5IP7I

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I02
2K5RA 1TWCI 2R92I 1Y1VI 2JNYA 2F4MA 3GTKI 1TWHI 4A3LI 2PK7A 1RO4A 3GTGI 2R7ZI 2NVXI 3M4OI 3S1RI 1TFIA 2E2HI 3H0GI 2R93I 3H3VJ 3HOVI 2P3YA 4A93I 2JA7I 2JA5I 3D6WA 4NBDA 3HOYI 4NB8A 2DE5A 3VMHA 2RBLA 4A3KI 2J6AA 1WW9A 1WCMI 3Q87A 1VLAA 1PFTA 3EERA 3GCFA 1K83I 1I3QI 4NBFA 4Y52I 1ML8A 1TWGI 2F4OA 4A3JI 3S1QI 3GTPI 4NBBA 3K7AI 5C44I 3GTJI 4QTUA 3I4MI 3PO2I 3RZOI 4BBRI 4XX2A 3S14I 3FKII 3S2HI 3S15I 2JS4A 3M3YI 1Y1VS 3I4NI 1X3WA 3GTLI 1QYPA 3S1MI 4Y7NI 1NUIA 1Y1WI 1YUAA 3HOZI 2B63I 2NVYI 5CM2M 3VMGA 3GTMI 2JR6A 2YU9I 3HOUI 4NB9A 3GTOI 2JA8I 4A3II 3S2DI 3GTQI 3S16I 3GKQA 2JA6I 2BJOA 4NBEA 4A3FI 5FLMI 3VMIA 4NBHA 3PO3I 4X6AI 4BY7I 3I07A 1LQLA 5C4XI 1X3ZA 3GTMS 3LUSA 2VUMI 5C4JI 3VB9A 3S1NI 3CQZI 4NBCA 2DE7A 1SFOI 1USPA 1N2FA 1ZB9A 2KPIA 3HOXI 1ZB8A 2AKLA 1DL6A 4BBSI 2HF1A 3RZDI 2DE6A 4A3BI 1TWFI 1R9TI 2E2JI 4A3DI 3PO3S 4A3MI 4NBAA 4NBGA 2NVQI 1I6HI 1USPB 3ESWA 4MH4A 4BXXI 5IP7I 4NOZA 4QTTA 1I50I 4A3GI 5IP9I 3HOWI 3U50C 5C3EI 4A3CI 1RLYA 1TWAI 4A3EI 2E2II 3S17I 2NVTI 1L1OC 4BY1I
chains in the Genus database with same CATH superfamily
1WZNA 1Y1VI 2R92I 1FDIA 2Q51A 3GTGI 2R6MA 2E2HI 1TFIA 3H0GI 1KD11 3TE5B 4A93I 2JA7I 3HOYI 4MXUA 1S721 2PM9A 4NB8A 2QEX1 2H85A 1Z03A 3NDJA 2DE5A 4E2ZA 3HKZA 1WCMI 3CCL1 2AYDA 3EERA 4E2WA 1KC82 2F4OA 3CCRZ 4NH1C 3GTPI 3J80b 4DGLA 4NBBA 3NFZA 3CMA1 2PMZA 3GTJI 1AA6A 4XX2A 3FKII 2RIQA 1Y1VS 5D1PA 4EWCA 2NAPA 4RV9A 1NUIA 3HOZI 2QLVB 3HOUI 2OZKA 2LEXA 1N8R2 3GTOI 1S72Z 3GTQI 2QEXZ 4A3FI 1KQSZ 4RS4A 5FLMI 2LIYA 4NBHA 1M902 3IX0A 3GTMS 3BG0B 3CCLZ 5C4JI 3J81f 3CXCY 3CQZI 1WJ2A 1ZB8A 2AKLA 4BBSI 2HF1A 3RZDI 4A3BI 1TWFI 5T64A 4A3DI 3PO3S 1VQK1 2WB1A 3CPWY 2I3CA 2JUBA 3JAMb 1USPB 3ESWA 4MH4A 5IP7I 2V3VA 5IP9I 2QREB 3U50C 5C3EI 1N8R1 1RO2A 1TWAI 4A3EI 3IF8A 1RO0A 2K5RA 2RHBA 2OOYB 1TWCI 3D9XA 1M901 4A3LI 1RO4A 3CCE1 2R7ZI 3S1RI 3H3VJ 3CC71 1Q812 3HOVI 2VUGA 2JA5I 1QXFA 1YI21 2J6AA 3OW2Z 3T4NB 1VQKZ 2JIMA 3CCS1 1WW9A 2Q4ZA 1YUKA 3I551 2G2KA 1JJ2Y 1TWGI 1NJI2 1YJN1 2YADA 4E31A 5C44I 1YHQ1 3PO2I 3RZOI 4BBRI 2JS4A 3I4NI 3GTLI 1Y8CA 3CC41 3CCEZ 1Y1WI 2E9HA 2VPYA 2RPRA 1Q811 