4XX2 A;  3IX0 A;  1YI2 Z;  3H3V J;  2P28 A;  4TNU A;  3HOU I;  2VPX A;  1Y1W I;  3CD6 1;  1S72 Z;  2VUG A;  4NBD A;  4A3I I;  4DGL A;  3CCU 1;  2QA4 1;  2QRD B;  4Y52 I;  1QVF Z;  3GCF A;  4E2Z A;  1RNI A;  2QRC B;  1RO2 A;  2KI7 B;  3CC7 1;  5T6B A;  2JR6 A;  3T4N B;  2F4M A;  1WCM I;  3JAM b;  1X3Z A;  2DE7 A;  4QTT A;  2AKL A;  2LIY A;  3P5J B;  3CCE 1;  1ZB9 A;  2QLV B;  1RO4 A;  1NP6 A;  4RVD A;  2JA7 I;  1TFI A;  4E2X A;  3HOW I;  3GTM S;  2JIR A;  3IF8 A;  2V45 A;  1Q82 2;  3F3P C;  2GTH A;  3G71 1;  3CXC Z;  2VPY A;  2G2K A;  1USP B;  1TWC I;  4Y7N I;  3J81 f;  1Q82 1;  1M1K 2;  4RVF A;  1JJ2 Y;  3J80 b;  3S1Q I;  2R7Z I;  1M1K 1;  1JWH C;  3HOX I;  1X3W A;  4MD7 A;  3CMA Z;  2NVT I;  4NH1 C;  1YJW Z;  2RHB A;  2B63 I;  1WZN A;  2V3V A;  3M3Y I;  3FQM A;  3G6E 1;  2V8J A;  1KQS Z;  4RV9 A;  3K7A I;  3OW2 Z;  2DE5 A;  1VQ5 1;  3LUS A;  4A3K I;  1VQ7 Z;  4DQY B;  5AN9 F;  1VQP 1;  3GTM I;  2RT9 A;  1YI2 1;  2OTJ Z;  1VQ6 Z;  3NH4 A;  3CCQ Z;  1KRL A;  3D9X A;  1X0T A;  1S72 1;  1Y8C A;  2QEX Z;  3PO2 I;  2RBL A;  1FDO A;  3NDJ A;  1QF8 A;  3NFZ A;  4MD9 A;  3GTJ I;  3PO3 S;  3KIH A;  1QYP A;  3CC2 Z;  1VQN 1;  2RIQ A;  5C3E I;  3GTP I;  1PFT A;  2V8I A;  1K83 I;  2M6N A;  4A3F I;  3FKI I;  3J81 b;  3EER A;  1VQ9 Z;  3M4O I;  4MD8 A;  1AA6 A;  1TWA I;  2PK7 A;  3VMG A;  5CM2 M;  3CME Z;  1RLY A;  4MH4 A;  1N8R 2;  2OTL 1;  4NB8 A;  1TWF I;  4E2W A;  1QXF A;  1N8R 1;  1VQ4 Z;  1VQK Z;  5LL6 f;  2O4H A;  2Q51 A;  4RVG A;  1VQL Z;  2E2H I;  1YJN Z;  3I4M I;  3GTL I;  2RPR A;  4A3M I;  2JMO A;  1DL6 A;  4NB9 A;  1ZH1 A;  5T64 A;  3GTO I;  3CCL 1;  4A93 I;  1YIT Z;  4A3B I;  3FQQ A;  3PO3 I;  1W2B Y;  2F4O A;  2IZ3 A;  3CCV Z;  1USP A;  3VMI A;  1Z02 A;  3CCS Z;  3TE5 B;  2P3Y A;  3CPW Y;  2NAP A;  3HOZ I;  2HF1 A;  1YJW 1;  1VQM Z;  2WB1 A;  1M90 2;  3S14 I;  2QR1 B;  3I07 A;  4DK1 A;  1M90 1;  2LFU A;  2JA6 I;  1VQ7 1;  1LQL A;  2LEX A;  2VF1 A;  3QWU A;  3MZL B;  3BG0 B;  1Z03 A;  1K8A 2;  2OTJ 1;  1Q16 A;  2OZK A;  4NBH A;  2ZAE B;  4BY7 I;  4E2Y A;  4A3G I;  1K8A 1;  2QEX 1;  4AYB A;  3CD6 Z;  4CL1 A;  3G4S Z;  5FLM I;  1QVF Y;  3CC2 1;  2KPI A;  3VB9 A;  5D1O A;  1KC8 2;  4HH4 A; 
