2QEX1

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qex100
3CCEZ 1YI2Z 1Q862 1VQ91 1YHQZ 3CC4Z 3CPWZ 1VQ4Z 1YJNZ 1S721 1QVGY 1VQPZ 1Q812 3CCE1 3CMEZ 3CCUZ 1YI21 1YHQ1 1KD11 3G6EZ 3CC41 3I551 1Q861 3CCVZ 2QEX1 1VQ61 3CCJZ 3CCU1 1YJ91 3CXCY 1VQO1 1VQMZ 1Q811 1QVGZ 3CCMZ 1VQ7Z 1YIJZ 1W2BY 1M1K1 1NJI2 1VQN1 3CCSZ 2OTJ1 3CC2Z 3CCM1 1VQLZ 3CD61 3CXCZ 3CC7Z 1M1K2 3CCQZ 1VQ41 1YJN1 1W2BZ 2QA4Z 1NJI1 1VQ5Z 1VQP1 3G4SZ 3CMAZ 3CME1 1VQKZ 1YJWZ 3G6E1 1VQ8Z 1KQSY 1JJ2Y 1M901 2QA41 3CCV1 3G71Z 3CMA1 3CCJ1 3CCLZ 1YJW1 1VQ81 1VQM1 3CCRZ 1YITZ 1YIJ1 1Q7Y1 1VQ71 2OTLZ 3G711 1N8R1 1M902 1KQSZ 1JJ2Z 3CCS1 3CC21 1VQL1 1KC82 1Q821 3OW2Z 1QVFY 3I56Z 1Q7Y2 3CC71 1S72Z 3CCQ1 1N8R2 1K9M1 1VQ51 3G4S1 3I55Z 1K8A1 3I561 3OW2Y 1KC81 1VQK1 1Q822 2QEXZ 1VQ6Z 1K732 1QVFZ 1YJ9Z 1VQOZ 1K9M2 3CCL1 3CPWY 1K8A2 3CCR1 1YIT1 1VQ9Z 2OTL1 1VQNZ 2OTJZ 3CD6Z 1K731 1KD12
chains in the Genus database with same CATH superfamily
3J80f 1QF8A 3CCEZ 1Q862 3JAMb 2RT9A 2DE6A 3CC4Z 1YJNZ 1QVGY 1YI21 3CCUZ 2WAQA 1KD11 4E2YA 5FLXb 2I3CA 3D2LA 4A3LI 1X3WA 2RBLA 2IZ3A 1AA6A 1Q811 1RO4A 1K83I 3GTKI 4NBCA 2JA6I 2NVYI 4HGYA 2EGTA 3VMGA 3S1NI 2H85A 2OTJ1 3CCM1 3CXCZ 4A93I 4A3II 3HOXI 1WIIA 1Z03A 2PMZA 3G4SZ 2RPRA 5IP7I 1P9NA 1YJWZ 1KQSY 2JA7I 1JJ2Y 1M901 2QA41 3S16I 2O53A 3CCJ1 3BG0B 5C3EI 2AYDA 1YUKA 3J81f 3CCRZ 2R7ZI 2B63I 4A3KI 2OTLZ 3G711 1N8R1 5T67A 4DK1A 2LIYA 3ESWA 1Z02A 2JA5I 2W03A 3CCS1 3CC21 2E7ZA 1KC82 5D1OB 3VMHA 3I4MI 1FDOA 4QTTA 4EWCA 1VQ51 3HOZI 1K8A1 1USPB 3I561 1VQK1 2PM9A 1K732 2JIMA 1QVFZ 1WW9A 2NVQI 3GTMI 5T6BA 3F3FC 1YIT1 2OTJZ 3K7AI 1KD12 4E2WA 2J6AA 1VLAA 5C4XI 1JWHC 1RLYA 5IT9f 4E2ZA 1Y1WI 4BBSI 4MRIA 1S721 3D6WA 2G2KA 3NH8A 1Q812 2F4OA 2QRCB 1YHQ1 2R6MA 3PO3S 3I551 1S7MA 3JAMf 2QEX1 1Z01A 2HF1A 3CCJZ 4Y7NI 3NH4A 3T4NB 2OOXB 3CXCY 2VPYA 2QR1B 1X3ZA 1M1K1 3M4OI 5FLXf 4A3DI 3S14I 1I3QI 3H0GI 1RNIA 3CCSZ 2GTIA 3CC2Z 2YADA 4A3EI 3TDHB 1VQ41 2RHBA 4NH1C 1NJI1 1VQ5Z 2BJOA 1TWGI 1VQP1 3IR7A 2VPZA 3CME1 1VQKZ 1NP6A 3MZLB 3VMIA 2K5RA 2JMOA 3CMA1 3GTPI 3TE5B 4RVGA 1ZB9A 1VQ81 4A3MI 1YITZ 1Q7Y1 2KPIA 2JNYA 3MZKB 3HOUI 