2B63I 2NVYI 2Y0SA 5CM2M 3J80f 3CC7Z 3GTMI 2JR6A 2V8JA 4MD9A 4A3II 1YI2Z 3S16I 1RQFA 3G711 3CXCZ 2JA6I 1Q822 2JMOA 3VTNA 3VMIA 1Z01A 3G6E1 3QWUA 3CCSZ 3PO3I 2OTL1 3I07A 5A2Qb 1X3ZA 3IFUA 3CCQ1 3I55Z 2QRCB 2M48A 2V8IA 1NJI1 1DL6A 3FQMA 1YJNZ 4RVFA 1VQ61 1R9TI 2E2JI 1YHQZ 2E7ZA 4A3MI 2OOXB 4NBAA 4NBGA 2NVQI 2OTJ1 2M6NA 4E2XA 3CC4Z 4QTTA 1YIT1 3HOWI 3MZKB 2IZ4A 3S17I 3FQQA 3NDIA 2W03A 4BY1I 1Q821 5D1OB 1K731 3JAMf 4CL1A 3GTKI 1Q16A 3G71Z 1RNIA 2NVXI 3EEDA 3M4OI 3G6EZ 2OTLZ 2R93I 2QR1B 2JIPA 3CCQZ 3CCV1 3D6WA 4NBDA 1Q7Y2 4A3KI 3VMHA 2GU2A 1QVFY 3D2LA 1VQ6Z 3BG1B 3TDHB 5FLXb 4TNUA 1JJ2Z 2OTJZ 1S7MA 3Q87A 1PFTA 3GCFA 1K83I 3NH4A 4NBFA 1ML8A 3S1QI 4A3JI 4E30A 1YITZ 2V8KA 3S2HI 3S15I 3CCM1 1X3WA 3S1MI 2RT9A 4HH4A 4Y7NI 1W2BY 4HGYA 1YUAA 4RVHA 1Q7Y1 3CCVZ 1VQ71 1SIWA 1VQL1 4NB9A 4AYBA 1YJW1 2JA8I 3P5JB 2BJOA 2JIRA 4MRIA 4BY7I 2EGTA 1LQLA 4MONA 3LUSA 1X0TA 3IR7A 2IZ3A 1VQ41 4NBCA 1SFOI 1M1K1 1USPA 1ZB9A 3HOXI 2GTIA 2ZAEB 2DE6A 2IV2X 3F3FC 1VQ81 5IT9b 1I6HI 4RVDA 2GTHA 5A2Qf 3CCMZ 3J7A4 4BXXI 3NH5A 1K732 3NH8A 1VQO1 1YIJ1 2JIOA 4NFRA 3G4SZ 1I50I 3CC21 4A3GI 1KRLA 1VQ7Z 1QVGY 2LFUA 1VQLZ 1YJWZ 1NP6A 1VQN1 3CPWZ 2QRDB 2JNYA 2F4MA 3CD61 1TWHI 3OW2Y 2PK7A 2WAQA 2O53A 1VQ91 4RVGA 4E33A 1QVFZ 1K9M1 2O4HA 1YJ91 1Q862 2P3YA 1VQ4Z 3CCJ1 1K8A2 5T67A 3MONA 2RBLA 3MZLB 3CME1 1VQ8Z 3I561 4DQYB 3CCU1 1VLAA 2QKDA 2QA41 1I3QI 4Y52I 1VQOZ 2VPZA 1YIJZ 2K3RA 3CC2Z 2VF1A 1P9NA 3K7AI 1W2BZ 3KIHA 4QTUA 3I4MI 1VQM1 5FLXf 3S14I 1VQNZ 1VQ51 1KC81 3M3YI 1QYPA 3CD6Z 3KIFA 2W04A 1VQ9Z 1Q861 5LL6f 5AN9F 3VMGA 3J81b 1K8A1 2KI7B 3CMAZ 2YU9I 1YJ9Z 3CCJZ 4S1TA 1VQP1 2P28A 1JWHC 4DK1A 3S2DI 1M1K2 3GKQA 2V45A 4NBEA 3CMEZ 4E2YA 3F3PC 3I56Z 4X6AI 2VPWA 4E32A 5C4XI 5T6BA 3CCUZ 2VUMI 3VB9A 3S1NI 1KD12 2QA4Z 1FDOA 1KQSY 2DE7A 1N2FA 1ZH1A 4HGZA 2KPIA 2HU9A 4MD7A 3G4S1 2JIQA 4MD8A 1VQMZ 1VQ5Z 5D1OA 1QVGZ 1WIIA 4NOZA 3CCR1 1QF8A 4A3CI 1RLYA 2E2II 2NVTI 1L1OC 5IT9f 1Z02A 2VPXA 1VQPZ 1K9M2
chains in the Genus database with same CATH topology