#chains in the Genus database with same CATH homology
 1KC8 1;  2JA8 I;  1Y1V I;  3J7A 4;  3HKZ A;  1VLA A;  3CME 1;  1Q86 2;  4E31 A;  1K9M 2;  1VQL 1;  2YAD A;  5IP7 I;  1Q86 1;  1YJN 1;  2QRE B;  2GU2 A;  1K9M 1;  2VUM I;  2NVQ I;  1NJI 2;  5D1O B;  1YIT 1;  2I3C A;  3NH8 A;  3HOV I;  4MON A;  3I55 Z;  1Z01 A;  2PMZ A;  1NJI 1;  1I6H I;  3S15 I;  1K73 2;  3CCV 1;  1ML8 A;  3CCS 1;  4NBE A;  3F3F C;  1W2B Z;  4NBF A;  1K73 1;  5D1P A;  2JS4 A;  1YIJ Z;  3CCR Z;  2K3R A;  3CC4 Z;  4NOZ A;  1VQ8 Z;  4A3E I;  1VQM 1;  1KQS Y;  3I56 Z;  4MXU A;  3MON A;  1TWH I;  4NBB A;  2W03 A;  2H85 A;  4RS4 A;  1VQ5 Z;  4A3D I;  4BBR I;  2K5R A;  3EED A;  5A2Q f;  3CCM Z;  4A3C I;  1YUA A;  3ESW A;  3BG1 B;  1S7M A;  1JJ2 Z;  1KD1 2;  4BXX I;  3CCJ Z;  3CMA 1;  1YJ9 Z;  3G4S 1;  2JUB A;  4QTU A;  4RVH A;  1KD1 1;  1QVG Y;  3VMH A;  1Q7Y 2;  3U50 C;  1Y1V S;  4EWC A;  1VQN Z;  1R9T I;  1I3Q I;  2O53 A;  2R6M A;  3S1M I;  1Q7Y 1;  2HU9 A;  3TDH B;  1SFO I;  4A3J I;  4MRI A;  2R92 I;  4HGY A;  1VQO Z;  3NH5 A;  3S2D I;  1YHQ Z;  2OOX B;  2OTL Z;  1VQ6 1;  3CCQ 1;  3Q87 A;  5FLX f;  4NBA A;  5C44 I;  2R93 I;  3VTN A;  3S17 I;  5C4X I;  3RZD I;  3IFU A;  4E30 A;  2E2J I;  3S1R I;  5IT9 f;  4NBG A;  1ZB8 A;  3I55 1;  3CCL Z;  2W04 A;  3CCU Z;  2QA4 Z;  1N2F A;  3KIF A;  5A2Q b;  2WAQ A;  1VQ9 1;  4X6A I;  1TWG I;  2PM9 A;  1YIJ 1;  3CCR 1;  2QKD A;  2J6A A;  3CC4 1;  2GTI A;  1VQ8 1;  2YU9 I;  3CC7 Z;  3I56 1;  2DE6 A;  5IP9 I;  3NDI A;  1I50 I;  3GTQ I;  2Y0S A;  2BJO A;  5C4J I;  2E2I I;  1VQ4 1;  1VQK 1;  1YUK A;  2JA5 I;  3HOY I;  3D6W A;  3CCE Z;  3S1N I;  3GKQ A;  3S16 I;  3RZO I;  2NVY I;  3I4N I;  3CQZ I;  3CXC Y;  4HGZ A;  3S2H I;  3GTK I;  1Q81 2;  1RO0 A;  3G71 Z;  3CCM 1;  4E32 A;  2NVX I;  2IZ4 A;  4NBC A;  1Q81 1;  3H0G I;  4S1T A;  1WII A;  2M48 A;  3JAM f;  3CCJ 1;  1YJ9 1;  2E9H A;  5FLX b;  5T67 A;  1RQF A;  3CPW Z;  3GTG I;  4NFR A;  4A3L I;  3OW2 Y;  5IT9 b;  3MZK B;  3G6E Z;  1QVG Z;  4BY1 I;  4E33 A;  1P9N A;  2EGT A;  1NUI A;  1VQO 1;  2JNY A;  1YHQ 1;  3J80 f;  2V8K A;  1L1O C;  1VQP Z;  4BBS I;  2Q4Z