5IP7I

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I02
5C44I 3S14I 1TWAI 1I6HI 1USPA 1QYPA 2E2HI 2F4OA 4A3LI 2NVQI 3S15I 4A3KI 3GTPI 3S1NI 4A3CI 3GTJI 1X3WA 1TWCI 2YU9I 2R7ZI 3S1MI 2VUMI 1TWGI 5C3EI 2HF1A 3VMHA 4BBSI 1I3QI 3GTKI 1VLAA 3GTMI 2E2JI 3GKQA 3RZOI 2DE5A 3GTLI 3PO2I 1PFTA 1X3ZA 4A3MI 1R9TI 3S1QI 3HOVI 4X6AI 2BJOA 1WW9A 4Y52I 3EERA 5FLMI 1Y1VS 1TWHI 3S1RI 5C4XI 3VB9A 3HOYI 1TFIA 1N2FA 3GCFA 2R92I 3HOWI 3PO3S 3U50C 1RLYA 4NOZA 1SFOI 2E2II 4Y7NI 2P3YA 2DE7A 4A3BI 1L1OC 4A3FI 2F4MA 4A3JI 1LQLA 2K5RA 3LUSA 2JA5I 5C4JI 3D6WA 2JA8I 3GTOI 3H3VJ 4BY7I 3K7AI 3GTMS 1TWFI 3Q87A 3CQZI 4NBDA 2DE6A 1NUIA 3S16I 5CM2M 2KPIA 4XX2A 4BBRI 4BY1I 4A3II 2PK7A 4NBCA 1RO4A 3HOUI 5IP9I 3GTGI 4NBAA 3RZDI 1Y1VI 2JA6I 3FKII 4QTTA 3GTQI 3I4NI 4A93I 1K83I 3H0GI 3S17I 4A3DI 3HOXI 2JS4A 2JA7I 3VMGA 2JR6A 1ZB9A 3PO3I 2RBLA 3ESWA 4MH4A 3M4OI 2JNYA 4BXXI 4NBBA 4NB8A 2NVYI 5IP7I 2NVTI 1YUAA 2AKLA 4A3EI 2B63I 3S2HI 4NB9A 1Y1WI 2J6AA 4NBGA 1ML8A 3M3YI 3HOZI 1USPB 3I07A 3I4MI 3S2DI 4NBFA 2NVXI 4NBHA 4QTUA 4NBEA 4A3GI 1WCMI 1ZB8A 1I50I 1DL6A 3VMIA 2R93I
chains in the Genus database with same CATH superfamily
3VTNA 1VQL1 3CMA1 3CC7Z 1USPA 2LEXA 2E2HI 3T4NB 2V8IA 1YJNZ 2NVQI 3I551 3GTJI 5C3EI 3VMHA 1JJ2Z 1VQ4Z 3GTKI 1QVGY 2DE5A 4E2YA 2W03A 2QR1B 4E2ZA 1R9TI 3CCJZ 1VQLZ 1VQP1 4E2XA 2GTIA 2O53A 2IZ3A 4NH1C 2EGTA 4RVDA 2QLVB 4E31A 5C4XI 3VB9A 4CL1A 1N2FA 3IX0A 3U50C 4E32A 2P3YA 3CCV1 1FDIA 3J81f 1L1OC 3OW2Z 1KRLA 1LQLA 2K5RA 2JA5I 3D6WA 1VQPZ 1WJ2A 2JIQA 2JIMA 3K7AI 1YJ91 4RVFA 2H85A 1TWFI 3G711 2P28A 1Z02A 2LFUA 2M6NA 1KQSZ 1RO4A 1K731 1VQ9Z 1YJW1 2QEX1 4E33A 1VQO1 3GTQI 1VQ71 3G6E1 1KD11 3QWUA 3IR7A 1QVFY 5D1OA 5IT9b 3M4OI 2B63I 1X0TA 1YJWZ 1USPB 2LIYA 2JMOA 2K3RA 4TNUA 1S72Z 1VQ7Z 1JWHC 3I4MI 1K732 