2R92I 1Y1VI 2Q51A 3GTGI 2R6MA 2E2HI 1TFIA 3H0GI 1KD11 3TE5B 4A93I 2JA7I 3HOYI 4MXUA 1S721 2PM9A 4NB8A 2QEX1 2H85A 1Z03A 3NDJA 2DE5A 4E2ZA 3HKZA 1WCMI 3CCL1 3EERA 4E2WA 1KC82 2F4OA 3CCRZ 4NH1C 3GTPI 3J80b 4DGLA 4NBBA 3NFZA 3CMA1 2PMZA 3GTJI 4XX2A 3FKII 2RIQA 1Y1VS 5D1PA 4EWCA 4RV9A 1NUIA 3HOZI 2QLVB 3HOUI 2OZKA 1N8R2 3GTOI 1S72Z 3GTQI 2QEXZ 4A3FI 1KQSZ 4RS4A 5FLMI 2LIYA 4NBHA 1M902 3IX0A 3GTMS 3BG0B 3CCLZ 5C4JI 3J81f 3CXCY 3CQZI 1ZB8A 2AKLA 4BBSI 2HF1A 3RZDI 4A3BI 1TWFI 5T64A 4A3DI 3PO3S 1VQK1 2WB1A 3CPWY 2I3CA 2JUBA 3JAMb 1USPB 3ESWA 4MH4A 5IP7I 5IP9I 2QREB 3U50C 5C3EI 1N8R1 1RO2A 1TWAI 4A3EI 3IF8A 1RO0A 2K5RA 2RHBA 2OOYB 1TWCI 3D9XA 1M901 4A3LI 1RO4A 3CCE1 2R7ZI 3S1RI 3H3VJ 3CC71 1Q812 3HOVI 2VUGA 2JA5I 1YI21 2J6AA 3OW2Z 3T4NB 1VQKZ 3CCS1 1WW9A 2Q4ZA 1YUKA 3I551 2G2KA 1JJ2Y 1TWGI 1NJI2 1YJN1 2YADA 4E31A 5C44I 1YHQ1 3PO2I 3RZOI 4BBRI 2JS4A 3I4NI 3GTLI 3CC41 3CCEZ 1Y1WI 2E9HA 2B63I 2RPRA 1Q811 2NVYI 2Y0SA 5CM2M 3J80f 3CC7Z 3GTMI 2JR6A 2V8JA 4MD9A 4A3II 1YI2Z 3S16I 1RQFA 3G711 3CXCZ 2JA6I 1Q822 2JMOA 3VTNA 3VMIA 1Z01A 3G6E1 3QWUA 3CCSZ 3PO3I 2OTL1 3I07A 5A2Qb 1X3ZA 3IFUA 3CCQ1 3I55Z 2QRCB 2M48A 2V8IA 1NJI1 1DL6A 3FQMA 1YJNZ 4RVFA 1VQ61 1R9TI 2E2JI 1YHQZ 4A3MI 2OOXB 4NBAA 4NBGA 2NVQI 2OTJ1 2M6NA 4E2XA 3CC4Z 4QTTA 1YIT1 3HOWI 3MZKB 2IZ4A 3S17I 3FQQA 3NDIA 2W03A 4BY1I 1Q821 5D1OB 1K731 3JAMf 4CL1A 3GTKI 3G71Z 1RNIA 2NVXI 3EEDA 3M4OI 3G6EZ 2OTLZ 2R93I 2QR1B 3CCQZ 3CCV1 3D6WA 4NBDA 1Q7Y2 4A3KI 3VMHA 2GU2A 1QVFY 1VQ6Z 3BG1B 3TDHB 5FLXb 4TNUA 1JJ2Z 2OTJZ 1S7MA 3Q87A 1PFTA 3GCFA 1K83I 3NH4A 4NBFA 1ML8A 3S1QI 4A3JI 4E30A 1YITZ 2V8KA 3S2HI 3S15I 3CCM1 1X3WA 3S1MI 2RT9A 4HH4A 4Y7NI 1W2BY 4HGYA 1YUAA 4RVHA 1Q7Y1 3CCVZ 1VQ71 1VQL1 4NB9A 4AYBA 1YJW1 2JA8I 3P5JB 2BJOA 4MRIA 4BY7I 2EGTA 1LQLA 4MONA 3LUSA 1X0TA 2IZ3A 1VQ41 4NBCA 1SFOI 1M1K1 1USPA 1ZB9A 3HOXI 2GTIA 2ZAEB 2DE6A 3F3FC 1VQ81 5IT9b 1I6HI 4RVDA 2GTHA 5A2Qf 3CCMZ 3J7A4 4BXXI 3NH5A 1K732 3NH8A 1VQO1 1YIJ1 4NFRA 3G4SZ 1I50I 3CC21 4A3GI 1KRLA 1VQ7Z 1QVGY 2LFUA 1VQLZ 1YJWZ 1NP6A 1VQN1 3CPWZ 2QRDB 2JNYA 2F4MA 3CD61 1TWHI 3OW2Y 2PK7A 2WAQA 2O53A 1VQ91 4RVGA 4E33A 1QVFZ 1K9M1 2O4HA 1YJ91 1Q862 2P3YA 1VQ4Z 3CCJ1 1K8A2 5T67A 3MONA 2RBLA 3MZLB 3CME1 1VQ8Z 3I561 4DQYB 3CCU1 1VLAA 2QKDA 2QA41 1I3QI 4Y52I 1VQOZ 1YIJZ 2K3RA 3CC2Z 2VF1A 1P9NA 3K7AI 1W2BZ 3KIHA 4QTUA 3I4MI 1VQM1 