2QEX1

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qex100
3CCEZ 1K9M2 1VQOZ 1N8R2 3CCM1 1VQKZ 3CCQZ 3CCVZ 3CPWY 1VQ81 1K8A2 3I551 3CMA1 1N8R1 3CCR1 3G6E1 3CCMZ 1YJN1 3CCL1 2QEXZ 3CCUZ 1S721 3I55Z 3CMAZ 1K732 1KC82 1YHQZ 1NJI1 2OTJZ 2OTL1 1YIJ1 3CCS1 1VQ41 1K731 1KC81 3CC41 3CC21 3CCJ1 2QA41 1M901 3I561 1QVFZ 3CCSZ 1VQ4Z 1VQM1 3CC71 1W2BZ 1NJI2 3CME1 3CC2Z 3CCJZ 1YJW1 3CXCY 2QA4Z 3CC4Z 1VQ8Z 3CC7Z 1VQ61 3CCRZ 3G6EZ 1Q861 3G711 1YJNZ 3CCLZ 1JJ2Z 3CMEZ 1M902 1Q821 3OW2Z 1S72Z 1VQL1 3CD61 1YJ91 1VQ91 3CCE1 2OTLZ 1QVFY 1YIJZ 1VQN1 1KD11 3G4S1 1VQLZ 1QVGZ 3CD6Z 1KQSZ 1Q862 1VQP1 1M1K2 3I56Z 1YI21 1YIT1 1Q822 1VQNZ 1VQMZ 1VQ51 3G4SZ 1JJ2Y 1M1K1 1VQPZ 1Q7Y2 1VQ71 1YJWZ 1K9M1 3OW2Y 2QEX1 1YI2Z 1KD12 1YITZ 3CCU1 1VQ5Z 1VQ6Z 3CPWZ 1Q812 3G71Z 1Q7Y1 1VQ7Z 1YHQ1 2OTJ1 1QVGY 3CXCZ 1Q811 1K8A1 1KQSY 1W2BY 1YJ9Z 1VQO1 1VQK1 1VQ9Z 3CCQ1 3CCV1
chains in the Genus database with same CATH superfamily
3CCEZ 1TWAI 2GTHA 2V8JA 5C44I 3D6WA 1RQFA 2OOXB 3KIHA 1TWGI 4A93I 3GTMI 3I551 3CMA1 2F4OA 2VPXA 2O4HA 1YJN1 2JA8I 3HOVI 2QRCB 1S721 1YUAA 1TFIA 1QYPA 3F3PC 4NOZA 3ESWA 2HF1A 2JIRA 2OTL1 3S17I 5CM2M 3CCS1 3J81f 1ZB8A 1K731 4BY1I 4HGYA 3HKZA 1ZH1A 4BY7I 3BG0B 3I561 1QVFZ 3CC71 4A3GI 1NJI2 2H85A 3NH5A 5A2Qb 2QA4Z 1FDIA 1VQ61 4E2ZA 1Q861 3G711 3HOUI 5T6BA 4BXXI 1VQL1 1I3QI 2E2HI 1VQ91 3PO2I 2P28A 3CCE1 4QTUA 4E2YA 3NH8A 3KIFA 1VQN1 3G4S1 2F4MA 3CD6Z 3I4NI 2QLVB 5C4XI 5A2Qf 1VQP1 1Q822 5D1OA 1LQLA 1VQMZ 5T67A 5D1OB 2DE6A 1M1K1 2AYDA 1Q7Y2 1VQ71 1YJWZ 2BJOA 1R9TI 1AA6A 3IF8A 1Q812 2NVXI 2VPWA 1KRLA 2RBLA 2QREB 2YADA 1NUIA 5FLXb 3K7AI 3T4NB 5D1PA 1W2BY 3RZDI 1VQO1 2GU2A 3CCQ1 4A3DI 1X3WA 2G2KA 2E9HA 3CCM1 2KPIA 4E32A 3M4OI 3CPWY 3MONA 2J6AA 4NFRA 1N8R1 4A3CI 4XX2A 3VMGA 3LUSA 4A3KI 4MD8A 3MZLB 2W04A 3U50C 2WB1A 1YHQZ 1NJI1 3HOXI 2OTJZ 2RPRA 2KI7B 3D9XA 3J80f 1KC81 4RVFA 4S1TA 4BBSI 3H3VJ 2NVTI 2QRDB 2YU9I 1VQ4Z 4RS4A 1VQM1 4A3MI 1W2BZ 1S7MA 3CC4Z 3CME1 3CC2Z 3CCJZ 5LL6f 1PFTA 4HH4A 1Z02A 4HGZA 1YJW1 4RVHA 4DK1A 1VQ8Z 4NBHA 2JIPA 2LFUA 2JUBA 2E7ZA 2R92I 1M902 2WAQA 1Q821 2VUGA 2JIOA 2JMOA 4A3II 2R93I 