5IP7I

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I02
2E2JI 4NBCA 2DE7A 2YU9I 5CM2M 3HOXI 4A3CI 1I6HI 3PO3I 3CQZI 5C4JI 3I07A 1ML8A 3HOUI 4A3MI 1K83I 1PFTA 5FLMI 4NOZA 3GTKI 1USPA 2JA6I 1TFIA 3S17I 3K7AI 2JNYA 5C3EI 1N2FA 2DE5A 3GTQI 4NBFA 1QYPA 1TWCI 3HOVI 1DL6A 4NBGA 2R7ZI 1YUAA 3VB9A 3VMIA 4BBRI 1ZB9A 3S1RI 4A3BI 3ESWA 2AKLA 4NBDA 3S2HI 4QTUA 4A93I 1ZB8A 1RLYA 3EERA 2BJOA 3U50C 4BY1I 2B63I 1NUIA 3S1QI 3I4NI 4BY7I 4MH4A 2P3YA 3M4OI 3FKII 5C4XI 3GTLI 3GTPI 4NBHA 3VMGA 2E2II 3S15I 2JR6A 4Y7NI 2F4MA 1VLAA 3GTGI 2R93I 1R9TI 3H0GI 1X3WA 4BBSI 3GCFA 3D6WA 3H3VJ 2PK7A 3S1MI 3I4MI 3Q87A 4NB8A 1TWFI 4A3FI 3GKQA 1L1OC 2J6AA 2VUMI 3GTMS 1SFOI 2JA5I 2NVTI 2HF1A 4A3LI 3RZDI 4NBEA 2KPIA 2NVQI 3GTOI 1USPB 2NVYI 3GTJI 4A3II 3PO2I 3HOYI 4NBAA 4A3GI 2R92I 5IP7I 3S16I 3GTMI 3S14I 1TWGI 2JA7I 4NB9A 1Y1VS 5IP9I 4A3KI 2RBLA 4A3JI 3HOZI 5C44I 3HOWI 3S2DI 3RZOI 4X6AI 2F4OA 2K5RA 1RO4A 4BXXI 4A3DI 1LQLA 1Y1WI 3VMHA 1I50I 4QTTA 3S1NI 1Y1VI 2E2HI 2NVXI 3LUSA 4NBBA 4XX2A 1TWHI 2JS4A 2DE6A 3PO3S 4Y52I 1WCMI 1I3QI 2JA8I 1WW9A 3M3YI 1TWAI 4A3EI 1X3ZA
chains in the Genus database with same CATH superfamily
3CCLZ 1VQMZ 4HGYA 2DE7A 2RHBA 3CCU1 3CQZI 1NP6A 1VQ9Z 1K8A1 4E2ZA 2O53A 4A3MI 1PFTA 2W04A 2RPRA 4DQYB 3G4SZ 3GTKI 3MZKB 2JA6I 3S17I 1Q7Y2 2JNYA 2K3RA 1M1K1 3GTQI 4NBFA 1TWCI 3I561 1VQ41 1YI21 3CPWY 2R7ZI 3FQQA 4E32A 3VMIA 1ZB9A 1K9M2 4QTUA 1RLYA 2QKDA 3CCMZ 4BY1I 3IX0A 2QA4Z 3F3FC 2EGTA 3IR7A 4NH1C 3GTLI 2V8KA 1QXFA 3CMAZ 4E30A 4RVDA 5A2Qb 1VLAA 2QR1B 3H0GI 3NFZA 4BBSI 2LIYA 4DK1A 2NAPA 3CCQZ 1YUKA 3J81b 1YJNZ 1L1OC 4E31A 1M901 2VUGA 2JA5I 2Q4ZA 3GTOI 1USPB 4AYBA 2ZAEB 2VPXA 4DGLA 5T64A 3G6EZ 3HOYI 4NB9A 5IP9I 1KQSY 4RV9A 3HOZI 5C44I 3CXCY 1S72Z 3S2DI 2GTHA 3CME1 2K5RA 2JUBA 3CD61 1VQK1 3CC71 2PM9A 4CL1A 1Y1WI 2VPZA 4QTTA 2VPWA 1Q812 3CC4Z 1TWHI 3JAMb 5IT9f 1JJ2Z 1WW9A 1RQFA 3CCEZ 3I551 3VTNA 1Q7Y1 2QLVB 1YJ9Z 1YIT1 2E2JI 1VQPZ 5CM2M 3HOXI 1I6HI 3PO3I 3CCV1 1K9M1 2QEX1 1ML8A 5T6BA 4MD8A 4NOZA 1USPA 5C3EI 2GU2A 2DE5A 3OW2Z 1QVGZ 1VQ71 1QYPA 3HOVI 1DL6A 2LFUA 3CC21 1QF8A 1N8R2 4BBRI 1YHQZ 3CCRZ 1VQ6Z 2G2KA 1NUIA 4MH4A 2P3YA 1Q862 2GTIA 3CCS1 3CCL1 2JIOA 1YJWZ 