5FLXf 3S14I 1VQNZ 1VQ51 1KC81 3M3YI 1QYPA 3CD6Z 3KIFA 2W04A 1VQ9Z 1Q861 5LL6f 5AN9F 3VMGA 3J81b 1K8A1 2KI7B 3CMAZ 2YU9I 1YJ9Z 3CCJZ 4S1TA 1VQP1 2P28A 1JWHC 4DK1A 3S2DI 1M1K2 3GKQA 4NBEA 3CMEZ 4E2YA 3F3PC 3I56Z 4X6AI 4E32A 5C4XI 5T6BA 3CCUZ 2VUMI 3VB9A 3S1NI 1KD12 2QA4Z 1KQSY 2DE7A 1N2FA 1ZH1A 4HGZA 2KPIA 2HU9A 4MD7A 3G4S1 4MD8A 1VQMZ 1VQ5Z 5D1OA 1QVGZ 1WIIA 4NOZA 3CCR1 1QF8A 4A3CI 1RLYA 2E2II 2NVTI 1L1OC 5IT9f 1Z02A 1VQPZ 1K9M2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5R A;  1TWC I;  2R92 I;  1Y1V I;  2JNY A;  2F4M A;  3GTK I;  1TWH I;  4A3L I;  2PK7 A;  1RO4 A;  3GTG I;  2R7Z I;  2NVX I;  3M4O I;  3S1R I;  1TFI A;  2E2H I;  3H0G I;  2R93 I;  3H3V J;  3HOV I;  2P3Y A;  4A93 I;  2JA7 I;  2JA5 I;  3D6W A;  4NBD A;  3HOY I;  4NB8 A;  2DE5 A;  3VMH A;  2RBL A;  4A3K I;  2J6A A;  1WW9 A;  1WCM I;  3Q87 A;  1VLA A;  1PFT A;  3EER A;  3GCF A;  1K83 I;  1I3Q I;  4NBF A;  4Y52 I;  1ML8 A;  1TWG I;  2F4O A;  4A3J I;  3S1Q I;  3GTP I;  4NBB A;  3K7A I;  5C44 I;  3GTJ I;  4QTU A;  3I4M I;  3PO2 I;  3RZO I;  4BBR I;  4XX2 A;  3S14 I;  3FKI I;  3S2H I;  3S15 I;  2JS4 A;  3M3Y I;  1Y1V S;  3I4N I;  1X3W A;  3GTL I;  1QYP A;  3S1M I;  4Y7N I;  1NUI A;  1Y1W I;  1YUA A;  3HOZ I;  2B63 I;  2NVY I;  5CM2 M;  3VMG A;  3GTM I;  2JR6 A;  2YU9 I;  3HOU I;  4NB9 A;  3GTO I;  2JA8 I;  4A3I I;  3S2D I;  3GTQ I;  3S16 I;  3GKQ A;  2JA6 I;  2BJO A;  4NBE A;  4A3F I;  5FLM I;  3VMI A;  4NBH A;  3PO3 I;  4X6A I;  4BY7 I;  3I07 A;  1LQL A;  5C4X I;  1X3Z A;  3GTM S;  3LUS A;  2VUM I;  5C4J I;  3VB9 A;  3S1N I;  3CQZ I;  4NBC A;  2DE7 A;  1SFO I;  1USP A;  1N2F A;  1ZB9 A;  2KPI A;  3HOX I;  1ZB8 A;  2AKL A;  1DL6 A;  4BBS I;  2HF1 A;  3RZD I;  2DE6 A;  4A3B I;  1TWF I;  1R9T I;  2E2J I;  4A3D I;  3PO3 S;  4A3M I;  4NBA A;  4NBG A;  2NVQ I;  1I6H I;  1USP B;  3ESW A;  4MH4 A;  4BXX I;  5IP7 I;  4NOZ A;  4QTT A;  1I50 I;  4A3G I;  5IP9 I;  3HOW I;  3U50 C;  5C3E I;  4A3C I;  1RLY A;  1TWA I;  4A3E I;  2E2I I;  3S17 I;  2NVT I;  1L1O C;  4BY1 I; 
#chains in the Genus database with same CATH topology