1ZH1A 2NVTI 3HOVI 3J7A4 1LQLA 1VQL1 3S1MI 3EEDA 1R9TI 1Q821 1QVFY 4NFRA 2JR6A 3CC71 2R92I 1S72Z 2GU2A 2Q51A 2V45A 1ZB8A 3IX0A 2VPXA 3I55Z 3OW2Y 4MD9A 5D1PA 2QEXZ 4RVHA 3FKII 5T64A 1SFOI 2KI7B 1K9M2 1N2FA 2PK7A 4RS4A 4X6AI 4NBBA 3I07A 4NBFA 2P28A 5FLMI 2E2JI 4AYBA 2YU9I 3P5JB 3BG1B 3QWUA 4NOZA 4CL1A 1YI2Z 3GTLI 1VQ91 4A3JI 3MONA 1VQ4Z 2VPWA 4DQYB 1TFIA 3GKQA 4E30A 1VQPZ 4RVFA 1Q16A 3CMEZ 3CCE1 3HOWI 2V3VA 4HGZA 3CC41 1TWCI 4E31A 2JIRA 2IV2X 2E2HI 1Y8CA 3VTNA 2E9HA 3CCU1 1PFTA 3NDIA 2JIOA 2QLVB 1VQO1 3CCMZ 2HU9A 2NVXI 3RZDI 2OZKA 4NBAA 1NJI2 1VQN1 1QYPA 4E33A 1VQLZ 5D1OA 1FDIA 4BXXI 4NB9A 3CC7Z 4NBEA 2ZAEB 1W2BZ 2QA4Z 3S1QI 2K3RA 4MH4A 3S15I 2JUBA 3FQMA 1USPA 1I6HI 4MD7A 3G6E1 2O4HA 4A3FI 4QTUA 3CCV1 3LUSA 2LEXA 3M3YI 3G71Z 2VUGA 1YJW1 2QKDA 4A3CI 1VQM1 1YIJ1 1VQ71 3GTQI 5A2Qb 1M902 2GTHA 3GTMS 4NBGA 1Y1VI 2V8KA 4BBRI 3D9XA 4MONA 3I56Z 3CCQ1 1N8R2 3NH5A 2E2II 3IF8A 3IFUA 2QRDB 2JIQA 2JIPA 1RO0A 2M6NA 5IP9I 1VQOZ 2P3YA 2JA8I 2DE5A 3CCL1 1X0TA 1KRLA 3J80b 4MD8A 3VB9A 1QXFA 3GTGI 4NBHA 1K8A2 4BY7I 2WB1A 4A3GI 1VQNZ 1WCMI 2VUMI 3U50C 5C44I 1YHQZ 3HOYI 3CPWZ 2V8JA 1L1OC 1TWHI 3H3VJ 4HH4A 4TNUA 3G6EZ 3NDJA 4MXUA 1Y1VS 3CCVZ 1Q861 2QREB 4Y52I 1VQ61 5LL6f 1YJ91 4E2XA 1VQMZ 1QVGZ 1VQ7Z 3F3PC 1YIJZ 1W2BY 2Q4ZA 2LFUA 3HKZA 3NFZA 5AN9F 1TWFI 3CD61 4RV9A 2VF1A 3KIFA 3PO2I 2R93I 1M1K2 3CCQZ 3PO3I 1YJN1 2AKLA 4A3BI 3EERA 3CMAZ 3J81b 1RQFA 2M48A 1TWAI 3RZOI 2JS4A 1VQ8Z 3FQQA 4XX2A 2Y0SA 3CCLZ 3I4NI 1I50I 1SIWA 3S1RI 2F4MA 3GCFA 1YUAA 1KQSZ 1JJ2Z 4NBDA 3S17I 3OW2Z 2W04A 1Q7Y2 1ML8A 5A2Qf 5CM2M 3Q87A 1K9M1 4DGLA 2NAPA 3CQZI 4BY1I 3G4S1 5C4JI 3S2DI 1KC81 3GTOI 1Q822 1VQ6Z 2RIQA 1RO2A 2OOYB 1YJ9Z 3KIHA 1DL6A 1WJ2A 4NB8A 4RVDA 3CPWY 5IT9b 3GTJI 4E32A 3CCR1 2IZ4A 3S2HI 1VQ9Z 2OTL1 2V8IA 2DE7A 1NUIA 4S1TA 3CD6Z 1K731 1WZNA
chains in the Genus database with same CATH topology