1VQK1 4NBHA 3CCU1 4QTUA 4NBEA 2OTJ1 1DL6A 4RV9A 2R93I 2R6MA 3TDHB 1I6HI 3NH8A 4MD8A 1KD12 3CXCZ 3S15I 1Z03A 4RVHA 2JUBA 2YADA 2HF1A 2GTHA 3GKQA 5AN9F 2OTLZ 4A3MI 1W2BZ 3S1QI 1M1K1 2VPYA 1WW9A 4Y52I 2O4HA 4EWCA 3J80f 1ZH1A 3GCFA 1RLYA 1SFOI 2DE7A 4RS4A 1VQM1 2Y0SA 2ZAEB 2Q4ZA 2F4MA 1QVGZ 3TE5B 5C4JI 2E7ZA 3KIFA 4DGLA 3H3VJ 4MXUA 1YI2Z 1Z01A 3CCM1 2GU2A 3EEDA 2DE6A 1NUIA 3CC41 1JJ2Y 3S16I 5CM2M 2KPIA 2RT9A 1RNIA 2VPZA 4A3II 3CCEZ 3HOUI 1VQMZ 5IP9I 1VQ91 1Y1VI 3J81b 2JA6I 1Q861 3H0GI 3CC2Z 3HOXI 2JS4A 3PO3I 3CCMZ 2AYDA 3CC4Z 2AKLA 5D1PA 4A3EI 4NB9A 1N8R1 4RVGA 3JAMf 1Q16A 3JAMb 1ML8A 2QKDA 3OW2Y 4NBFA 1VQ8Z 1S721 4A3GI 1KC81 5C44I 3BG1B 1Q862 3S14I 1YUKA 1TWAI 1WZNA 1KQSY 1QYPA 2F4OA 1K8A1 4DK1A 1VQ6Z 4A3KI 3GTPI 1X3WA 1TWCI 3S1MI 2VUMI 3NDJA 1N8R2 2G2KA 4BBSI 2JIRA 1I3QI 1VLAA 3GTMI 3GTLI 4HH4A 1VQNZ 3HOVI 2OOYB 2OTL1 2NAPA 2BJOA 1NP6A 3EERA 5FLMI 4MD9A 1KC82 3BG0B 1TWHI 2PM9A 3S1RI 4MRIA 4AYBA 3NH5A 2M48A 1K8A2 2R92I 4NOZA 2E2II 3D2LA 2WAQA 4A3BI 2VPWA 1NJI1 3CCQZ 1VQ5Z 5LL6f 2JA8I 3GTOI 3CCRZ 2QA4Z 4BY7I 3CXCY 3GTMS 2E9HA 3CD61 3CPWZ 1YHQZ 3Q87A 3CQZI 4NBDA 1QF8A 1YITZ 1YI21 4XX2A 4BBRI 3J80b 4DQYB 4BY1I 4NBCA 1Q7Y1 5A2Qf 1Q811 3GTGI 3CCE1 3NFZA 3NDIA 3I4NI 4E2WA 1S7MA 4QTTA 4A93I 2V8JA 3FQMA 2JA7I 2RIQA 5FLXf 2JR6A 5FLXb 1NJI2 1ZB9A 3D9XA 3CC21 1RQFA 3ESWA 4MH4A 3CD6Z 2JNYA 3NH4A 4BXXI 3I561 4NBBA 2OZKA 2NVTI 3G4SZ 1YUAA 2VUGA 3CME1 1Y1WI 1Q821 1M1K2 3CCLZ 4NBGA 5T64A 3M3YI 5D1OB 3P5JB 2RHBA 2QRDB 5T6BA 1YIJ1 2JIOA 3S2DI 1Q7Y2 2RPRA 1Q812 2NVXI 3CMAZ 1I50I 1VQ81 3I56Z 1WIIA 2I3CA 2WB1A 4S1TA 1FDOA 5T67A 3I55Z 3CMEZ 4A3LI 3S1NI 2IV2X 3MONA 4A3CI 2YU9I 2R7ZI 1VQ61 1RO0A 2V3VA 1YIJZ 1TWGI 2OOXB 1Q822 2PMZA 1Y8CA 3RZOI 2E2JI 3PO2I 4NFRA 1PFTA 1X3ZA 2VPXA 4X6AI 1VQN1 4MD7A 4MONA 2IZ4A 