 1WZN A;  1Y1V I;  2R92 I;  1FDI A;  2Q51 A;  3GTG I;  2R6M A;  2E2H I;  1TFI A;  3H0G I;  1KD1 1;  3TE5 B;  4A93 I;  2JA7 I;  3HOY I;  4MXU A;  1S72 1;  2PM9 A;  4NB8 A;  2QEX 1;  2H85 A;  1Z03 A;  3NDJ A;  2DE5 A;  4E2Z A;  3HKZ A;  1WCM I;  3CCL 1;  2AYD A;  3EER A;  4E2W A;  1KC8 2;  2F4O A;  3CCR Z;  4NH1 C;  3GTP I;  3J80 b;  4DGL A;  4NBB A;  3NFZ A;  3CMA 1;  2PMZ A;  3GTJ I;  1AA6 A;  4XX2 A;  3FKI I;  2RIQ A;  1Y1V S;  5D1P A;  4EWC A;  2NAP A;  4RV9 A;  1NUI A;  3HOZ I;  2QLV B;  3HOU I;  2OZK A;  2LEX A;  1N8R 2;  3GTO I;  1S72 Z;  3GTQ I;  2QEX Z;  4A3F I;  1KQS Z;  4RS4 A;  5FLM I;  2LIY A;  4NBH A;  1M90 2;  3IX0 A;  3GTM S;  3BG0 B;  3CCL Z;  5C4J I;  3J81 f;  3CXC Y;  3CQZ I;  1WJ2 A;  1ZB8 A;  2AKL A;  4BBS I;  2HF1 A;  3RZD I;  4A3B I;  1TWF I;  5T64 A;  4A3D I;  3PO3 S;  1VQK 1;  2WB1 A;  3CPW Y;  2I3C A;  2JUB A;  3JAM b;  1USP B;  3ESW A;  4MH4 A;  5IP7 I;  2V3V A;  5IP9 I;  2QRE B;  3U50 C;  5C3E I;  1N8R 1;  1RO2 A;  1TWA I;  4A3E I;  3IF8 A;  1RO0 A;  2K5R A;  2RHB A;  2OOY B;  1TWC I;  3D9X A;  1M90 1;  4A3L I;  1RO4 A;  3CCE 1;  2R7Z I;  3S1R I;  3H3V J;  3CC7 1;  1Q81 2;  3HOV I;  2VUG A;  2JA5 I;  1QXF A;  1YI2 1;  2J6A A;  3OW2 Z;  3T4N B;  1VQK Z;  2JIM A;  3CCS 1;  1WW9 A;  2Q4Z A;  1YUK A;  3I55 1;  2G2K A;  1JJ2 Y;  1TWG I;  1NJI 2;  1YJN 1;  2YAD A;  4E31 A;  5C44 I;  1YHQ 1;  3PO2 I;  3RZO I;  4BBR I;  2JS4 A;  3I4N I;  3GTL I;  1Y8C A;  3CC4 1;  3CCE Z;  1Y1W I;  2E9H A;  2VPY A;  2RPR A;  1Q81 1;  2B63 I;  2NVY I;  2Y0S A;  5CM2 M;  3J80 f;  3CC7 Z;  3GTM I;  2JR6 A;  2V8J A;  4MD9 A;  4A3I I;  1YI2 Z;  3S16 I;  1RQF A;  3G71 1;  3CXC Z;  2JA6 I;  1Q82 2;  2JMO A;  3VTN A;  3VMI A;  1Z01 A;  3G6E 1;  3QWU A;  3CCS Z;  3PO3 I;  2OTL 1;  3I07 A;  5A2Q b;  1X3Z A;  3IFU A;  3CCQ 1;  3I55 Z;  2QRC B;  2M48 A;  2V8I A;  1NJI 1;  1DL6 A;  3FQM A;  1YJN Z;  4RVF A;  1VQ6 1;  1R9T I;  2E2J I;  1YHQ Z;  2E7Z A;  4A3M I;  2OOX B;  4NBA A;  4NBG A;  2NVQ I;  2OTJ 1;  2M6N A;  4E2X A;  3CC4 Z;  4QTT A;  1YIT 1;  3HOW I;  3MZK B;  2IZ4 A;  3S17 I;  3FQQ A;  3NDI A;  2W03 A;  4BY1 I;  1Q82 1;  5D1O B;  1K73 1;  3JAM f;  4CL1 A;  3GTK I;  1Q16 A;  3G71 Z;  1RNI A;  2NVX I;  3EED A;  