3GTPI 4NBHA 2RT9A 2Q51A 4Y7NI 2F4MA 1R9TI 3F3PC 3FQMA 3D6WA 3G4S1 1VQO1 1KRLA 2LEXA 5D1OB 1TWFI 4A3FI 5T67A 3J80f 1VQ5Z 3D9XA 3MONA 1QVFY 3CPWZ 3GTMS 1KC81 1X0TA 5FLXf 4A3LI 2KPIA 2NVQI 3G71Z 3CCM1 1Q811 4A3GI 5IP7I 3S14I 4E2YA 1K732 2RBLA 3HOWI 1WZNA 2F4OA 3EEDA 4NFRA 3CMA1 1VQNZ 1Q822 3QWUA 4E33A 2V3VA 4BXXI 2YADA 1LQLA 3VMHA 2NVXI 4XX2A 2IZ4A 2JS4A 2DE6A 1KD12 1RO0A 1WCMI 2JA8I 3M3YI 3NH5A 1X3ZA 4RS4A 1JWHC 4NBCA 2YU9I 2AYDA 3IF8A 1N8R1 4A3CI 1Z02A 5LL6f 2QREB 3G6E1 5C4JI 2OTJZ 1FDOA 3HOUI 1K83I 1SIWA 5FLMI 2VF1A 1Z03A 1KQSZ 1TFIA 3K7AI 1S721 2PMZA 3CXCZ 2JMOA 1Q861 3CD6Z 2V8JA 4NBGA 5A2Qf 3VB9A 3MZLB 4TNUA 3CCJ1 4EWCA 3BG0B 4A93I 1P9NA 2BJOA 3U50C 2B63I 3I4NI 3CCE1 1FDIA 1W2BY 2OTLZ 2E9HA 1YJ91 1VQP1 2WB1A 3M4OI 1VQ8Z 3KIFA 4S1TA 5C4XI 1YIJZ 3T4NB 3P5JB 2O4HA 4MONA 1Z01A 3GTGI 2JIPA 1X3WA 3H3VJ 2PK7A 4RVFA 4NB8A 3NH8A 4E2XA 3NDJA 4HH4A 3J80b 3CC2Z 3J7A4 3HKZA 1RNIA 2J6AA 2VUMI 2V8IA 1SFOI 1VQLZ 1RO2A 1YHQ1 2HF1A 3RZDI 4RVGA 2QRCB 4NBEA 2W03A 3IFUA 1VQM1 1Q821 3CCR1 2H85A 3CCUZ 3D2LA 3PO2I 2M6NA 2JIRA 1VQ91 4E2WA 1KD11 3GTMI 2JA7I 5AN9F 1Y1VS 4A3KI 2IZ3A 4A3JI 1YJW1 1ZH1A 3RZOI 4MRIA 3I56Z 1VQ4Z 1YI2Z 3NH4A 1RO4A 2WAQA 1VQOZ 1I50I 2Y0SA 3S1NI 2E2HI 1Y8CA 1VQ51 4Y52I 2OOXB 1QVFZ 4A3EI 2V45A 2QA41 2RIQA 2KI7B 4RVHA 2QRDB 3G711 2HU9A 3TDHB 3I07A 1NJI2 4MD9A 3CCQ1 1N2FA 5IT9b 1VQN1 1WJ2A 1YJN1 1YUAA 3S1RI 1K8A2 4A3BI 3ESWA 2AKLA 4NBDA 5D1OA 2JIMA 3S2HI 3NDIA 1ZB8A 2R6MA 3EERA 3S1QI 4BY7I 1M1K2 5D1PA 3FKII 3BG1B 3CMEZ 3VMGA 1S7MA 2E2II 3TE5B 4HGZA 3S15I 2OTJ1 1VQKZ 2JR6A 2E7ZA 2R93I 2OZKA 1AA6A 3CC7Z 3GCFA 3S1MI 1WIIA 3I4MI 3Q87A 1KC82 3CC41 3GKQA 3J81f 1JJ2Y 3CCJZ 3I55Z 2NVTI 2I3CA 1YITZ 2JIQA 2NVYI 3GTJI 4A3II 1Q16A 3CCVZ 2QEXZ 4NBAA 2R92I 2OTL1 1W2BZ 3S16I 1TWGI 2M48A 1VQ81 1M902 4MD7A 3OW2Y 1YIJ1 1QVGY 4X6AI 2P28A 1VQ7Z 1K731 4A3DI 2VPYA 5FLXb 2IV2X 1Y1VI 3LUSA 4NBBA 3JAMf 4MXUA 1VQ61 3PO3S 1NJI1 2OOYB 1I3QI 1TWAI 3KIHA 1VQL1 3CCSZ
chains in the Genus database with same CATH topology