2I3CA 1I50I 1YIJZ 3FQMA 3M3YI 2R6MA 4RVGA 2NVYI 4E30A 1KQSZ 3GTLI 4E2WA 1YI21 2JIMA 1YIT1 2O53A 5IT9b 3RZOI 1USPA 1JJ2Y 4NBFA 2AKLA 1Y1VI 1USPB 3OW2Y 4RV9A 1SIWA 4BBRI 2ZAEB 3VB9A 1VQ5Z 3PO3I 4A3BI 4NBDA 2DE5A 2RT9A 1YHQ1 2OTJ1 3H0GI 1QVGY 1SFOI 4NB8A 3IR7A 2PM9A 4A3LI 1L1OC 1WZNA 3I4MI 2V3VA 3NDJA 1K9M2 3GCFA 4DQYB 3FQQA 4MH4A 3I07A 4NBGA 1VQKZ 1Q16A 2Q4ZA 2JA5I 3CCVZ 1VQ81 1P9NA 2K3RA 2HU9A 2QEXZ 2JA6I 1RLYA 4A3FI 3CCUZ 3GTJI 3EERA 3I55Z 3CMAZ 3NH4A 1K732 4TNUA 2E2JI 2V8IA 3HOWI 1YIJ1 2RIQA 4A3JI 2M48A 4MD7A 4EWCA 3IFUA 2QA41 1M901 2NVQI 2E2II 3CCSZ 4E2XA 3HOYI 3JAMb 5FLXf 5FLMI 2Y0SA 2GTIA 3VMIA 3CXCY 2VPYA 4MXUA 4DGLA 3CC7Z 1WJ2A 3VTNA 4Y7NI 3CCRZ 3G6EZ 3CCLZ 1ZB9A 3HOZI 2JR6A 1RNIA 2V8KA 1WW9A 3CD61 2V45A 1YUKA 1QVFY 3S1NI 2QR1B 3J7A4 4NH1C 1VQLZ 1QF8A 2NAPA 5IP7I 1M1K2 4MRIA 1VLAA 1JWHC 3GKQA 4Y52I 1VQNZ 2JA7I 1RO0A 3G4SZ 3J81b 5C3EI 1VQPZ 2P3YA 1K9M1 4A3EI 3GTKI 2QEX1 1KD12 3CCU1 3CPWZ 4RVDA 4X6AI 2JIQA 1Q7Y1 1VQ7Z 2LEXA 3CXCZ 1Q811 2LIYA 2VPZA 1YJ9Z 2B63I 3BG1B 3GTMS 3GTPI 2IV2X 4MD9A 4CL1A 1TWHI 1X3ZA 1WIIA 1VQOZ 1N8R2 3CCQZ 3S16I 4NBEA 2IZ3A 1K8A2 2QKDA 3GTOI 1QXFA 3CCR1 3QWUA 4QTTA 3G6E1 3CCMZ 3CCL1 2IZ4A 4E33A 3S14I 2Q51A 3FKII 1RO2A 3S1MI 2M6NA 3EEDA 4MONA 1KC82 5IT9f 1ML8A 1VQ41 4NBAA 1N2FA 5C4JI 2PK7A 3CC41 3CC21 3CCJ1 4NBCA 3TE5B 1NP6A 1Y1VS 2PMZA 2R7ZI 3S1QI 3PO3S 1WCMI 5T64A 1I6HI 1YJNZ 1JJ2Z 3IX0A 3CMEZ 3GTQI 3MZKB 2JNYA 3P5JB 3OW2Z 1DL6A 1S72Z 3S1RI 1TWCI 1YJ91 3Q87A 2K5RA 3S15I 2VUMI 4NB9A 2OTLZ 4E31A 1KD11 1Z01A 1QVGZ 1Q862 2JS4A 3I56Z 3NDIA 1VQ51 4NBBA 3S2HI 2RHBA 1Y1WI 3J80b 2VF1A 2W03A 3NFZA 1YI2Z 3S2DI 2OOYB 1YITZ 3F3FC 1VQ6Z 5IP9I 1Y8CA 1Z03A 5AN9F 3G71Z 3CQZI 3TDHB 1RO4A 2OZKA 3GTGI 1TWFI 1FDOA 3D2LA 1K8A1 2DE7A 4AYBA 3JAMf 1KQSY 1X0TA 1K83I 2EGTA 1VQK1 1VQ9Z 3VMHA 3CCV1
chains in the Genus database with same CATH topology