3M4O I;  3G6E Z;  2OTL Z;  2R93 I;  2QR1 B;  2JIP A;  3CCQ Z;  3CCV 1;  3D6W A;  4NBD A;  1Q7Y 2;  4A3K I;  3VMH A;  2GU2 A;  1QVF Y;  3D2L A;  1VQ6 Z;  3BG1 B;  3TDH B;  5FLX b;  4TNU A;  1JJ2 Z;  2OTJ Z;  1S7M A;  3Q87 A;  1PFT A;  3GCF A;  1K83 I;  3NH4 A;  4NBF A;  1ML8 A;  3S1Q I;  4A3J I;  4E30 A;  1YIT Z;  2V8K A;  3S2H I;  3S15 I;  3CCM 1;  1X3W A;  3S1M I;  2RT9 A;  4HH4 A;  4Y7N I;  1W2B Y;  4HGY A;  1YUA A;  4RVH A;  1Q7Y 1;  3CCV Z;  1VQ7 1;  1SIW A;  1VQL 1;  4NB9 A;  4AYB A;  1YJW 1;  2JA8 I;  3P5J B;  2BJO A;  2JIR A;  4MRI A;  4BY7 I;  2EGT A;  1LQL A;  4MON A;  3LUS A;  1X0T A;  3IR7 A;  2IZ3 A;  1VQ4 1;  4NBC A;  1SFO I;  1M1K 1;  1USP A;  1ZB9 A;  3HOX I;  2GTI A;  2ZAE B;  2DE6 A;  2IV2 X;  3F3F C;  1VQ8 1;  5IT9 b;  1I6H I;  4RVD A;  2GTH A;  5A2Q f;  3CCM Z;  3J7A 4;  4BXX I;  3NH5 A;  1K73 2;  3NH8 A;  1VQO 1;  1YIJ 1;  2JIO A;  4NFR A;  3G4S Z;  1I50 I;  3CC2 1;  4A3G I;  1KRL A;  1VQ7 Z;  1QVG Y;  2LFU A;  1VQL Z;  1YJW Z;  1NP6 A;  1VQN 1;  3CPW Z;  2QRD B;  2JNY A;  2F4M A;  3CD6 1;  1TWH I;  3OW2 Y;  2PK7 A;  2WAQ A;  2O53 A;  1VQ9 1;  4RVG A;  4E33 A;  1QVF Z;  1K9M 1;  2O4H A;  1YJ9 1;  1Q86 2;  2P3Y A;  1VQ4 Z;  3CCJ 1;  1K8A 2;  5T67 A;  3MON A;  2RBL A;  3MZL B;  3CME 1;  1VQ8 Z;  3I56 1;  4DQY B;  3CCU 1;  1VLA A;  2QKD A;  2QA4 1;  1I3Q I;  4Y52 I;  1VQO Z;  2VPZ A;  1YIJ Z;  2K3R A;  3CC2 Z;  2VF1 A;  1P9N A;  3K7A I;  1W2B Z;  3KIH A;  4QTU A;  3I4M I;  1VQM 1;  5FLX f;  3S14 I;  1VQN Z;  1VQ5 1;  1KC8 1;  3M3Y I;  1QYP A;  3CD6 Z;  3KIF A;  2W04 A;  1VQ9 Z;  1Q86 1;  5LL6 f;  5AN9 F;  3VMG A;  3J81 b;  1K8A 1;  2KI7 B;  3CMA Z;  2YU9 I;  1YJ9 Z;  3CCJ Z;  4S1T A;  1VQP 1;  2P28 A;  1JWH C;  4DK1 A;  3S2D I;  1M1K 2;  3GKQ A;  2V45 A;  4NBE A;  3CME Z;  4E2Y A;  3F3P C;  3I56 Z;  4X6A I;  2VPW A;  4E32 A;  5C4X I;  5T6B A;  3CCU Z;  2VUM I;  3VB9 A;  3S1N I;  1KD1 2;  2QA4 Z;  1FDO A;  1KQS Y;  2DE7 A;  1N2F A;  1ZH1 A;  4HGZ A;  2KPI A;  2HU9 A;  4MD7 A;  3G4S 1;  2JIQ A;  4MD8 A;  1VQM Z;  1VQ5 Z;  5D1O A;  1QVG Z;  1WII A;  4NOZ A;  3CCR 1;  1QF8 A;  4A3C I;  1RLY A;  2E2I I;  2NVT I;  1L1O C;  5IT9 f;  1Z02 A;  2VPX A;  1VQP Z;  1K9M 2; 