3CCLZ 1VQMZ 4HGYA 2DE7A 2RHBA 3CCU1 3CQZI 1NP6A 1VQ9Z 1K8A1 4E2ZA 2O53A 4A3MI 1PFTA 2W04A 2RPRA 4DQYB 3G4SZ 3GTKI 3MZKB 2JA6I 3S17I 1Q7Y2 2JNYA 2K3RA 1M1K1 3GTQI 4NBFA 1TWCI 3I561 1VQ41 1YI21 3CPWY 2R7ZI 3FQQA 4E32A 3VMIA 1ZB9A 1K9M2 4QTUA 1RLYA 2QKDA 3CCMZ 4BY1I 3IX0A 2QA4Z 3F3FC 2EGTA 4NH1C 3GTLI 2V8KA 3CMAZ 4E30A 4RVDA 2QR1B 1VLAA 5A2Qb 3H0GI 3NFZA 4BBSI 2LIYA 4DK1A 3CCQZ 1YUKA 3J81b 1YJNZ 1L1OC 4E31A 1M901 2VUGA 2JA5I 2Q4ZA 3GTOI 1USPB 4AYBA 2ZAEB 4DGLA 5T64A 3G6EZ 3HOYI 4NB9A 5IP9I 1KQSY 4RV9A 3HOZI 5C44I 3CXCY 1S72Z 3S2DI 2GTHA 3CME1 2K5RA 2JUBA 3CD61 1VQK1 3CC71 2PM9A 4CL1A 1Y1WI 4QTTA 1Q812 3CC4Z 1TWHI 3JAMb 5IT9f 1JJ2Z 1WW9A 1RQFA 3CCEZ 3I551 3VTNA 1Q7Y1 2QLVB 1YJ9Z 1YIT1 2E2JI 1VQPZ 5CM2M 3HOXI 1I6HI 3PO3I 3CCV1 1K9M1 2QEX1 1ML8A 5T6BA 4MD8A 4NOZA 1USPA 5C3EI 2GU2A 2DE5A 3OW2Z 1QVGZ 1VQ71 1QYPA 3HOVI 1DL6A 2LFUA 3CC21 1QF8A 1N8R2 4BBRI 1YHQZ 3CCRZ 1VQ6Z 2G2KA 1NUIA 4MH4A 2P3YA 1Q862 2GTIA 3CCS1 3CCL1 1YJWZ 3GTPI 4NBHA 2RT9A 2Q51A 4Y7NI 2F4MA 1R9TI 3F3PC 3FQMA 3D6WA 3G4S1 1VQO1 1KRLA 5D1OB 1TWFI 4A3FI 5T67A 3J80f 1VQ5Z 3D9XA 3MONA 1QVFY 3CPWZ 3GTMS 1KC81 1X0TA 5FLXf 4A3LI 2KPIA 2NVQI 3G71Z 3CCM1 1Q811 4A3GI 5IP7I 3S14I 4E2YA 1K732 2RBLA 3HOWI 2F4OA 3EEDA 4NFRA 3CMA1 1VQNZ 1Q822 3QWUA 4E33A 4BXXI 2YADA 1LQLA 3VMHA 2NVXI 4XX2A 2IZ4A 2JS4A 2DE6A 1KD12 1RO0A 1WCMI 2JA8I 3M3YI 3NH5A 1X3ZA 4RS4A 1JWHC 4NBCA 2YU9I 3IF8A 1N8R1 4A3CI 1Z02A 5LL6f 2QREB 3G6E1 5C4JI 2OTJZ 3HOUI 1K83I 5FLMI 2VF1A 1Z03A 1KQSZ 1TFIA 3K7AI 1S721 2PMZA 3CXCZ 2JMOA 1Q861 3CD6Z 2V8JA 4NBGA 5A2Qf 3VB9A 3MZLB 4TNUA 3CCJ1 4EWCA 3BG0B 4A93I 1P9NA 2BJOA 3U50C 2B63I 3I4NI 3CCE1 1W2BY 2OTLZ 2E9HA 1YJ91 1VQP1 2WB1A 3M4OI 1VQ8Z 3KIFA 4S1TA 5C4XI 1YIJZ 3T4NB 3P5JB 2O4HA 4MONA 1Z01A 3GTGI 1X3WA 3H3VJ 2PK7A 4RVFA 4NB8A 3NH8A 4E2XA 3NDJA 4HH4A 3J80b 3CC2Z 3J7A4 3HKZA 1RNIA 2J6AA 2VUMI 2V8IA 1SFOI 1VQLZ 1RO2A 1YHQ1 2HF1A 3RZDI 4RVGA 2QRCB 4NBEA 2W03A 3IFUA 1VQM1 1Q821 3CCR1 2H85A 3CCUZ 3PO2I 2M6NA 1VQ91 4E2WA 1KD11 3GTMI 2JA7I 5AN9F 1Y1VS 4A3KI 2IZ3A 4A3JI 1YJW1 1ZH1A 3RZOI 4MRIA 3I56Z 1VQ4Z 1YI2Z 3NH4A 1RO4A 2WAQA 1VQOZ 1I50I 2Y0SA 3S1NI 2E2HI 1VQ51 4Y52I 2OOXB 1QVFZ 4A3EI 2QA41 2RIQA 2KI7B 4RVHA 2QRDB 3G711 2HU9A 3TDHB 3I07A 1NJI2 4MD9A 3CCQ1 1N2FA 5IT9b 1VQN1 1YJN1 1YUAA 3S1RI 1K8A2 4A3BI 3ESWA 2AKLA 4NBDA 5D1OA 3S2HI 3NDIA 1ZB8A 2R6MA 