3CCEZ 1TWAI 2GTHA 2V8JA 5C44I 3D6WA 1RQFA 2OOXB 3KIHA 1TWGI 4A93I 3GTMI 3I551 3CMA1 2F4OA 2O4HA 1YJN1 2JA8I 3HOVI 2QRCB 1S721 1YUAA 1TFIA 1QYPA 3F3PC 4NOZA 3ESWA 2HF1A 2OTL1 3S17I 5CM2M 3CCS1 3J81f 1ZB8A 1K731 4BY1I 4HGYA 3HKZA 1ZH1A 4BY7I 3BG0B 3I561 1QVFZ 3CC71 4A3GI 1NJI2 2H85A 3NH5A 5A2Qb 2QA4Z 1VQ61 4E2ZA 1Q861 3G711 3HOUI 5T6BA 4BXXI 1VQL1 1I3QI 2E2HI 1VQ91 3PO2I 2P28A 3CCE1 4QTUA 4E2YA 3NH8A 3KIFA 1VQN1 3G4S1 2F4MA 3CD6Z 3I4NI 2QLVB 5C4XI 5A2Qf 1VQP1 1Q822 5D1OA 1LQLA 1VQMZ 5T67A 5D1OB 2DE6A 1M1K1 1VQ71 1Q7Y2 1YJWZ 2BJOA 1R9TI 3IF8A 1Q812 2NVXI 1KRLA 2RBLA 2QREB 2YADA 1NUIA 5FLXb 3K7AI 3T4NB 5D1PA 1W2BY 3RZDI 1VQO1 2GU2A 3CCQ1 4A3DI 1X3WA 2G2KA 2E9HA 3CCM1 2KPIA 4E32A 3M4OI 3CPWY 3MONA 2J6AA 4NFRA 1N8R1 4A3CI 4XX2A 3VMGA 3LUSA 4A3KI 4MD8A 3MZLB 2W04A 3U50C 2WB1A 1YHQZ 1NJI1 3HOXI 2OTJZ 2RPRA 2KI7B 3D9XA 3J80f 1KC81 4RVFA 4S1TA 4BBSI 3H3VJ 2NVTI 2QRDB 2YU9I 1VQ4Z 4RS4A 1VQM1 4A3MI 1W2BZ 1S7MA 3CC4Z 3CME1 3CC2Z 3CCJZ 1PFTA 4HH4A 4HGZA 1Z02A 5LL6f 1YJW1 4RVHA 4DK1A 1VQ8Z 4NBHA 2LFUA 2JUBA 2R92I 1M902 2WAQA 1Q821 2VUGA 2JMOA 4A3II 2R93I 2I3CA 1I50I 1YIJZ 3FQMA 3M3YI 2R6MA 4RVGA 2NVYI 4E30A 1KQSZ 3GTLI 4E2WA 1YI21 1YIT1 2O53A 5IT9b 3RZOI 1USPA 1JJ2Y 4NBFA 2AKLA 1Y1VI 1USPB 3OW2Y 4RV9A 4BBRI 2ZAEB 3VB9A 1VQ5Z 3PO3I 4A3BI 4NBDA 2DE5A 2RT9A 1YHQ1 2OTJ1 3H0GI 1QVGY 1SFOI 4NB8A 2PM9A 4A3LI 1L1OC 3I4MI 1K9M2 3NDJA 3GCFA 4DQYB 3FQQA 4MH4A 3I07A 4NBGA 1VQKZ 2Q4ZA 2JA5I 3CCVZ 1VQ81 1P9NA 2K3RA 2HU9A 2QEXZ 2JA6I 1RLYA 4A3FI 3CCUZ 3GTJI 3EERA 3I55Z 3CMAZ 3NH4A 1K732 4TNUA 2E2JI 2V8IA 3HOWI 1YIJ1 2RIQA 4A3JI 2M48A 4MD7A 4EWCA 3IFUA 2QA41 1M901 2NVQI 2E2II 3CCSZ 4E2XA 3HOYI 3JAMb 5FLXf 5FLMI 2Y0SA 2GTIA 3VMIA 3CXCY 4MXUA 4DGLA 3CC7Z 3VTNA 4Y7NI 3CCRZ 3G6EZ 3CCLZ 1ZB9A 3HOZI 2JR6A 1RNIA 2V8KA 1WW9A 3CD61 1YUKA 1QVFY 3S1NI 2QR1B 3J7A4 4NH1C 1VQLZ 1QF8A 5IP7I 1M1K2 4MRIA 1VLAA 1JWHC 3GKQA 4Y52I 1VQNZ 2JA7I 1RO0A 3G4SZ 3J81b 5C3EI 1VQPZ 2P3YA 1K9M1 4A3EI 3GTKI 2QEX1 1KD12 3CCU1 3CPWZ 4RVDA 4X6AI 1Q7Y1 1VQ7Z 3CXCZ 1Q811 2LIYA 1YJ9Z 2B63I 3BG1B 3GTMS 3GTPI 4MD9A 4CL1A 1TWHI 1X3ZA 1WIIA 1VQOZ 1N8R2 3CCQZ 3S16I 4NBEA 2IZ3A 1K8A2 2QKDA 3GTOI 3CCR1 3QWUA 4QTTA 3G6E1 3CCMZ 3CCL1 2IZ4A 4E33A 3S14I 2Q51A 3FKII 1RO2A 3S1MI 2M6NA 3EEDA 4MONA 1KC82 5IT9f 1ML8A 1VQ41 4NBAA 1N2FA 5C4JI 2PK7A 3CC41 3CC21 3CCJ1 4NBCA 3TE5B 1NP6A 1Y1VS 2PMZA 