#chains in the Genus database with same CATH homology
 2R92 I;  1Y1V I;  2Q51 A;  3GTG I;  2R6M A;  2E2H I;  1TFI A;  3H0G I;  1KD1 1;  3TE5 B;  4A93 I;  2JA7 I;  3HOY I;  4MXU A;  1S72 1;  2PM9 A;  4NB8 A;  2QEX 1;  2H85 A;  1Z03 A;  3NDJ A;  2DE5 A;  4E2Z A;  3HKZ A;  1WCM I;  3CCL 1;  3EER A;  4E2W A;  1KC8 2;  2F4O A;  3CCR Z;  4NH1 C;  3GTP I;  3J80 b;  4DGL A;  4NBB A;  3NFZ A;  3CMA 1;  2PMZ A;  3GTJ I;  4XX2 A;  3FKI I;  2RIQ A;  1Y1V S;  5D1P A;  4EWC A;  4RV9 A;  1NUI A;  3HOZ I;  2QLV B;  3HOU I;  2OZK A;  1N8R 2;  3GTO I;  1S72 Z;  3GTQ I;  2QEX Z;  4A3F I;  1KQS Z;  4RS4 A;  5FLM I;  2LIY A;  4NBH A;  1M90 2;  3IX0 A;  3GTM S;  3BG0 B;  3CCL Z;  5C4J I;  3J81 f;  3CXC Y;  3CQZ I;  1ZB8 A;  2AKL A;  4BBS I;  2HF1 A;  3RZD I;  4A3B I;  1TWF I;  5T64 A;  4A3D I;  3PO3 S;  1VQK 1;  2WB1 A;  3CPW Y;  2I3C A;  2JUB A;  3JAM b;  1USP B;  3ESW A;  4MH4 A;  5IP7 I;  5IP9 I;  2QRE B;  3U50 C;  5C3E I;  1N8R 1;  1RO2 A;  1TWA I;  4A3E I;  3IF8 A;  1RO0 A;  2K5R A;  2RHB A;  2OOY B;  1TWC I;  3D9X A;  1M90 1;  4A3L I;  1RO4 A;  3CCE 1;  2R7Z I;  3S1R I;  3H3V J;  3CC7 1;  1Q81 2;  3HOV I;  2VUG A;  2JA5 I;  1YI2 1;  2J6A A;  3OW2 Z;  3T4N B;  1VQK Z;  3CCS 1;  1WW9 A;  2Q4Z A;  1YUK A;  3I55 1;  2G2K A;  1JJ2 Y;  1TWG I;  1NJI 2;  1YJN 1;  2YAD A;  4E31 A;  5C44 I;  1YHQ 1;  3PO2 I;  3RZO I;  4BBR I;  2JS4 A;  3I4N I;  3GTL I;  3CC4 1;  3CCE Z;  1Y1W I;  2E9H A;  2B63 I;  2RPR A;  1Q81 1;  2NVY I;  2Y0S A;  5CM2 M;  3J80 f;  3CC7 Z;  3GTM I;  2JR6 A;  2V8J A;  4MD9 A;  4A3I I;  1YI2 Z;  3S16 I;  1RQF A;  3G71 1;  3CXC Z;  2JA6 I;  1Q82 2;  2JMO A;  3VTN A;  3VMI A;  1Z01 A;  3G6E 1;  3QWU A;  3CCS Z;  3PO3 I;  2OTL 1;  3I07 A;  5A2Q b;  1X3Z A;  3IFU A;  3CCQ 1;  3I55 Z;  2QRC B;  2M48 A;  2V8I A;  1NJI 1;  1DL6 A;  3FQM A;  1YJN Z;  4RVF A;  1VQ6 1;  1R9T I;  2E2J I;  1YHQ Z;  4A3M I;  2OOX B;  4NBA A;  4NBG A;  2NVQ I;  2OTJ 1;  2M6N A;  4E2X A;  3CC4 Z;  4QTT A;  1YIT 1;  3HOW I;  3MZK B;  2IZ4 A;  3S17 I;  3FQQ A;  3NDI A;  2W03 A;  4BY1 I;  1Q82 1;  5D1O B;  1K73 1;  3JAM f;  4CL1 A;  3GTK I;  3G71 Z;  