3EERA 3S1QI 4BY7I 1M1K2 5D1PA 3FKII 3BG1B 3CMEZ 3VMGA 1S7MA 2E2II 3TE5B 4HGZA 3S15I 2OTJ1 1VQKZ 2JR6A 2R93I 2OZKA 3CC7Z 3GCFA 3S1MI 1WIIA 3I4MI 3Q87A 1KC82 3CC41 3GKQA 3J81f 1JJ2Y 3CCJZ 3I55Z 2NVTI 2I3CA 1YITZ 2NVYI 3GTJI 4A3II 3CCVZ 2QEXZ 4NBAA 2R92I 2OTL1 1W2BZ 3S16I 1TWGI 2M48A 1VQ81 1M902 4MD7A 3OW2Y 1YIJ1 1QVGY 4X6AI 2P28A 1VQ7Z 1K731 4A3DI 5FLXb 1Y1VI 3LUSA 4NBBA 3JAMf 4MXUA 1VQ61 3PO3S 1NJI1 2OOYB 1I3QI 1TWAI 3KIHA 1VQL1 3CCSZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J I;  4NBC A;  2DE7 A;  2YU9 I;  5CM2 M;  3HOX I;  4A3C I;  1I6H I;  3PO3 I;  3CQZ I;  5C4J I;  3I07 A;  1ML8 A;  3HOU I;  4A3M I;  1K83 I;  1PFT A;  5FLM I;  4NOZ A;  3GTK I;  1USP A;  2JA6 I;  1TFI A;  3S17 I;  3K7A I;  2JNY A;  5C3E I;  1N2F A;  2DE5 A;  3GTQ I;  4NBF A;  1QYP A;  1TWC I;  3HOV I;  1DL6 A;  4NBG A;  2R7Z I;  1YUA A;  3VB9 A;  3VMI A;  4BBR I;  1ZB9 A;  3S1R I;  4A3B I;  3ESW A;  2AKL A;  4NBD A;  3S2H I;  4QTU A;  4A93 I;  1ZB8 A;  1RLY A;  3EER A;  2BJO A;  3U50 C;  4BY1 I;  2B63 I;  1NUI A;  3S1Q I;  3I4N I;  4BY7 I;  4MH4 A;  2P3Y A;  3M4O I;  3FKI I;  5C4X I;  3GTL I;  3GTP I;  4NBH A;  3VMG A;  2E2I I;  3S15 I;  2JR6 A;  4Y7N I;  2F4M A;  1VLA A;  3GTG I;  2R93 I;  1R9T I;  3H0G I;  1X3W A;  4BBS I;  3GCF A;  3D6W A;  3H3V J;  2PK7 A;  3S1M I;  3I4M I;  3Q87 A;  4NB8 A;  1TWF I;  4A3F I;  3GKQ A;  1L1O C;  2J6A A;  2VUM I;  3GTM S;  1SFO I;  2JA5 I;  2NVT I;  2HF1 A;  4A3L I;  3RZD I;  4NBE A;  2KPI A;  2NVQ I;  3GTO I;  1USP B;  2NVY I;  3GTJ I;  4A3I I;  3PO2 I;  3HOY I;  4NBA A;  4A3G I;  2R92 I;  5IP7 I;  3S16 I;  3GTM I;  3S14 I;  1TWG I;  2JA7 I;  4NB9 A;  1Y1V S;  5IP9 I;  4A3K I;  2RBL A;  4A3J I;  3HOZ I;  5C44 I;  3HOW I;  3S2D I;  3RZO I;  4X6A I;  2F4O A;  2K5R A;  1RO4 A;  4BXX I;  4A3D I;  1LQL A;  1Y1W I;  3VMH A;  1I50 I;  4QTT A;  3S1N I;  1Y1V I;  2E2H I;  2NVX I;  3LUS A;  4NBB A;  4XX2 A;  1TWH I;  2JS4 A;  2DE6 A;  3PO3 S;  4Y52 I;  1WCM I;  1I3Q I;  2JA8 I;  1WW9 A;  3M3Y I;  1TWA I;  4A3E I;  1X3Z A; 
#chains in the Genus database with same CATH topology