1Y1VS 1QVFZ 3HOYI 1M901 1TFIA 2KI7B 3CCVZ 3HOWI 3PO3S 4Y7NI 1K9M1 4A3FI 4A3JI 2V45A 3LUSA 1AA6A 1YJ9Z 2QREB 3F3FC 3CCQ1 1VQ51 4HGZA 5IT9f 3IF8A 3F3PC 3G71Z 3MZKB 3CCR1 2QA41 1SIWA 1YHQ1 4HGYA 3IFUA 2PK7A 2QEXZ 2QRCB 1YIT1 1VQOZ 1M902 4NBAA 3RZDI 2HU9A 3FQQA 4E30A 3FKII 3G6EZ 1K83I 3S17I 3MZLB 1K9M2 2JIPA 4A3DI 2V8KA 3VMGA 3CCS1 3HKZA 2RBLA 4NB8A 2NVYI 5IP7I 3J7A4 3S2HI 3CC71 1QXFA 2J6AA 1YJN1 3G4S1 2W04A 2Q51A 3HOZI 3CCL1 3I07A 3KIHA 1VQKZ 3CCUZ 5A2Qb 1W2BY 2OTJZ 1VQ41 3CCSZ 1RO2A 1WCMI 2VF1A 3CPWY 1ZB8A 3VMIA 1P9NA 3CCJ1
chains in the Genus database with same CATH topology
3VTNA 1VQL1 3CMA1 3CC7Z 1USPA 2E2HI 3T4NB 2V8IA 1YJNZ 2NVQI 3I551 3GTJI 5C3EI 3VMHA 1JJ2Z 1VQ4Z 3GTKI 1QVGY 2DE5A 4E2YA 2W03A 2QR1B 4E2ZA 1R9TI 3CCJZ 1VQLZ 1VQP1 4E2XA 2GTIA 2O53A 2IZ3A 4NH1C 2EGTA 4RVDA 2QLVB 4E31A 5C4XI 3VB9A 4CL1A 1N2FA 3IX0A 3U50C 4E32A 2P3YA 3CCV1 3J81f 1L1OC 3OW2Z 1KRLA 1LQLA 2K5RA 2JA5I 3D6WA 1VQPZ 3K7AI 1YJ91 4RVFA 2H85A 1TWFI 3G711 2P28A 1Z02A 2LFUA 2M6NA 1KQSZ 1RO4A 1K731 1VQ9Z 1YJW1 2QEX1 4E33A 1VQO1 3GTQI 1VQ71 3G6E1 1KD11 3QWUA 1QVFY 5D1OA 5IT9b 3M4OI 2B63I 1X0TA 1YJWZ 1USPB 2LIYA 2JMOA 2K3RA 4TNUA 1S72Z 1VQ7Z 1JWHC 3I4MI 1K732 1VQK1 4NBHA 3CCU1 4QTUA 4NBEA 2OTJ1 1DL6A 4RV9A 2R93I 2R6MA 3TDHB 1I6HI 3NH8A 4MD8A 1KD12 3CXCZ 3S15I 1Z03A 4RVHA 2JUBA 2YADA 2HF1A 2GTHA 3GKQA 5AN9F 2OTLZ 4A3MI 1W2BZ 3S1QI 1M1K1 1WW9A 4Y52I 2O4HA 4EWCA 3J80f 1ZH1A 3GCFA 1RLYA 1SFOI 2DE7A 4RS4A 1VQM1 2Y0SA 2ZAEB 2Q4ZA 2F4MA 1QVGZ 3TE5B 5C4JI 3KIFA 4DGLA 3H3VJ 4MXUA 1YI2Z 1Z01A 3CCM1 2GU2A 3EEDA 2DE6A 1NUIA 3CC41 1JJ2Y 3S16I 5CM2M 2KPIA 2RT9A 1RNIA 4A3II 3CCEZ 3HOUI 1VQMZ 5IP9I 1VQ91 1Y1VI 3J81b 2JA6I 1Q861 3H0GI 3CC2Z 3HOXI 2JS4A 3PO3I 3CCMZ 3CC4Z 2AKLA 5D1PA 4A3EI 4NB9A 1N8R1 4RVGA 3JAMf 3JAMb 1ML8A 2QKDA 