1RNI A;  2NVX I;  3EED A;  3M4O I;  3G6E Z;  2OTL Z;  2R93 I;  2QR1 B;  3CCQ Z;  3CCV 1;  3D6W A;  4NBD A;  1Q7Y 2;  4A3K I;  3VMH A;  2GU2 A;  1QVF Y;  1VQ6 Z;  3BG1 B;  3TDH B;  5FLX b;  4TNU A;  1JJ2 Z;  2OTJ Z;  1S7M A;  3Q87 A;  1PFT A;  3GCF A;  1K83 I;  3NH4 A;  4NBF A;  1ML8 A;  3S1Q I;  4A3J I;  4E30 A;  1YIT Z;  2V8K A;  3S2H I;  3S15 I;  3CCM 1;  1X3W A;  3S1M I;  2RT9 A;  4HH4 A;  4Y7N I;  1W2B Y;  4HGY A;  1YUA A;  4RVH A;  1Q7Y 1;  3CCV Z;  1VQ7 1;  1VQL 1;  4NB9 A;  4AYB A;  1YJW 1;  2JA8 I;  3P5J B;  2BJO A;  4MRI A;  4BY7 I;  2EGT A;  1LQL A;  4MON A;  3LUS A;  1X0T A;  2IZ3 A;  1VQ4 1;  4NBC A;  1SFO I;  1M1K 1;  1USP A;  1ZB9 A;  3HOX I;  2GTI A;  2ZAE B;  2DE6 A;  3F3F C;  1VQ8 1;  5IT9 b;  1I6H I;  4RVD A;  2GTH A;  5A2Q f;  3CCM Z;  3J7A 4;  4BXX I;  3NH5 A;  1K73 2;  3NH8 A;  1VQO 1;  1YIJ 1;  4NFR A;  3G4S Z;  1I50 I;  3CC2 1;  4A3G I;  1KRL A;  1VQ7 Z;  1QVG Y;  2LFU A;  1VQL Z;  1YJW Z;  1NP6 A;  1VQN 1;  3CPW Z;  2QRD B;  2JNY A;  2F4M A;  3CD6 1;  1TWH I;  3OW2 Y;  2PK7 A;  2WAQ A;  2O53 A;  1VQ9 1;  4RVG A;  4E33 A;  1QVF Z;  1K9M 1;  2O4H A;  1YJ9 1;  1Q86 2;  2P3Y A;  1VQ4 Z;  3CCJ 1;  1K8A 2;  5T67 A;  3MON A;  2RBL A;  3MZL B;  3CME 1;  1VQ8 Z;  3I56 1;  4DQY B;  3CCU 1;  1VLA A;  2QKD A;  2QA4 1;  1I3Q I;  4Y52 I;  1VQO Z;  1YIJ Z;  2K3R A;  3CC2 Z;  2VF1 A;  1P9N A;  3K7A I;  1W2B Z;  3KIH A;  4QTU A;  3I4M I;  1VQM 1;  5FLX f;  3S14 I;  1VQN Z;  1VQ5 1;  1KC8 1;  3M3Y I;  1QYP A;  3CD6 Z;  3KIF A;  2W04 A;  1VQ9 Z;  1Q86 1;  5LL6 f;  5AN9 F;  3VMG A;  3J81 b;  1K8A 1;  2KI7 B;  3CMA Z;  2YU9 I;  1YJ9 Z;  3CCJ Z;  4S1T A;  1VQP 1;  2P28 A;  1JWH C;  4DK1 A;  3S2D I;  1M1K 2;  3GKQ A;  4NBE A;  3CME Z;  4E2Y A;  3F3P C;  3I56 Z;  4X6A I;  4E32 A;  5C4X I;  5T6B A;  3CCU Z;  2VUM I;  3VB9 A;  3S1N I;  1KD1 2;  2QA4 Z;  1KQS Y;  2DE7 A;  1N2F A;  1ZH1 A;  4HGZ A;  2KPI A;  2HU9 A;  4MD7 A;  3G4S 1;  4MD8 A;  1VQM Z;  1VQ5 Z;  5D1O A;  1QVG Z;  1WII A;  4NOZ A;  3CCR 1;  1QF8 A;  4A3C I;  1RLY A;  2E2I I;  2NVT I;  1L1O C;  5IT9 f;  1Z02 A;  1VQP Z;  1K9M 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...