 3CCL Z;  1VQM Z;  4HGY A;  2DE7 A;  2RHB A;  3CCU 1;  3CQZ I;  1NP6 A;  1VQ9 Z;  1K8A 1;  4E2Z A;  2O53 A;  4A3M I;  1PFT A;  2W04 A;  2RPR A;  4DQY B;  3G4S Z;  3GTK I;  3MZK B;  2JA6 I;  3S17 I;  1Q7Y 2;  2JNY A;  2K3R A;  1M1K 1;  3GTQ I;  4NBF A;  1TWC I;  3I56 1;  1VQ4 1;  1YI2 1;  3CPW Y;  2R7Z I;  3FQQ A;  4E32 A;  3VMI A;  1ZB9 A;  1K9M 2;  4QTU A;  1RLY A;  2QKD A;  3CCM Z;  4BY1 I;  3IX0 A;  2QA4 Z;  3F3F C;  2EGT A;  3IR7 A;  4NH1 C;  3GTL I;  2V8K A;  1QXF A;  3CMA Z;  4E30 A;  4RVD A;  5A2Q b;  1VLA A;  2QR1 B;  3H0G I;  3NFZ A;  4BBS I;  2LIY A;  4DK1 A;  2NAP A;  3CCQ Z;  1YUK A;  3J81 b;  1YJN Z;  1L1O C;  4E31 A;  1M90 1;  2VUG A;  2JA5 I;  2Q4Z A;  3GTO I;  1USP B;  4AYB A;  2ZAE B;  2VPX A;  4DGL A;  5T64 A;  3G6E Z;  3HOY I;  4NB9 A;  5IP9 I;  1KQS Y;  4RV9 A;  3HOZ I;  5C44 I;  3CXC Y;  1S72 Z;  3S2D I;  2GTH A;  3CME 1;  2K5R A;  2JUB A;  3CD6 1;  1VQK 1;  3CC7 1;  2PM9 A;  4CL1 A;  1Y1W I;  2VPZ A;  4QTT A;  2VPW A;  1Q81 2;  3CC4 Z;  1TWH I;  3JAM b;  5IT9 f;  1JJ2 Z;  1WW9 A;  1RQF A;  3CCE Z;  3I55 1;  3VTN A;  1Q7Y 1;  2QLV B;  1YJ9 Z;  1YIT 1;  2E2J I;  1VQP Z;  5CM2 M;  3HOX I;  1I6H I;  3PO3 I;  3CCV 1;  1K9M 1;  2QEX 1;  1ML8 A;  5T6B A;  4MD8 A;  4NOZ A;  1USP A;  5C3E I;  2GU2 A;  2DE5 A;  3OW2 Z;  1QVG Z;  1VQ7 1;  1QYP A;  3HOV I;  1DL6 A;  2LFU A;  3CC2 1;  1QF8 A;  1N8R 2;  4BBR I;  1YHQ Z;  3CCR Z;  1VQ6 Z;  2G2K A;  1NUI A;  4MH4 A;  2P3Y A;  1Q86 2;  2GTI A;  3CCS 1;  3CCL 1;  2JIO A;  1YJW Z;  3GTP I;  4NBH A;  2RT9 A;  2Q51 A;  4Y7N I;  2F4M A;  1R9T I;  3F3P C;  3FQM A;  3D6W A;  3G4S 1;  1VQO 1;  1KRL A;  2LEX A;  5D1O B;  1TWF I;  4A3F I;  5T67 A;  3J80 f;  1VQ5 Z;  3D9X A;  3MON A;  1QVF Y;  3CPW Z;  3GTM S;  1KC8 1;  1X0T A;  5FLX f;  4A3L I;  2KPI A;  2NVQ I;  3G71 Z;  3CCM 1;  1Q81 1;  4A3G I;  5IP7 I;  3S14 I;  4E2Y A;  1K73 2;  2RBL A;  3HOW I;  1WZN A;  2F4O A;  3EED A;  4NFR A;  3CMA 1;  1VQN Z;  1Q82 2;  3QWU A;  4E33 A;  2V3V A;  4BXX I;  2YAD A;  1LQL A;  3VMH A;  2NVX I;  4XX2 A;  2IZ4 A;  2JS4 A;  2DE6 A;  1KD1 2;  1RO0 A;  1WCM I;  2JA8 I;  3M3Y I;  3NH5 A;  1X3Z A;  4RS4 A;  1JWH C;  4NBC A;  2YU9 I;  2AYD A;  3IF8 A;  1N8R 1;  4A3C I;  1Z02 A;  