2R7ZI 3S1QI 3PO3S 1WCMI 5T64A 1I6HI 1YJNZ 1JJ2Z 3IX0A 3CMEZ 3GTQI 3MZKB 2JNYA 3P5JB 3OW2Z 1DL6A 1S72Z 3S1RI 1TWCI 1YJ91 3Q87A 2K5RA 3S15I 2VUMI 4NB9A 2OTLZ 4E31A 1KD11 1Z01A 1QVGZ 1Q862 2JS4A 3I56Z 3NDIA 1VQ51 4NBBA 3S2HI 2RHBA 1Y1WI 3J80b 2VF1A 2W03A 3NFZA 1YI2Z 3S2DI 2OOYB 1YITZ 3F3FC 1VQ6Z 5IP9I 1Z03A 5AN9F 3G71Z 3CQZI 3TDHB 1RO4A 2OZKA 3GTGI 1TWFI 1K8A1 2DE7A 4AYBA 3JAMf 1KQSY 1X0TA 1K83I 2EGTA 1VQK1 1VQ9Z 3VMHA 3CCV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE Z;  1K9M 2;  1VQO Z;  1N8R 2;  3CCM 1;  1VQK Z;  3CCQ Z;  3CCV Z;  3CPW Y;  1VQ8 1;  1K8A 2;  3I55 1;  3CMA 1;  1N8R 1;  3CCR 1;  3G6E 1;  3CCM Z;  1YJN 1;  3CCL 1;  2QEX Z;  3CCU Z;  1S72 1;  3I55 Z;  3CMA Z;  1K73 2;  1KC8 2;  1YHQ Z;  1NJI 1;  2OTJ Z;  2OTL 1;  1YIJ 1;  3CCS 1;  1VQ4 1;  1K73 1;  1KC8 1;  3CC4 1;  3CC2 1;  3CCJ 1;  2QA4 1;  1M90 1;  3I56 1;  1QVF Z;  3CCS Z;  1VQ4 Z;  1VQM 1;  3CC7 1;  1W2B Z;  1NJI 2;  3CME 1;  3CC2 Z;  3CCJ Z;  1YJW 1;  3CXC Y;  2QA4 Z;  3CC4 Z;  1VQ8 Z;  3CC7 Z;  1VQ6 1;  3CCR Z;  3G6E Z;  1Q86 1;  3G71 1;  1YJN Z;  3CCL Z;  1JJ2 Z;  3CME Z;  1M90 2;  1Q82 1;  3OW2 Z;  1S72 Z;  1VQL 1;  3CD6 1;  1YJ9 1;  1VQ9 1;  3CCE 1;  2OTL Z;  1QVF Y;  1YIJ Z;  1VQN 1;  1KD1 1;  3G4S 1;  1VQL Z;  1QVG Z;  3CD6 Z;  1KQS Z;  1Q86 2;  1VQP 1;  1M1K 2;  3I56 Z;  1YI2 1;  1YIT 1;  1Q82 2;  1VQN Z;  1VQM Z;  1VQ5 1;  3G4S Z;  1JJ2 Y;  1M1K 1;  1VQP Z;  1Q7Y 2;  1VQ7 1;  1YJW Z;  1K9M 1;  3OW2 Y;  2QEX 1;  1YI2 Z;  1KD1 2;  1YIT Z;  3CCU 1;  1VQ5 Z;  1VQ6 Z;  3CPW Z;  1Q81 2;  3G71 Z;  1Q7Y 1;  1VQ7 Z;  1YHQ 1;  2OTJ 1;  1QVG Y;  3CXC Z;  1Q81 1;  1K8A 1;  1KQS Y;  1W2B Y;  1YJ9 Z;  1VQO 1;  1VQK 1;  1VQ9 Z;  3CCQ 1;  3CCV 1; 
#chains in the Genus database with same CATH topology
 3CCE Z;  1TWA I;  2GTH A;  2V8J A;  5C44 I;  3D6W A;  1RQF A;  2OOX B;  3KIH A;  1TWG I;  4A93 I;  3GTM I;  3I55 1;  3CMA 1;  2F4O A;  2VPX A;  2O4H A;  1YJN 1;  2JA8 I;  3HOV I;  2QRC B;  1S72 1;  1YUA A;  1TFI A;  1QYP A;  3F3P C;  4NOZ A;  3ESW A;  2HF1 A;  2JIR A;  2OTL 1;  3S17 I;  5CM2 M;  3CCS 1;  3J81 f;  