3J80f 1QF8A 3CCEZ 1Q862 3JAMb 2RT9A 2DE6A 3CC4Z 1YJNZ 1QVGY 1YI21 3CCUZ 2WAQA 1KD11 4E2YA 5FLXb 2I3CA 4A3LI 1X3WA 2RBLA 2IZ3A 1Q811 1RO4A 1K83I 3GTKI 4NBCA 2JA6I 2NVYI 4HGYA 2EGTA 3VMGA 3S1NI 2H85A 2OTJ1 3CCM1 3CXCZ 4A93I 4A3II 3HOXI 1WIIA 1Z03A 2PMZA 3G4SZ 2RPRA 5IP7I 1P9NA 1YJWZ 1KQSY 2JA7I 1JJ2Y 1M901 2QA41 3S16I 2O53A 3CCJ1 3BG0B 5C3EI 1YUKA 3J81f 3CCRZ 2R7ZI 2B63I 4A3KI 2OTLZ 3G711 1N8R1 5T67A 4DK1A 2LIYA 3ESWA 1Z02A 2JA5I 2W03A 3CCS1 3CC21 1KC82 5D1OB 3VMHA 3I4MI 4QTTA 4EWCA 1VQ51 3HOZI 1K8A1 1USPB 3I561 1VQK1 2PM9A 1K732 1QVFZ 1WW9A 2NVQI 3GTMI 5T6BA 3F3FC 1YIT1 2OTJZ 3K7AI 1KD12 4E2WA 2J6AA 1VLAA 5C4XI 1JWHC 1RLYA 5IT9f 4E2ZA 1Y1WI 4BBSI 4MRIA 1S721 3D6WA 2G2KA 3NH8A 1Q812 2F4OA 2QRCB 1YHQ1 2R6MA 3PO3S 3I551 1S7MA 3JAMf 2QEX1 1Z01A 2HF1A 3CCJZ 4Y7NI 3NH4A 3T4NB 2OOXB 3CXCY 2QR1B 1X3ZA 1M1K1 3M4OI 5FLXf 4A3DI 3S14I 1I3QI 3H0GI 1RNIA 3CCSZ 2GTIA 3CC2Z 2YADA 4A3EI 3TDHB 1VQ41 2RHBA 4NH1C 1NJI1 1VQ5Z 2BJOA 1TWGI 1VQP1 3CME1 1VQKZ 1NP6A 3MZLB 3VMIA 2K5RA 2JMOA 3CMA1 3GTPI 3TE5B 4RVGA 1ZB9A 1VQ81 4A3MI 1YITZ 1Q7Y1 2KPIA 2JNYA 3MZKB 3HOUI 1ZH1A 2NVTI 3HOVI 3J7A4 1LQLA 1VQL1 3S1MI 3EEDA 1R9TI 1Q821 1QVFY 4NFRA 2JR6A 3CC71 2R92I 1S72Z 2GU2A 2Q51A 1ZB8A 3IX0A 3I55Z 3OW2Y 4MD9A 5D1PA 2QEXZ 4RVHA 3FKII 5T64A 1SFOI 2KI7B 1K9M2 1N2FA 2PK7A 4RS4A 4X6AI 4NBBA 3I07A 4NBFA 2P28A 5FLMI 2E2JI 4AYBA 2YU9I 3P5JB 3BG1B 3QWUA 4NOZA 4CL1A 1YI2Z 3GTLI 1VQ91 4A3JI 3MONA 1VQ4Z 4DQYB 1TFIA 3GKQA 4E30A 1VQPZ 4RVFA 3CCE1 3CMEZ 3HOWI 4HGZA 3CC41 1TWCI 4E31A 2E2HI 3VTNA 2E9HA 3CCU1 1PFTA 3NDIA 2QLVB 1VQO1 3CCMZ 2HU9A 2NVXI 3RZDI 2OZKA 4NBAA 1NJI2 1VQN1 1QYPA 4E33A 1VQLZ 5D1OA 4BXXI 4NB9A 3CC7Z 4NBEA 2ZAEB 1W2BZ 2QA4Z 3S1QI 2K3RA 4MH4A 3S15I 2JUBA 3FQMA 1USPA 1I6HI 4MD7A 3G6E1 2O4HA 4A3FI 4QTUA 3CCV1 3LUSA 3M3YI 3G71Z 2VUGA 1YJW1 2QKDA 4A3CI 1VQM1 1YIJ1 1VQ71 3GTQI 5A2Qb 1M902 2GTHA 3GTMS 4NBGA 1Y1VI 2V8KA 4BBRI 3D9XA 4MONA 3I56Z 3CCQ1 1N8R2 3NH5A 2E2II 3IF8A 3IFUA 2QRDB 1RO0A 2M6NA 5IP9I 1VQOZ 2P3YA 2JA8I 2DE5A 3CCL1 1X0TA 1KRLA 3J80b 4MD8A 3VB9A 3GTGI 4NBHA 1K8A2 4BY7I 2WB1A 4A3GI 1VQNZ 1WCMI 2VUMI 3U50C 5C44I 1YHQZ 3HOYI 3CPWZ 2V8JA 1L1OC 1TWHI 3H3VJ 4HH4A 4TNUA 3G6EZ 3NDJA 4MXUA 1Y1VS 3CCVZ 1Q861 2QREB 4Y52I 1VQ61 5LL6f 1YJ91 4E2XA 1VQMZ 1QVGZ 1VQ7Z 3F3PC 1YIJZ 1W2BY 2Q4ZA 2LFUA 3HKZA 3NFZA 5AN9F 1TWFI 3CD61 4RV9A 2VF1A 3KIFA 3PO2I 