3OW2Y 4NBFA 1VQ8Z 1S721 4A3GI 1KC81 5C44I 3BG1B 1Q862 3S14I 1YUKA 1TWAI 1KQSY 1QYPA 2F4OA 1K8A1 4DK1A 1VQ6Z 4A3KI 3GTPI 1X3WA 1TWCI 3S1MI 2VUMI 3NDJA 1N8R2 2G2KA 4BBSI 1I3QI 1VLAA 3GTMI 3GTLI 4HH4A 1VQNZ 3HOVI 2OOYB 2OTL1 2BJOA 1NP6A 3EERA 5FLMI 4MD9A 1KC82 3BG0B 1TWHI 2PM9A 3S1RI 4MRIA 4AYBA 3NH5A 2M48A 1K8A2 2R92I 4NOZA 2E2II 2WAQA 4A3BI 1NJI1 3CCQZ 1VQ5Z 5LL6f 2JA8I 3GTOI 3CCRZ 2QA4Z 4BY7I 3CXCY 3GTMS 2E9HA 3CD61 3CPWZ 1YHQZ 3Q87A 3CQZI 4NBDA 1QF8A 1YITZ 1YI21 4XX2A 4BBRI 3J80b 4DQYB 4BY1I 4NBCA 1Q7Y1 5A2Qf 1Q811 3GTGI 3CCE1 3NFZA 3NDIA 3I4NI 4E2WA 1S7MA 4QTTA 4A93I 2V8JA 3FQMA 2JA7I 2RIQA 5FLXf 2JR6A 5FLXb 1NJI2 1ZB9A 3D9XA 3CC21 1RQFA 3ESWA 4MH4A 3CD6Z 2JNYA 3NH4A 4BXXI 3I561 4NBBA 2OZKA 2NVTI 3G4SZ 1YUAA 2VUGA 3CME1 1Y1WI 1Q821 1M1K2 3CCLZ 4NBGA 5T64A 3M3YI 5D1OB 3P5JB 2RHBA 2QRDB 5T6BA 1YIJ1 3S2DI 1Q7Y2 2RPRA 1Q812 2NVXI 3CMAZ 1I50I 1VQ81 3I56Z 1WIIA 2I3CA 2WB1A 4S1TA 5T67A 3I55Z 3CMEZ 4A3LI 3S1NI 3MONA 4A3CI 2YU9I 2R7ZI 1VQ61 1RO0A 1YIJZ 1TWGI 2OOXB 1Q822 2PMZA 3RZOI 2E2JI 3PO2I 4NFRA 1PFTA 1X3ZA 4X6AI 1VQN1 4MD7A 4MONA 2IZ4A 1Y1VS 1QVFZ 3HOYI 1M901 1TFIA 2KI7B 3CCVZ 3HOWI 3PO3S 4Y7NI 1K9M1 4A3FI 4A3JI 3LUSA 1YJ9Z 2QREB 3F3FC 3CCQ1 1VQ51 4HGZA 5IT9f 3IF8A 3F3PC 3G71Z 3MZKB 3CCR1 2QA41 1YHQ1 4HGYA 3IFUA 2PK7A 2QEXZ 2QRCB 1YIT1 1VQOZ 1M902 4NBAA 3RZDI 2HU9A 3FQQA 4E30A 3FKII 3G6EZ 1K83I 3S17I 3MZLB 1K9M2 4A3DI 2V8KA 3VMGA 3CCS1 3HKZA 2RBLA 4NB8A 2NVYI 5IP7I 3J7A4 3S2HI 3CC71 2J6AA 1YJN1 3G4S1 2W04A 2Q51A 3HOZI 3CCL1 3I07A 3KIHA 1VQKZ 3CCUZ 5A2Qb 1W2BY 2OTJZ 1VQ41 3CCSZ 1RO2A 1WCMI 2VF1A 3CPWY 1ZB8A 3VMIA 1P9NA 3CCJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 I;  3S14 I;  1TWA I;  1I6H I;  1USP A;  1QYP A;  2E2H I;  2F4O A;  4A3L I;  2NVQ I;  3S15 I;  4A3K I;  