5LL6 f;  2QRE B;  3G6E 1;  5C4J I;  2OTJ Z;  1FDO A;  3HOU I;  1K83 I;  1SIW A;  5FLM I;  2VF1 A;  1Z03 A;  1KQS Z;  1TFI A;  3K7A I;  1S72 1;  2PMZ A;  3CXC Z;  2JMO A;  1Q86 1;  3CD6 Z;  2V8J A;  4NBG A;  5A2Q f;  3VB9 A;  3MZL B;  4TNU A;  3CCJ 1;  4EWC A;  3BG0 B;  4A93 I;  1P9N A;  2BJO A;  3U50 C;  2B63 I;  3I4N I;  3CCE 1;  1FDI A;  1W2B Y;  2OTL Z;  2E9H A;  1YJ9 1;  1VQP 1;  2WB1 A;  3M4O I;  1VQ8 Z;  3KIF A;  4S1T A;  5C4X I;  1YIJ Z;  3T4N B;  3P5J B;  2O4H A;  4MON A;  1Z01 A;  3GTG I;  2JIP A;  1X3W A;  3H3V J;  2PK7 A;  4RVF A;  4NB8 A;  3NH8 A;  4E2X A;  3NDJ A;  4HH4 A;  3J80 b;  3CC2 Z;  3J7A 4;  3HKZ A;  1RNI A;  2J6A A;  2VUM I;  2V8I A;  1SFO I;  1VQL Z;  1RO2 A;  1YHQ 1;  2HF1 A;  3RZD I;  4RVG A;  2QRC B;  4NBE A;  2W03 A;  3IFU A;  1VQM 1;  1Q82 1;  3CCR 1;  2H85 A;  3CCU Z;  3D2L A;  3PO2 I;  2M6N A;  2JIR A;  1VQ9 1;  4E2W A;  1KD1 1;  3GTM I;  2JA7 I;  5AN9 F;  1Y1V S;  4A3K I;  2IZ3 A;  4A3J I;  1YJW 1;  1ZH1 A;  3RZO I;  4MRI A;  3I56 Z;  1VQ4 Z;  1YI2 Z;  3NH4 A;  1RO4 A;  2WAQ A;  1VQO Z;  1I50 I;  2Y0S A;  3S1N I;  2E2H I;  1Y8C A;  1VQ5 1;  4Y52 I;  2OOX B;  1QVF Z;  4A3E I;  2V45 A;  2QA4 1;  2RIQ A;  2KI7 B;  4RVH A;  2QRD B;  3G71 1;  2HU9 A;  3TDH B;  3I07 A;  1NJI 2;  4MD9 A;  3CCQ 1;  1N2F A;  5IT9 b;  1VQN 1;  1WJ2 A;  1YJN 1;  1YUA A;  3S1R I;  1K8A 2;  4A3B I;  3ESW A;  2AKL A;  4NBD A;  5D1O A;  2JIM A;  3S2H I;  3NDI A;  1ZB8 A;  2R6M A;  3EER A;  3S1Q I;  4BY7 I;  1M1K 2;  5D1P A;  3FKI I;  3BG1 B;  3CME Z;  3VMG A;  1S7M A;  2E2I I;  3TE5 B;  4HGZ A;  3S15 I;  2OTJ 1;  1VQK Z;  2JR6 A;  2E7Z A;  2R93 I;  2OZK A;  1AA6 A;  3CC7 Z;  3GCF A;  3S1M I;  1WII A;  3I4M I;  3Q87 A;  1KC8 2;  3CC4 1;  3GKQ A;  3J81 f;  1JJ2 Y;  3CCJ Z;  3I55 Z;  2NVT I;  2I3C A;  1YIT Z;  2JIQ A;  2NVY I;  3GTJ I;  4A3I I;  1Q16 A;  3CCV Z;  2QEX Z;  4NBA A;  2R92 I;  2OTL 1;  1W2B Z;  3S16 I;  1TWG I;  2M48 A;  1VQ8 1;  1M90 2;  4MD7 A;  3OW2 Y;  1YIJ 1;  1QVG Y;  4X6A I;  2P28 A;  1VQ7 Z;  1K73 1;  4A3D I;  2VPY A;  5FLX b;  2IV2 X;  1Y1V I;  3LUS A;  4NBB A;  3JAM f;  4MXU A;  1VQ6 1;  3PO3 S;  1NJI 1;  2OOY B;  1I3Q I;  1TWA I;  3KIH A;  1VQL 1;  3CCS Z; 