1ZB8 A;  1K73 1;  4BY1 I;  4HGY A;  3HKZ A;  1ZH1 A;  4BY7 I;  3BG0 B;  3I56 1;  1QVF Z;  3CC7 1;  4A3G I;  1NJI 2;  2H85 A;  3NH5 A;  5A2Q b;  2QA4 Z;  1FDI A;  1VQ6 1;  4E2Z A;  1Q86 1;  3G71 1;  3HOU I;  5T6B A;  4BXX I;  1VQL 1;  1I3Q I;  2E2H I;  1VQ9 1;  3PO2 I;  2P28 A;  3CCE 1;  4QTU A;  4E2Y A;  3NH8 A;  3KIF A;  1VQN 1;  3G4S 1;  2F4M A;  3CD6 Z;  3I4N I;  2QLV B;  5C4X I;  5A2Q f;  1VQP 1;  1Q82 2;  5D1O A;  1LQL A;  1VQM Z;  5T67 A;  5D1O B;  2DE6 A;  1M1K 1;  2AYD A;  1Q7Y 2;  1VQ7 1;  1YJW Z;  2BJO A;  1R9T I;  1AA6 A;  3IF8 A;  1Q81 2;  2NVX I;  2VPW A;  1KRL A;  2RBL A;  2QRE B;  2YAD A;  1NUI A;  5FLX b;  3K7A I;  3T4N B;  5D1P A;  1W2B Y;  3RZD I;  1VQO 1;  2GU2 A;  3CCQ 1;  4A3D I;  1X3W A;  2G2K A;  2E9H A;  3CCM 1;  2KPI A;  4E32 A;  3M4O I;  3CPW Y;  3MON A;  2J6A A;  4NFR A;  1N8R 1;  4A3C I;  4XX2 A;  3VMG A;  3LUS A;  4A3K I;  4MD8 A;  3MZL B;  2W04 A;  3U50 C;  2WB1 A;  1YHQ Z;  1NJI 1;  3HOX I;  2OTJ Z;  2RPR A;  2KI7 B;  3D9X A;  3J80 f;  1KC8 1;  4RVF A;  4S1T A;  4BBS I;  3H3V J;  2NVT I;  2QRD B;  2YU9 I;  1VQ4 Z;  4RS4 A;  1VQM 1;  4A3M I;  1W2B Z;  1S7M A;  3CC4 Z;  3CME 1;  3CC2 Z;  3CCJ Z;  5LL6 f;  1PFT A;  4HH4 A;  1Z02 A;  4HGZ A;  1YJW 1;  4RVH A;  4DK1 A;  1VQ8 Z;  4NBH A;  2JIP A;  2LFU A;  2JUB A;  2E7Z A;  2R92 I;  1M90 2;  2WAQ A;  1Q82 1;  2VUG A;  2JIO A;  2JMO A;  4A3I I;  2R93 I;  2I3C A;  1I50 I;  1YIJ Z;  3FQM A;  3M3Y I;  2R6M A;  4RVG A;  2NVY I;  4E30 A;  1KQS Z;  3GTL I;  4E2W A;  1YI2 1;  2JIM A;  1YIT 1;  2O53 A;  5IT9 b;  3RZO I;  1USP A;  1JJ2 Y;  4NBF A;  2AKL A;  1Y1V I;  1USP B;  3OW2 Y;  4RV9 A;  1SIW A;  4BBR I;  2ZAE B;  3VB9 A;  1VQ5 Z;  3PO3 I;  4A3B I;  4NBD A;  2DE5 A;  2RT9 A;  1YHQ 1;  2OTJ 1;  3H0G I;  1QVG Y;  1SFO I;  4NB8 A;  3IR7 A;  2PM9 A;  4A3L I;  1L1O C;  1WZN A;  3I4M I;  2V3V A;  3NDJ A;  1K9M 2;  3GCF A;  4DQY B;  3FQQ A;  4MH4 A;  3I07 A;  4NBG A;  1VQK Z;  1Q16 A;  2Q4Z A;  2JA5 I;  3CCV Z;  1VQ8 1;  1P9N A;  2K3R A;  2HU9 A;  2QEX Z;  2JA6 I;  1RLY A;  4A3F I;  3CCU Z;  3GTJ I;  3EER A;  3I55 Z;  