3GTP I;  3S1N I;  4A3C I;  3GTJ I;  1X3W A;  1TWC I;  2YU9 I;  2R7Z I;  3S1M I;  2VUM I;  1TWG I;  5C3E I;  2HF1 A;  3VMH A;  4BBS I;  1I3Q I;  3GTK I;  1VLA A;  3GTM I;  2E2J I;  3GKQ A;  3RZO I;  2DE5 A;  3GTL I;  3PO2 I;  1PFT A;  1X3Z A;  4A3M I;  1R9T I;  3S1Q I;  3HOV I;  4X6A I;  2BJO A;  1WW9 A;  4Y52 I;  3EER A;  5FLM I;  1Y1V S;  1TWH I;  3S1R I;  5C4X I;  3VB9 A;  3HOY I;  1TFI A;  1N2F A;  3GCF A;  2R92 I;  3HOW I;  3PO3 S;  3U50 C;  1RLY A;  4NOZ A;  1SFO I;  2E2I I;  4Y7N I;  2P3Y A;  2DE7 A;  4A3B I;  1L1O C;  4A3F I;  2F4M A;  4A3J I;  1LQL A;  2K5R A;  3LUS A;  2JA5 I;  5C4J I;  3D6W A;  2JA8 I;  3GTO I;  3H3V J;  4BY7 I;  3K7A I;  3GTM S;  1TWF I;  3Q87 A;  3CQZ I;  4NBD A;  2DE6 A;  1NUI A;  3S16 I;  5CM2 M;  2KPI A;  4XX2 A;  4BBR I;  4BY1 I;  4A3I I;  2PK7 A;  4NBC A;  1RO4 A;  3HOU I;  5IP9 I;  3GTG I;  4NBA A;  3RZD I;  1Y1V I;  2JA6 I;  3FKI I;  4QTT A;  3GTQ I;  3I4N I;  4A93 I;  1K83 I;  3H0G I;  3S17 I;  4A3D I;  3HOX I;  2JS4 A;  2JA7 I;  3VMG A;  2JR6 A;  1ZB9 A;  3PO3 I;  2RBL A;  3ESW A;  4MH4 A;  3M4O I;  2JNY A;  4BXX I;  4NBB A;  4NB8 A;  2NVY I;  5IP7 I;  2NVT I;  1YUA A;  2AKL A;  4A3E I;  2B63 I;  3S2H I;  4NB9 A;  1Y1W I;  2J6A A;  4NBG A;  1ML8 A;  3M3Y I;  3HOZ I;  1USP B;  3I07 A;  3I4M I;  3S2D I;  4NBF A;  2NVX I;  4NBH A;  4QTU A;  4NBE A;  4A3G I;  1WCM I;  1ZB8 A;  1I50 I;  1DL6 A;  3VMI A;  2R93 I; 
#chains in the Genus database with same CATH topology
 3VTN A;  1VQL 1;  3CMA 1;  3CC7 Z;  1USP A;  2LEX A;  2E2H I;  3T4N B;  2V8I A;  1YJN Z;  2NVQ I;  3I55 1;  3GTJ I;  5C3E I;  3VMH A;  1JJ2 Z;  1VQ4 Z;  3GTK I;  1QVG Y;  2DE5 A;  4E2Y A;  2W03 A;  2QR1 B;  4E2Z A;  1R9T I;  3CCJ Z;  1VQL Z;  1VQP 1;  4E2X A;  2GTI A;  2O53 A;  2IZ3 