2R93I 1M1K2 3CCQZ 3PO3I 1YJN1 2AKLA 4A3BI 3EERA 3CMAZ 3J81b 1RQFA 2M48A 1TWAI 3RZOI 2JS4A 1VQ8Z 3FQQA 4XX2A 2Y0SA 3CCLZ 3I4NI 1I50I 3S1RI 2F4MA 3GCFA 1YUAA 1KQSZ 1JJ2Z 4NBDA 3S17I 3OW2Z 2W04A 1Q7Y2 1ML8A 5A2Qf 5CM2M 3Q87A 1K9M1 4DGLA 3CQZI 4BY1I 3G4S1 5C4JI 3S2DI 1KC81 3GTOI 1Q822 1VQ6Z 2RIQA 1RO2A 2OOYB 1YJ9Z 3KIHA 1DL6A 4NB8A 4RVDA 3CPWY 5IT9b 3GTJI 4E32A 3CCR1 2IZ4A 3S2HI 1VQ9Z 2OTL1 2V8IA 2DE7A 1NUIA 4S1TA 3CD6Z 1K731
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE Z;  1YI2 Z;  1Q86 2;  1VQ9 1;  1YHQ Z;  3CC4 Z;  3CPW Z;  1VQ4 Z;  1YJN Z;  1S72 1;  1QVG Y;  1VQP Z;  1Q81 2;  3CCE 1;  3CME Z;  3CCU Z;  1YI2 1;  1YHQ 1;  1KD1 1;  3G6E Z;  3CC4 1;  3I55 1;  1Q86 1;  3CCV Z;  2QEX 1;  1VQ6 1;  3CCJ Z;  3CCU 1;  1YJ9 1;  3CXC Y;  1VQO 1;  1VQM Z;  1Q81 1;  1QVG Z;  3CCM Z;  1VQ7 Z;  1YIJ Z;  1W2B Y;  1M1K 1;  1NJI 2;  1VQN 1;  3CCS Z;  2OTJ 1;  3CC2 Z;  3CCM 1;  1VQL Z;  3CD6 1;  3CXC Z;  3CC7 Z;  1M1K 2;  3CCQ Z;  1VQ4 1;  1YJN 1;  1W2B Z;  2QA4 Z;  1NJI 1;  1VQ5 Z;  1VQP 1;  3G4S Z;  3CMA Z;  3CME 1;  1VQK Z;  1YJW Z;  3G6E 1;  1VQ8 Z;  1KQS Y;  1JJ2 Y;  1M90 1;  2QA4 1;  3CCV 1;  3G71 Z;  3CMA 1;  3CCJ 1;  3CCL Z;  1YJW 1;  1VQ8 1;  1VQM 1;  3CCR Z;  1YIT Z;  1YIJ 1;  1Q7Y 1;  1VQ7 1;  2OTL Z;  3G71 1;  1N8R 1;  1M90 2;  1KQS Z;  1JJ2 Z;  3CCS 1;  3CC2 1;  1VQL 1;  1KC8 2;  1Q82 1;  3OW2 Z;  1QVF Y;  3I56 Z;  1Q7Y 2;  3CC7 1;  1S72 Z;  3CCQ 1;  1N8R 2;  1K9M 1;  1VQ5 1;  3G4S 1;  3I55 Z;  1K8A 1;  3I56 1;  3OW2 Y;  1KC8 1;  1VQK 1;  1Q82 2;  2QEX Z;  1VQ6 Z;  1K73 2;  1QVF Z;  1YJ9 Z;  1VQO Z;  1K9M 2;  3CCL 1;  3CPW Y;  1K8A 2;  3CCR 1;  1YIT 1;  1VQ9 Z;  2OTL 1;  1VQN Z;  2OTJ Z;  3CD6 Z;  1K73 1;  1KD1 2; 
#chains in the Genus database with same CATH topology
 3J80 f;  1QF8 A;  3CCE Z;  1Q86 2;  3JAM b;  2RT9 A;  2DE6 A;  3CC4 Z;  1YJN Z;  1QVG Y;  1YI2 1;  3CCU Z;  2WAQ A;  1KD1 1;  4E2Y A;  5FLX b;  2I3C A;  3D2L A;  4A3L I;  1X3W A;  2RBL A;  2IZ3 A;  1AA6 A;  1Q81 1;  1RO4 A;  1K83 I;  3GTK I;  4NBC A;  2JA6 I;  2NVY I;  4HGY A;  2EGT A;  3VMG A;  3S1N I;  2H85 A;  