#chains in the Genus database with same CATH homology
 3CCL Z;  1VQM Z;  4HGY A;  2DE7 A;  2RHB A;  3CCU 1;  3CQZ I;  1NP6 A;  1VQ9 Z;  1K8A 1;  4E2Z A;  2O53 A;  4A3M I;  1PFT A;  2W04 A;  2RPR A;  4DQY B;  3G4S Z;  3GTK I;  3MZK B;  2JA6 I;  3S17 I;  1Q7Y 2;  2JNY A;  2K3R A;  1M1K 1;  3GTQ I;  4NBF A;  1TWC I;  3I56 1;  1VQ4 1;  1YI2 1;  3CPW Y;  2R7Z I;  3FQQ A;  4E32 A;  3VMI A;  1ZB9 A;  1K9M 2;  4QTU A;  1RLY A;  2QKD A;  3CCM Z;  4BY1 I;  3IX0 A;  2QA4 Z;  3F3F C;  2EGT A;  4NH1 C;  3GTL I;  2V8K A;  3CMA Z;  4E30 A;  4RVD A;  2QR1 B;  1VLA A;  5A2Q b;  3H0G I;  3NFZ A;  4BBS I;  2LIY A;  4DK1 A;  3CCQ Z;  1YUK A;  3J81 b;  1YJN Z;  1L1O C;  4E31 A;  1M90 1;  2VUG A;  2JA5 I;  2Q4Z A;  3GTO I;  1USP B;  4AYB A;  2ZAE B;  4DGL A;  5T64 A;  3G6E Z;  3HOY I;  4NB9 A;  5IP9 I;  1KQS Y;  4RV9 A;  3HOZ I;  5C44 I;  3CXC Y;  1S72 Z;  3S2D I;  2GTH A;  3CME 1;  2K5R A;  2JUB A;  3CD6 1;  1VQK 1;  3CC7 1;  2PM9 A;  4CL1 A;  1Y1W I;  4QTT A;  1Q81 2;  3CC4 Z;  1TWH I;  3JAM b;  5IT9 f;  1JJ2 Z;  1WW9 A;  1RQF A;  3CCE Z;  3I55 1;  3VTN A;  1Q7Y 1;  2QLV B;  1YJ9 Z;  1YIT 1;  2E2J I;  1VQP Z;  5CM2 M;  3HOX I;  1I6H I;  3PO3 I;  3CCV 1;  1K9M 1;  2QEX 1;  1ML8 A;  5T6B A;  4MD8 A;  4NOZ A;  1USP A;  5C3E I;  2GU2 A;  2DE5 A;  3OW2 Z;  1QVG Z;  1VQ7 1;  1QYP A;  3HOV I;  1DL6 A;  2LFU A;  3CC2 1;  1QF8 A;  1N8R 2;  4BBR I;  1YHQ Z;  3CCR Z;  1VQ6 Z;  2G2K A;  1NUI A;  4MH4 A;  2P3Y A;  1Q86 2;  2GTI A;  3CCS 1;  3CCL 1;  1YJW Z;  3GTP I;  4NBH A;  2RT9 A;  2Q51 A;  4Y7N I;  2F4M A;  1R9T I;  3F3P C;  3FQM A;  3D6W A;  3G4S 1;  1VQO 1;  1KRL A;  5D1O B;  1TWF I;  4A3F I;  5T67 A;  3J80 f;  1VQ5 Z;  3D9X A;  3MON A;  1QVF Y;  3CPW Z;  3GTM S;  1KC8 1;  1X0T A;  5FLX f;  4A3L I;  2KPI A;  2NVQ I;  3G71 Z;  3CCM 1;  1Q81 1;  4A3G I;  5IP7 I;  3S14 I;  4E2Y A;  1K73 2;  2RBL A;  3HOW I;  2F4O A;  3EED A;  4NFR A;  3CMA 1;  1VQN Z;  1Q82 2;  3QWU A;  4E33 A;  4BXX I;  2YAD A;  1LQL A;  3VMH A;  2NVX I;  4XX2 A;  2IZ4 A;  2JS4 A;  2DE6 A;  1KD1 2;  1RO0 A;  1WCM I;  2JA8 I;  3M3Y I;  3NH5 A;  1X3Z A;  4RS4 A;  1JWH