A;  4NH1 C;  2EGT A;  4RVD A;  2QLV B;  4E31 A;  5C4X I;  3VB9 A;  4CL1 A;  1N2F A;  3IX0 A;  3U50 C;  4E32 A;  2P3Y A;  3CCV 1;  1FDI A;  3J81 f;  1L1O C;  3OW2 Z;  1KRL A;  1LQL A;  2K5R A;  2JA5 I;  3D6W A;  1VQP Z;  1WJ2 A;  2JIQ A;  2JIM A;  3K7A I;  1YJ9 1;  4RVF A;  2H85 A;  1TWF I;  3G71 1;  2P28 A;  1Z02 A;  2LFU A;  2M6N A;  1KQS Z;  1RO4 A;  1K73 1;  1VQ9 Z;  1YJW 1;  2QEX 1;  4E33 A;  1VQO 1;  3GTQ I;  1VQ7 1;  3G6E 1;  1KD1 1;  3QWU A;  3IR7 A;  1QVF Y;  5D1O A;  5IT9 b;  3M4O I;  2B63 I;  1X0T A;  1YJW Z;  1USP B;  2LIY A;  2JMO A;  2K3R A;  4TNU A;  1S72 Z;  1VQ7 Z;  1JWH C;  3I4M I;  1K73 2;  1VQK 1;  4NBH A;  3CCU 1;  4QTU A;  4NBE A;  2OTJ 1;  1DL6 A;  4RV9 A;  2R93 I;  2R6M A;  3TDH B;  1I6H I;  3NH8 A;  4MD8 A;  1KD1 2;  3CXC Z;  3S15 I;  1Z03 A;  4RVH A;  2JUB A;  2YAD A;  2HF1 A;  2GTH A;  3GKQ A;  5AN9 F;  2OTL Z;  4A3M I;  1W2B Z;  3S1Q I;  1M1K 1;  2VPY A;  1WW9 A;  4Y52 I;  2O4H A;  4EWC A;  3J80 f;  1ZH1 A;  3GCF A;  1RLY A;  1SFO I;  2DE7 A;  4RS4 A;  1VQM 1;  2Y0S A;  2ZAE B;  2Q4Z A;  2F4M A;  1QVG Z;  3TE5 B;  5C4J I;  2E7Z A;  3KIF A;  4DGL A;  3H3V J;  4MXU A;  1YI2 Z;  1Z01 A;  3CCM 1;  2GU2 A;  3EED A;  2DE6 A;  1NUI A;  3CC4 1;  1JJ2 Y;  3S16 I;  5CM2 M;  2KPI A;  2RT9 A;  1RNI A;  2VPZ A;  4A3I I;  3CCE Z;  3HOU I;  1VQM Z;  5IP9 I;  1VQ9 1;  1Y1V I;  3J81 b;  2JA6 I;  1Q86 1;  3H0G I;  3CC2 Z;  3HOX I;  2JS4 A;  3PO3 I;  3CCM Z;  2AYD A;  3CC4 Z;  2AKL A;  5D1P A;  4A3E I;  4NB9 A;  1N8R 1;  4RVG A;  3JAM f;  1Q16 A;  3JAM b;  1ML8 A;  2QKD A;  3OW2 Y;  4NBF A;  1VQ8 Z;  1S72 1;  4A3G I;  1KC8 1;  5C44 I;  3BG1 B;  1Q86 2;  3S14 I;  1YUK A;  1TWA I;  1WZN A;  1KQS Y;  1QYP A;  2F4O A;  1K8A 1;  4DK1 A;  1VQ6 Z;  4A3K I;  3GTP I;  1X3W A;  