3CMA Z;  3NH4 A;  1K73 2;  4TNU A;  2E2J I;  2V8I A;  3HOW I;  1YIJ 1;  2RIQ A;  4A3J I;  2M48 A;  4MD7 A;  4EWC A;  3IFU A;  2QA4 1;  1M90 1;  2NVQ I;  2E2I I;  3CCS Z;  4E2X A;  3HOY I;  3JAM b;  5FLX f;  5FLM I;  2Y0S A;  2GTI A;  3VMI A;  3CXC Y;  2VPY A;  4MXU A;  4DGL A;  3CC7 Z;  1WJ2 A;  3VTN A;  4Y7N I;  3CCR Z;  3G6E Z;  3CCL Z;  1ZB9 A;  3HOZ I;  2JR6 A;  1RNI A;  2V8K A;  1WW9 A;  3CD6 1;  2V45 A;  1YUK A;  1QVF Y;  3S1N I;  2QR1 B;  3J7A 4;  4NH1 C;  1VQL Z;  1QF8 A;  2NAP A;  5IP7 I;  1M1K 2;  4MRI A;  1VLA A;  1JWH C;  3GKQ A;  4Y52 I;  1VQN Z;  2JA7 I;  1RO0 A;  3G4S Z;  3J81 b;  5C3E I;  1VQP Z;  2P3Y A;  1K9M 1;  4A3E I;  3GTK I;  2QEX 1;  1KD1 2;  3CCU 1;  3CPW Z;  4RVD A;  4X6A I;  2JIQ A;  1Q7Y 1;  1VQ7 Z;  2LEX A;  3CXC Z;  1Q81 1;  2LIY A;  2VPZ A;  1YJ9 Z;  2B63 I;  3BG1 B;  3GTM S;  3GTP I;  2IV2 X;  4MD9 A;  4CL1 A;  1TWH I;  1X3Z A;  1WII A;  1VQO Z;  1N8R 2;  3CCQ Z;  3S16 I;  4NBE A;  2IZ3 A;  1K8A 2;  2QKD A;  3GTO I;  1QXF A;  3CCR 1;  3QWU A;  4QTT A;  3G6E 1;  3CCM Z;  3CCL 1;  2IZ4 A;  4E33 A;  3S14 I;  2Q51 A;  3FKI I;  1RO2 A;  3S1M I;  2M6N A;  3EED A;  4MON A;  1KC8 2;  5IT9 f;  1ML8 A;  1VQ4 1;  4NBA A;  1N2F A;  5C4J I;  2PK7 A;  3CC4 1;  3CC2 1;  3CCJ 1;  4NBC A;  3TE5 B;  1NP6 A;  1Y1V S;  2PMZ A;  2R7Z I;  3S1Q I;  3PO3 S;  1WCM I;  5T64 A;  1I6H I;  1YJN Z;  1JJ2 Z;  3IX0 A;  3CME Z;  3GTQ I;  3MZK B;  2JNY A;  3P5J B;  3OW2 Z;  1DL6 A;  1S72 Z;  3S1R I;  1TWC I;  1YJ9 1;  3Q87 A;  2K5R A;  3S15 I;  2VUM I;  4NB9 A;  2OTL Z;  4E31 A;  1KD1 1;  1Z01 A;  1QVG Z;  1Q86 2;  2JS4 A;  3I56 Z;  3NDI A;  1VQ5 1;  4NBB A;  3S2H I;  2RHB A;  1Y1W I;  3J80 b;  2VF1 A;  2W03 A;  3NFZ A;  1YI2 Z;  3S2D I;  2OOY B;  1YIT Z;  3F3F C;  1VQ6 Z;  5IP9 I;  1Y8C A;  1Z03 A;  5AN9 F;  3G71 Z;  3CQZ I;  3TDH B;  1RO4 A;  2OZK A;  3GTG I;  1TWF I;  1FDO A;  3D2L A;  1K8A 1;  2DE7 A;  4AYB A;  3JAM f;  1KQS Y;  1X0T A;  1K83 I;  2EGT A;  1VQK 1;  1VQ9 Z;  3VMH A;  3CCV 1; 
#chains in the Genus database with same CATH homology