2OTJ 1;  3CCM 1;  3CXC Z;  4A93 I;  4A3I I;  3HOX I;  1WII A;  1Z03 A;  2PMZ A;  3G4S Z;  2RPR A;  5IP7 I;  1P9N A;  1YJW Z;  1KQS Y;  2JA7 I;  1JJ2 Y;  1M90 1;  2QA4 1;  3S16 I;  2O53 A;  3CCJ 1;  3BG0 B;  5C3E I;  2AYD A;  1YUK A;  3J81 f;  3CCR Z;  2R7Z I;  2B63 I;  4A3K I;  2OTL Z;  3G71 1;  1N8R 1;  5T67 A;  4DK1 A;  2LIY A;  3ESW A;  1Z02 A;  2JA5 I;  2W03 A;  3CCS 1;  3CC2 1;  2E7Z A;  1KC8 2;  5D1O B;  3VMH A;  3I4M I;  1FDO A;  4QTT A;  4EWC A;  1VQ5 1;  3HOZ I;  1K8A 1;  1USP B;  3I56 1;  1VQK 1;  2PM9 A;  1K73 2;  2JIM A;  1QVF Z;  1WW9 A;  2NVQ I;  3GTM I;  5T6B A;  3F3F C;  1YIT 1;  2OTJ Z;  3K7A I;  1KD1 2;  4E2W A;  2J6A A;  1VLA A;  5C4X I;  1JWH C;  1RLY A;  5IT9 f;  4E2Z A;  1Y1W I;  4BBS I;  4MRI A;  1S72 1;  3D6W A;  2G2K A;  3NH8 A;  1Q81 2;  2F4O A;  2QRC B;  1YHQ 1;  2R6M A;  3PO3 S;  3I55 1;  1S7M A;  3JAM f;  2QEX 1;  1Z01 A;  2HF1 A;  3CCJ Z;  4Y7N I;  3NH4 A;  3T4N B;  2OOX B;  3CXC Y;  2VPY A;  2QR1 B;  1X3Z A;  1M1K 1;  3M4O I;  5FLX f;  4A3D I;  3S14 I;  1I3Q I;  3H0G I;  1RNI A;  3CCS Z;  2GTI A;  3CC2 Z;  2YAD A;  4A3E I;  3TDH B;  1VQ4 1;  2RHB A;  4NH1 C;  1NJI 1;  1VQ5 Z;  2BJO A;  1TWG I;  1VQP 1;  3IR7 A;  2VPZ A;  3CME 1;  1VQK Z;  1NP6 A;  3MZL B;  3VMI A;  2K5R A;  2JMO A;  3CMA 1;  3GTP I;  3TE5 B;  4RVG A;  1ZB9 A;  1VQ8 1;  4A3M I;  1YIT Z;  1Q7Y 1;  2KPI A;  2JNY A;  3MZK B;  3HOU I;  1ZH1 A;  2NVT I;  3HOV I;  3J7A 4;  1LQL A;  1VQL 1;  3S1M I;  3EED A;  1R9T I;  1Q82 1;  1QVF Y;  4NFR A;  2JR6 A;  3CC7 1;  2R92 I;  1S72 Z;  2GU2 A;  2Q51 A;  2V45 A;  1ZB8 A;  3IX0 A;  2VPX A;  3I55 Z;  3OW2 Y;  4MD9 A;  5D1P A;  2QEX Z;  4RVH A;  3FKI I;  5T64 A;  1SFO I;  2KI7 B;  1K9M 2;  1N2F A;  2PK7 A;  4RS4 A;  4X6A I;  4NBB A;  3I07 A;  4NBF A;  2P28 A;  5FLM I;  2E2J I;  4AYB A;  2YU9 I;  3P5J B;  3BG1 B;  3QWU A;  4NOZ A;  4CL1 A;  1YI2 Z;  3GTL I;  1VQ9 1;  4A3J I;  3MON A;  1VQ4 Z;  2VPW A;  4DQY B;  1TFI A;  3GKQ A;  4E30 A;  1VQP Z;  4RVF A;  1Q16 A;  3CME Z;  3CCE 1;  3HOW I;  2V3V A;  4HGZ A;  3CC4 1;  1TWC I;  4E31 A;  2JIR A;  2IV2 X;  