1TWC I;  3S1M I;  2VUM I;  3NDJ A;  1N8R 2;  2G2K A;  4BBS I;  2JIR A;  1I3Q I;  1VLA A;  3GTM I;  3GTL I;  4HH4 A;  1VQN Z;  3HOV I;  2OOY B;  2OTL 1;  2NAP A;  2BJO A;  1NP6 A;  3EER A;  5FLM I;  4MD9 A;  1KC8 2;  3BG0 B;  1TWH I;  2PM9 A;  3S1R I;  4MRI A;  4AYB A;  3NH5 A;  2M48 A;  1K8A 2;  2R92 I;  4NOZ A;  2E2I I;  3D2L A;  2WAQ A;  4A3B I;  2VPW A;  1NJI 1;  3CCQ Z;  1VQ5 Z;  5LL6 f;  2JA8 I;  3GTO I;  3CCR Z;  2QA4 Z;  4BY7 I;  3CXC Y;  3GTM S;  2E9H A;  3CD6 1;  3CPW Z;  1YHQ Z;  3Q87 A;  3CQZ I;  4NBD A;  1QF8 A;  1YIT Z;  1YI2 1;  4XX2 A;  4BBR I;  3J80 b;  4DQY B;  4BY1 I;  4NBC A;  1Q7Y 1;  5A2Q f;  1Q81 1;  3GTG I;  3CCE 1;  3NFZ A;  3NDI A;  3I4N I;  4E2W A;  1S7M A;  4QTT A;  4A93 I;  2V8J A;  3FQM A;  2JA7 I;  2RIQ A;  5FLX f;  2JR6 A;  5FLX b;  1NJI 2;  1ZB9 A;  3D9X A;  3CC2 1;  1RQF A;  3ESW A;  4MH4 A;  3CD6 Z;  2JNY A;  3NH4 A;  4BXX I;  3I56 1;  4NBB A;  2OZK A;  2NVT I;  3G4S Z;  1YUA A;  2VUG A;  3CME 1;  1Y1W I;  1Q82 1;  1M1K 2;  3CCL Z;  4NBG A;  5T64 A;  3M3Y I;  5D1O B;  3P5J B;  2RHB A;  2QRD B;  5T6B A;  1YIJ 1;  2JIO A;  3S2D I;  1Q7Y 2;  2RPR A;  1Q81 2;  2NVX I;  3CMA Z;  1I50 I;  1VQ8 1;  3I56 Z;  1WII A;  2I3C A;  2WB1 A;  4S1T A;  1FDO A;  5T67 A;  3I55 Z;  3CME Z;  4A3L I;  3S1N I;  2IV2 X;  3MON A;  4A3C I;  2YU9 I;  2R7Z I;  1VQ6 1;  1RO0 A;  2V3V A;  1YIJ Z;  1TWG I;  2OOX B;  1Q82 2;  2PMZ A;  1Y8C A;  3RZO I;  2E2J I;  3PO2 I;  4NFR A;  1PFT A;  1X3Z A;  2VPX A;  4X6A I;  1VQN 1;  4MD7 A;  4MON A;  2IZ4 A;  1Y1V S;  1QVF Z;  3HOY I;  1M90 1;  1TFI A;  2KI7 B;  3CCV Z;  3HOW I;  3PO3 S;  4Y7N I;  1K9M 1;  4A3F I;  4A3J I;  2V45 A;  3LUS A;  1AA6 A;  1YJ9 Z;  2QRE B;  3F3F C;  3CCQ 1;  1VQ5 1;  4HGZ A;  5IT9 f;  3IF8 A;  3F3P C;  3G71 Z;  