C;  4NBC A;  2YU9 I;  3IF8 A;  1N8R 1;  4A3C I;  1Z02 A;  5LL6 f;  2QRE B;  3G6E 1;  5C4J I;  2OTJ Z;  3HOU I;  1K83 I;  5FLM I;  2VF1 A;  1Z03 A;  1KQS Z;  1TFI A;  3K7A I;  1S72 1;  2PMZ A;  3CXC Z;  2JMO A;  1Q86 1;  3CD6 Z;  2V8J A;  4NBG A;  5A2Q f;  3VB9 A;  3MZL B;  4TNU A;  3CCJ 1;  4EWC A;  3BG0 B;  4A93 I;  1P9N A;  2BJO A;  3U50 C;  2B63 I;  3I4N I;  3CCE 1;  1W2B Y;  2OTL Z;  2E9H A;  1YJ9 1;  1VQP 1;  2WB1 A;  3M4O I;  1VQ8 Z;  3KIF A;  4S1T A;  5C4X I;  1YIJ Z;  3T4N B;  3P5J B;  2O4H A;  4MON A;  1Z01 A;  3GTG I;  1X3W A;  3H3V J;  2PK7 A;  4RVF A;  4NB8 A;  3NH8 A;  4E2X A;  3NDJ A;  4HH4 A;  3J80 b;  3CC2 Z;  3J7A 4;  3HKZ A;  1RNI A;  2J6A A;  2VUM I;  2V8I A;  1SFO I;  1VQL Z;  1RO2 A;  1YHQ 1;  2HF1 A;  3RZD I;  4RVG A;  2QRC B;  4NBE A;  2W03 A;  3IFU A;  1VQM 1;  1Q82 1;  3CCR 1;  2H85 A;  3CCU Z;  3PO2 I;  2M6N A;  1VQ9 1;  4E2W A;  1KD1 1;  3GTM I;  2JA7 I;  5AN9 F;  1Y1V S;  4A3K I;  2IZ3 A;  4A3J I;  1YJW 1;  1ZH1 A;  3RZO I;  4MRI A;  3I56 Z;  1VQ4 Z;  1YI2 Z;  3NH4 A;  1RO4 A;  2WAQ A;  1VQO Z;  1I50 I;  2Y0S A;  3S1N I;  2E2H I;  1VQ5 1;  4Y52 I;  2OOX B;  1QVF Z;  4A3E I;  2QA4 1;  2RIQ A;  2KI7 B;  4RVH A;  2QRD B;  3G71 1;  2HU9 A;  3TDH B;  3I07 A;  1NJI 2;  4MD9 A;  3CCQ 1;  1N2F A;  5IT9 b;  1VQN 1;  1YJN 1;  1YUA A;  3S1R I;  1K8A 2;  4A3B I;  3ESW A;  2AKL A;  4NBD A;  5D1O A;  3S2H I;  3NDI A;  1ZB8 A;  2R6M A;  3EER A;  3S1Q I;  4BY7 I;  1M1K 2;  5D1P A;  3FKI I;  3BG1 B;  3CME Z;  3VMG A;  1S7M A;  2E2I I;  3TE5 B;  4HGZ A;  3S15 I;  2OTJ 1;  1VQK Z;  2JR6 A;  2R93 I;  2OZK A;  3CC7 Z;  3GCF A;  3S1M I;  1WII A;  3I4M I;  3Q87 A;  1KC8 2;  3CC4 1;  3GKQ A;  3J81 f;  1JJ2 Y;  3CCJ Z;  3I55 Z;  2NVT I;  2I3C A;  1YIT Z;  2NVY I;  3GTJ I;  4A3I I;  3CCV Z;  2QEX Z;  4NBA A;  2R92 I;  2OTL 1;  1W2B Z;  3S16 I;  1TWG I;  2M48 A;  1VQ8 1;  1M90 2;  4MD7 A;  3OW2 Y;  1YIJ 1;  1QVG Y;  4X6A I;  2P28 A;  1VQ7 Z;  1K73 1;  4A3D I;  5FLX b;  1Y1V I;  3LUS A;  4NBB A;  3JAM f;  4MXU A;  1VQ6 1;  3PO3 S;  1NJI 1;  2OOY B;  1I3Q I;  1TWA I;  3KIH A;  1VQL 1;  3CCS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...