2E2H I;  1Y8C A;  3VTN A;  2E9H A;  3CCU 1;  1PFT A;  3NDI A;  2JIO A;  2QLV B;  1VQO 1;  3CCM Z;  2HU9 A;  2NVX I;  3RZD I;  2OZK A;  4NBA A;  1NJI 2;  1VQN 1;  1QYP A;  4E33 A;  1VQL Z;  5D1O A;  1FDI A;  4BXX I;  4NB9 A;  3CC7 Z;  4NBE A;  2ZAE B;  1W2B Z;  2QA4 Z;  3S1Q I;  2K3R A;  4MH4 A;  3S15 I;  2JUB A;  3FQM A;  1USP A;  1I6H I;  4MD7 A;  3G6E 1;  2O4H A;  4A3F I;  4QTU A;  3CCV 1;  3LUS A;  2LEX A;  3M3Y I;  3G71 Z;  2VUG A;  1YJW 1;  2QKD A;  4A3C I;  1VQM 1;  1YIJ 1;  1VQ7 1;  3GTQ I;  5A2Q b;  1M90 2;  2GTH A;  3GTM S;  4NBG A;  1Y1V I;  2V8K A;  4BBR I;  3D9X A;  4MON A;  3I56 Z;  3CCQ 1;  1N8R 2;  3NH5 A;  2E2I I;  3IF8 A;  3IFU A;  2QRD B;  2JIQ A;  2JIP A;  1RO0 A;  2M6N A;  5IP9 I;  1VQO Z;  2P3Y A;  2JA8 I;  2DE5 A;  3CCL 1;  1X0T A;  1KRL A;  3J80 b;  4MD8 A;  3VB9 A;  1QXF A;  3GTG I;  4NBH A;  1K8A 2;  4BY7 I;  2WB1 A;  4A3G I;  1VQN Z;  1WCM I;  2VUM I;  3U50 C;  5C44 I;  1YHQ Z;  3HOY I;  3CPW Z;  2V8J A;  1L1O C;  1TWH I;  3H3V J;  4HH4 A;  4TNU A;  3G6E Z;  3NDJ A;  4MXU A;  1Y1V S;  3CCV Z;  1Q86 1;  2QRE B;  4Y52 I;  1VQ6 1;  5LL6 f;  1YJ9 1;  4E2X A;  1VQM Z;  1QVG Z;  1VQ7 Z;  3F3P C;  1YIJ Z;  1W2B Y;  2Q4Z A;  2LFU A;  3HKZ A;  3NFZ A;  5AN9 F;  1TWF I;  3CD6 1;  4RV9 A;  2VF1 A;  3KIF A;  3PO2 I;  2R93 I;  1M1K 2;  3CCQ Z;  3PO3 I;  1YJN 1;  2AKL A;  4A3B I;  3EER A;  3CMA Z;  3J81 b;  1RQF A;  2M48 A;  1TWA I;  3RZO I;  2JS4 A;  1VQ8 Z;  3FQQ A;  4XX2 A;  2Y0S A;  3CCL Z;  3I4N I;  1I50 I;  1SIW A;  3S1R I;  2F4M A;  3GCF A;  1YUA A;  1KQS Z;  1JJ2 Z;  4NBD A;  3S17 I;  3OW2 Z;  2W04 A;  1Q7Y 2;  1ML8 A;  5A2Q f;  5CM2 M;  3Q87 A;  1K9M 1;  4DGL A;  2NAP A;  3CQZ I;  4BY1 I;  3G4S 1;  5C4J I;  3S2D I;  1KC8 1;  3GTO I;  1Q82 2;  1VQ6 Z;  2RIQ A;  1RO2 A;  2OOY B;  1YJ9 Z;  3KIH A;  1DL6 A;  1WJ2 A;  4NB8 A;  4RVD A;  3CPW Y;  5IT9 b;  3GTJ I;  4E32 A;  3CCR 1;  2IZ4 A;  3S2H I;  1VQ9 Z;  2OTL 1;  2V8I A;  2DE7 A;  1NUI A;  4S1T A;  3CD6 Z;  1K73 1;  1WZN A; 
#chains in the Genus database with same CATH homology