A;  2OOY B;  1WW9 A;  4XX2 A;  3IX0 A;  1YI2 Z;  3H3V J;  2P28 A;  4TNU A;  3HOU I;  1Y1W I;  3CD6 1;  1S72 Z;  2VUG A;  4NBD A;  4A3I I;  4DGL A;  3CCU 1;  2QA4 1;  2QRD B;  4Y52 I;  1QVF Z;  3GCF A;  4E2Z A;  1RNI A;  2QRC B;  2KI7 B;  1RO2 A;  3CC7 1;  5T6B A;  2JR6 A;  3T4N B;  2F4M A;  1WCM I;  3JAM b;  1X3Z A;  2DE7 A;  4QTT A;  2AKL A;  2LIY A;  3P5J B;  3CCE 1;  1ZB9 A;  2QLV B;  1RO4 A;  1NP6 A;  4RVD A;  2JA7 I;  1TFI A;  4E2X A;  3HOW I;  3GTM S;  3IF8 A;  1Q82 2;  3F3P C;  2GTH A;  3G71 1;  3CXC Z;  2G2K A;  1USP B;  1TWC I;  4Y7N I;  3J81 f;  1Q82 1;  1M1K 2;  4RVF A;  1JJ2 Y;  3J80 b;  3S1Q I;  2R7Z I;  1M1K 1;  1JWH C;  3HOX I;  1X3W A;  4MD7 A;  3CMA Z;  2NVT I;  4NH1 C;  1YJW Z;  2RHB A;  2B63 I;  3M3Y I;  3FQM A;  3G6E 1;  2V8J A;  1KQS Z;  4RV9 A;  3K7A I;  3OW2 Z;  2DE5 A;  1VQ5 1;  3LUS A;  4A3K I;  1VQ7 Z;  4DQY B;  5AN9 F;  1VQP 1;  3GTM I;  2RT9 A;  1YI2 1;  2OTJ Z;  1VQ6 Z;  3NH4 A;  3CCQ Z;  1KRL A;  3D9X A;  1X0T A;  1S72 1;  2QEX Z;  3PO2 I;  2RBL A;  3NFZ A;  3NDJ A;  1QF8 A;  4MD9 A;  3GTJ I;  3PO3 S;  3KIH A;  1QYP A;  3CC2 Z;  1VQN 1;  2RIQ A;  5C3E I;  3GTP I;  1PFT A;  2V8I A;  1K83 I;  2M6N A;  4A3F I;  3FKI I;  3J81 b;  3EER A;  1VQ9 Z;  3M4O I;  4MD8 A;  1TWA I;  2PK7 A;  3VMG A;  5CM2 M;  3CME Z;  1RLY A;  4MH4 A;  1N8R 2;  2OTL 1;  4NB8 A;  1TWF I;  4E2W A;  1N8R 1;  1VQ4 Z;  1VQK Z;  5LL6 f;  2O4H A;  2Q51 A;  4RVG A;  1VQL Z;  2E2H I;  1YJN Z;  3I4M I;  3GTL I;  2RPR A;  4A3M I;  2JMO A;  1DL6 A;  4NB9 A;  1ZH1 A;  5T64 A;  3GTO I;  3CCL 1;  4A93 I;  1YIT Z;  4A3B I;  3FQQ A;  3PO3 I;  1W2B Y;  2F4O A;  2IZ3 A;  3CCV Z;  1USP A;  3VMI A;  1Z02 A;  3CCS Z;  3TE5 B;  2P3Y A;  3CPW Y;  3HOZ I;  2HF1 A;  1YJW 1;  1VQM Z;  2WB1 A;  1M90 2;  3S14 I;  2QR1 B;  3I07 A;  4DK1 A;  1M90 1;  2LFU A;  2JA6 I;  1VQ7 1;  1LQL A;  2VF1 A;  3QWU A;  3MZL B;  3BG0 B;  1Z03 A;  1K8A 2;  2OTJ 1;  2OZK A;  4NBH A;  2ZAE B;  4BY7 I;  4E2Y A;  4A3G I;  1K8A 1;  2QEX 1;  4AYB A;  3CD6 Z;  4CL1 A;  3G4S Z;  5FLM I;  1QVF Y;  3CC2 1;  2KPI A;  3VB9 A;  5D1O A;  1KC8 2;  4HH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...