 3CCE Z;  1TWA I;  2GTH A;  2V8J A;  5C44 I;  3D6W A;  1RQF A;  2OOX B;  3KIH A;  1TWG I;  4A93 I;  3GTM I;  3I55 1;  3CMA 1;  2F4O A;  2O4H A;  1YJN 1;  2JA8 I;  3HOV I;  2QRC B;  1S72 1;  1YUA A;  1TFI A;  1QYP A;  3F3P C;  4NOZ A;  3ESW A;  2HF1 A;  2OTL 1;  3S17 I;  5CM2 M;  3CCS 1;  3J81 f;  1ZB8 A;  1K73 1;  4BY1 I;  4HGY A;  3HKZ A;  1ZH1 A;  4BY7 I;  3BG0 B;  3I56 1;  1QVF Z;  3CC7 1;  4A3G I;  1NJI 2;  2H85 A;  3NH5 A;  5A2Q b;  2QA4 Z;  1VQ6 1;  4E2Z A;  1Q86 1;  3G71 1;  3HOU I;  5T6B A;  4BXX I;  1VQL 1;  1I3Q I;  2E2H I;  1VQ9 1;  3PO2 I;  2P28 A;  3CCE 1;  4QTU A;  4E2Y A;  3NH8 A;  3KIF A;  1VQN 1;  3G4S 1;  2F4M A;  3CD6 Z;  3I4N I;  2QLV B;  5C4X I;  5A2Q f;  1VQP 1;  1Q82 2;  5D1O A;  1LQL A;  1VQM Z;  5T67 A;  5D1O B;  2DE6 A;  1M1K 1;  1VQ7 1;  1Q7Y 2;  1YJW Z;  2BJO A;  1R9T I;  3IF8 A;  1Q81 2;  2NVX I;  1KRL A;  2RBL A;  2QRE B;  2YAD A;  1NUI A;  5FLX b;  3K7A I;  3T4N B;  5D1P A;  1W2B Y;  3RZD I;  1VQO 1;  2GU2 A;  3CCQ 1;  4A3D I;  1X3W A;  2G2K A;  2E9H A;  3CCM 1;  2KPI A;  4E32 A;  3M4O I;  3CPW Y;  3MON A;  2J6A A;  4NFR A;  1N8R 1;  4A3C I;  4XX2 A;  3VMG A;  3LUS A;  4A3K I;  4MD8 A;  3MZL B;  2W04 A;  3U50 C;  2WB1 A;  1YHQ Z;  1NJI 1;  3HOX I;  2OTJ Z;  2RPR A;  2KI7 B;  3D9X A;  3J80 f;  1KC8 1;  4RVF A;  4S1T A;  4BBS I;  3H3V J;  2NVT I;  2QRD B;  2YU9 I;  1VQ4 Z;  4RS4 A;  1VQM 1;  4A3M I;  1W2B Z;  1S7M A;  3CC4 Z;  3CME 1;  3CC2 Z;  3CCJ Z;  1PFT A;  4HH4 A;  4HGZ A;  1Z02 A;  5LL6 f;  1YJW 1;  4RVH A;  4DK1 A;  1VQ8 Z;  4NBH A;  2LFU A;  2JUB A;  2R92 I;  1M90 2;  2WAQ A;  1Q82 1;  2VUG A;  2JMO A;  4A3I I;  2R93 I;  2I3C A;  1I50 I;  1YIJ Z;  3FQM A;  3M3Y I;  2R6M A;  4RVG A;  2NVY I;  4E30 A;  1KQS Z;  3GTL I;  4E2W A;  1YI2 1;  1YIT 1;  2O53 A;  5IT9 b;  3RZO I;  1USP A;  1JJ2 Y;  4NBF A;  2AKL A;  1Y1V I;  1USP B;  3OW2 Y;  4RV9 A;  4BBR I;  2ZAE B;  3VB9 A;  1VQ5 Z;  3PO3 I;  4A3B I;  4NBD A;  2DE5 A;  2RT9 A;  1YHQ 1;  2OTJ 1;  3H0G I;  1QVG Y;  1SFO I;  4NB8 A;  2PM9 A;  4A3L I;  1L1O C;  3I4M I;  1K9M 2;  3NDJ A;  3GCF A;  4DQY B;  3FQQ A;  4MH4 A;  3I07 A;  4NBG