 3J80 f;  1QF8 A;  3CCE Z;  1Q86 2;  3JAM b;  2RT9 A;  2DE6 A;  3CC4 Z;  1YJN Z;  1QVG Y;  1YI2 1;  3CCU Z;  2WAQ A;  1KD1 1;  4E2Y A;  5FLX b;  2I3C A;  4A3L I;  1X3W A;  2RBL A;  2IZ3 A;  1Q81 1;  1RO4 A;  1K83 I;  3GTK I;  4NBC A;  2JA6 I;  2NVY I;  4HGY A;  2EGT A;  3VMG A;  3S1N I;  2H85 A;  2OTJ 1;  3CCM 1;  3CXC Z;  4A93 I;  4A3I I;  3HOX I;  1WII A;  1Z03 A;  2PMZ A;  3G4S Z;  2RPR A;  5IP7 I;  1P9N A;  1YJW Z;  1KQS Y;  2JA7 I;  1JJ2 Y;  1M90 1;  2QA4 1;  3S16 I;  2O53 A;  3CCJ 1;  3BG0 B;  5C3E I;  1YUK A;  3J81 f;  3CCR Z;  2R7Z I;  2B63 I;  4A3K I;  2OTL Z;  3G71 1;  1N8R 1;  5T67 A;  4DK1 A;  2LIY A;  3ESW A;  1Z02 A;  2JA5 I;  2W03 A;  3CCS 1;  3CC2 1;  1KC8 2;  5D1O B;  3VMH A;  3I4M I;  4QTT A;  4EWC A;  1VQ5 1;  3HOZ I;  1K8A 1;  1USP B;  3I56 1;  1VQK 1;  2PM9 A;  1K73 2;  1QVF Z;  1WW9 A;  2NVQ I;  3GTM I;  5T6B A;  3F3F C;  1YIT 1;  2OTJ Z;  3K7A I;  1KD1 2;  4E2W A;  2J6A A;  1VLA A;  5C4X I;  1JWH C;  1RLY A;  5IT9 f;  4E2Z A;  1Y1W I;  4BBS I;  4MRI A;  1S72 1;  3D6W A;  2G2K A;  3NH8 A;  1Q81 2;  2F4O A;  2QRC B;  1YHQ 1;  2R6M A;  3PO3 S;  3I55 1;  1S7M A;  3JAM f;  2QEX 1;  1Z01 A;  2HF1 A;  3CCJ Z;  4Y7N I;  3NH4 A;  3T4N B;  2OOX B;  3CXC Y;  2QR1 B;  1X3Z A;  1M1K 1;  3M4O I;  5FLX f;  4A3D I;  3S14 I;  1I3Q I;  3H0G I;  1RNI A;  3CCS Z;  2GTI A;  3CC2 Z;  2YAD A;  4A3E I;  3TDH B;  1VQ4 1;  2RHB A;  4NH1 C;  1NJI 1;  1VQ5 Z;  2BJO A;  1TWG I;  1VQP 1;  3CME 1;  1VQK Z;  1NP6 A;  3MZL B;  3VMI A;  2K5R A;  2JMO A;  3CMA 1;  3GTP I;  3TE5 B;  4RVG A;  1ZB9 A;  1VQ8 1;  4A3M I;  1YIT Z;  1Q7Y 1;  2KPI A;  2JNY A;  3MZK B;  3HOU I;  1ZH1 A;  2NVT I;  3HOV I;  3J7A 4;  1LQL A;  1VQL 1;  3S1M I;  3EED A;  1R9T I;  1Q82 1;  1QVF Y;  4NFR A;  2JR6 A;  3CC7 1;  2R92 I;  1S72 Z;  2GU2 A;  2Q51 A;  1ZB8 A;  3IX0 A;  3I55 Z;  3OW2 Y;  4MD9 A;  5D1P A;  2QEX Z;  4RVH A;  3FKI I;  5T64 A;  1SFO I;  2KI7 B;  1K9M 2;  1N2F A;  2PK7 A;  4RS4 A;  4X6A I;  4NBB A;  3I07 A;  4NBF A;  2P28 A;  5FLM I;  2E2J I;  4AYB A;  2YU9 I;  3P5J B;  3BG1 B;  3QWU A;  4NOZ A;  4CL1 A;  1YI2 Z;  3GTL I;  1VQ9 1;  4A3J I;  3MON A;  1VQ4 Z;  4DQY B;  1TFI A;  3GKQ A;  4E30 A;  1VQP Z;  4RVF A;  3CCE 1;  3CME Z;  3HOW I;  4HGZ A;  3CC4 1;  1TWC I;  4E31 A;  2E2H I;  3VTN A;  2E9H A;  3CCU 1;  1PFT A;  3NDI A;  2QLV B;  1VQO 1;  3CCM Z;  2HU9 A;  2NVX I;  3RZD I;  2OZK A;  4NBA A;  1NJI 2;  1VQN 1;  1QYP A;  4E33 A;  1VQL Z;  5D1O A;  4BXX I;  4NB9 A;  3CC7 Z;  4NBE A;  2ZAE B;  1W2B Z;  2QA4 Z;  3S1Q I;  2K3R A;  4MH4 A;  3S15 I;  2JUB A;  3FQM A;  1USP A;  1I6H I;  4MD7 A;  3G6E 1;  2O4H A;  4A3F I;  4QTU A;  3CCV 1;  3LUS A;  3M3Y I;  3G71 Z;  2VUG A;  1YJW 1;  2QKD A;  4A3C I;  1VQM 1;  1YIJ 1;  1VQ7 1;  3GTQ I;  5A2Q b;  1M90 2;  2GTH A;  3GTM S;  4NBG A;  1Y1V I;  2V8K A;  4BBR I;  3D9X A;  4MON A;  3I56 Z;  3CCQ 1;  1N8R 2;  3NH5 A;  2E2I I;  3IF8 A;  3IFU A;  2QRD B;  1RO0 A;  2M6N A;  5IP9 I;  1VQO Z;  2P3Y A;  2JA8 I;  2DE5 A;  3CCL 1;  1X0T A;  1KRL A;  3J80 b;  4MD8 A;  3VB9 A;  3GTG I;  4NBH A;  1K8A 2;  4BY7 I;  2WB1 A;  4A3G I;  1VQN Z;  1WCM I;  2VUM I;  3U50 C;  5C44 I;  1YHQ Z;  3HOY I;  3CPW Z;  2V8J A;  1L1O C;  1TWH I;  3H3V J;  4HH4 A;  4TNU A;  3G6E Z;  3NDJ A;  4MXU A;  1Y1V S;  3CCV Z;  1Q86 1;  2QRE B;  4Y52 I;  1VQ6 1;  5LL6 f;  1YJ9 1;  4E2X A;  1VQM Z;  1QVG Z;  1VQ7 Z;  3F3P C;  1YIJ Z;  1W2B Y;  2Q4Z A;  2LFU A;  3HKZ A;  3NFZ A;  5AN9 F;  1TWF I;  3CD6 1;  4RV9 A;  2VF1 A;  3KIF A;  3PO2 I;  2R93 I;  1M1K 2;  3CCQ Z;  3PO3 I;  1YJN 1;  2AKL A;  4A3B I;  3EER A;  3CMA Z;  3J81 b;  1RQF A;  2M48 A;  1TWA I;  3RZO I;  2JS4 A;  1VQ8 Z;  3FQQ A;  4XX2 A;  2Y0S A;  3CCL Z;  3I4N I;  1I50 I;  3S1R I;  2F4M A;  3GCF A;  1YUA A;  1KQS Z;  1JJ2 Z;  4NBD A;  3S17 I;  3OW2 Z;  2W04 A;  1Q7Y 2;  1ML8 A;  5A2Q f;  5CM2 M;  3Q87 A;  1K9M 1;  4DGL A;  3CQZ I;  4BY1 I;  3G4S 1;  5C4J I;  3S2D I;  1KC8 1;  3GTO I;  1Q82 2;  1VQ6 Z;  2RIQ A;  1RO2 A;  2OOY B;  1YJ9 Z;  3KIH A;  1DL6 A;  4NB8 A;  4RVD A;  3CPW Y;  5IT9 b;  3GTJ I;  4E32 A;  3CCR 1;  2IZ4 A;  3S2H I;  1VQ9 Z;  2OTL 1;  2V8I A;  2DE7 A;  1NUI A;  4S1T A;  3CD6 Z;  1K73 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...