A;  1VQK Z;  2Q4Z A;  2JA5 I;  3CCV Z;  1VQ8 1;  1P9N A;  2K3R A;  2HU9 A;  2QEX Z;  2JA6 I;  1RLY A;  4A3F I;  3CCU Z;  3GTJ I;  3EER A;  3I55 Z;  3CMA Z;  3NH4 A;  1K73 2;  4TNU A;  2E2J I;  2V8I A;  3HOW I;  1YIJ 1;  2RIQ A;  4A3J I;  2M48 A;  4MD7 A;  4EWC A;  3IFU A;  2QA4 1;  1M90 1;  2NVQ I;  2E2I I;  3CCS Z;  4E2X A;  3HOY I;  3JAM b;  5FLX f;  5FLM I;  2Y0S A;  2GTI A;  3VMI A;  3CXC Y;  4MXU A;  4DGL A;  3CC7 Z;  3VTN A;  4Y7N I;  3CCR Z;  3G6E Z;  3CCL Z;  1ZB9 A;  3HOZ I;  2JR6 A;  1RNI A;  2V8K A;  1WW9 A;  3CD6 1;  1YUK A;  1QVF Y;  3S1N I;  2QR1 B;  3J7A 4;  4NH1 C;  1VQL Z;  1QF8 A;  5IP7 I;  1M1K 2;  4MRI A;  1VLA A;  1JWH C;  3GKQ A;  4Y52 I;  1VQN Z;  2JA7 I;  1RO0 A;  3G4S Z;  3J81 b;  5C3E I;  1VQP Z;  2P3Y A;  1K9M 1;  4A3E I;  3GTK I;  2QEX 1;  1KD1 2;  3CCU 1;  3CPW Z;  4RVD A;  4X6A I;  1Q7Y 1;  1VQ7 Z;  3CXC Z;  1Q81 1;  2LIY A;  1YJ9 Z;  2B63 I;  3BG1 B;  3GTM S;  3GTP I;  4MD9 A;  4CL1 A;  1TWH I;  1X3Z A;  1WII A;  1VQO Z;  1N8R 2;  3CCQ Z;  3S16 I;  4NBE A;  2IZ3 A;  1K8A 2;  2QKD A;  3GTO I;  3CCR 1;  3QWU A;  4QTT A;  3G6E 1;  3CCM Z;  3CCL 1;  2IZ4 A;  4E33 A;  3S14 I;  2Q51 A;  3FKI I;  1RO2 A;  3S1M I;  2M6N A;  3EED A;  4MON A;  1KC8 2;  5IT9 f;  1ML8 A;  1VQ4 1;  4NBA A;  1N2F A;  5C4J I;  2PK7 A;  3CC4 1;  3CC2 1;  3CCJ 1;  4NBC A;  3TE5 B;  1NP6 A;  1Y1V S;  2PMZ A;  2R7Z I;  3S1Q I;  3PO3 S;  1WCM I;  5T64 A;  1I6H I;  1YJN Z;  1JJ2 Z;  3IX0 A;  3CME Z;  3GTQ I;  3MZK B;  2JNY A;  3P5J B;  3OW2 Z;  1DL6 A;  1S72 Z;  3S1R I;  1TWC I;  1YJ9 1;  3Q87 A;  2K5R A;  3S15 I;  2VUM I;  4NB9 A;  2OTL Z;  4E31 A;  1KD1 1;  1Z01 A;  1QVG Z;  1Q86 2;  2JS4 A;  3I56 Z;  3NDI A;  1VQ5 1;  4NBB A;  3S2H I;  2RHB A;  1Y1W I;  3J80 b;  2VF1 A;  2W03 A;  3NFZ A;  1YI2 Z;  3S2D I;  2OOY B;  1YIT Z;  3F3F C;  1VQ6 Z;  5IP9 I;  1Z03 A;  5AN9 F;  3G71 Z;  3CQZ I;  3TDH B;  1RO4 A;  2OZK A;  3GTG I;  1TWF I;  1K8A 1;  2DE7 A;  4AYB A;  3JAM f;  1KQS Y;  1X0T A;  1K83 I;  2EGT A;  1VQK 1;  1VQ9 Z;  3VMH A;  3CCV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...