3MZK B;  3CCR 1;  2QA4 1;  1SIW A;  1YHQ 1;  4HGY A;  3IFU A;  2PK7 A;  2QEX Z;  2QRC B;  1YIT 1;  1VQO Z;  1M90 2;  4NBA A;  3RZD I;  2HU9 A;  3FQQ A;  4E30 A;  3FKI I;  3G6E Z;  1K83 I;  3S17 I;  3MZL B;  1K9M 2;  2JIP A;  4A3D I;  2V8K A;  3VMG A;  3CCS 1;  3HKZ A;  2RBL A;  4NB8 A;  2NVY I;  5IP7 I;  3J7A 4;  3S2H I;  3CC7 1;  1QXF A;  2J6A A;  1YJN 1;  3G4S 1;  2W04 A;  2Q51 A;  3HOZ I;  3CCL 1;  3I07 A;  3KIH A;  1VQK Z;  3CCU Z;  5A2Q b;  1W2B Y;  2OTJ Z;  1VQ4 1;  3CCS Z;  1RO2 A;  1WCM I;  2VF1 A;  3CPW Y;  1ZB8 A;  3VMI A;  1P9N A;  3CCJ 1; 
#chains in the Genus database with same CATH homology
 3VTN A;  1VQL 1;  3CMA 1;  3CC7 Z;  1USP A;  2E2H I;  3T4N B;  2V8I A;  1YJN Z;  2NVQ I;  3I55 1;  3GTJ I;  5C3E I;  3VMH A;  1JJ2 Z;  1VQ4 Z;  3GTK I;  1QVG Y;  2DE5 A;  4E2Y A;  2W03 A;  2QR1 B;  4E2Z A;  1R9T I;  3CCJ Z;  1VQL Z;  1VQP 1;  4E2X A;  2GTI A;  2O53 A;  2IZ3 A;  4NH1 C;  2EGT A;  4RVD A;  2QLV B;  4E31 A;  5C4X I;  3VB9 A;  4CL1 A;  1N2F A;  3IX0 A;  3U50 C;  4E32 A;  2P3Y A;  3CCV 1;  3J81 f;  1L1O C;  3OW2 Z;  1KRL A;  1LQL A;  2K5R A;  2JA5 I;  3D6W A;  1VQP Z;  3K7A I;  1YJ9 1;  4RVF A;  2H85 A;  1TWF I;  3G71 1;  2P28 A;  1Z02 A;  2LFU A;  2M6N A;  1KQS Z;  1RO4 A;  1K73 1;  1VQ9 Z;  1YJW 1;  2QEX 1;  4E33 A;  1VQO 1;  3GTQ I;  1VQ7 1;  3G6E 1;  1KD1 1;  3QWU A;  1QVF Y;  5D1O A;  5IT9 b;  3M4O I;  2B63 I;  1X0T A;  1YJW Z;  1USP B;  2LIY A;  2JMO A;  2K3R A;  4TNU A;  1S72 Z;  1VQ7 Z;  1JWH C;  3I4M I;  1K73 2;  1VQK 1;  4NBH A;  3CCU 1;  4QTU A;  4NBE A;  2OTJ 1;  1DL6 A;  4RV9 A;  2R93 I;  2R6M A;  3TDH B;  1I6H I;  3NH8 A;  4MD8 A;  1KD1 2;  3CXC Z;  3S15 I;  1Z03 A;  4RVH A;  2JUB A;  2YAD A;  2HF1 A;  2GTH A;  3GKQ A;  5AN9 F;  2OTL Z;  4A3M I;  1W2B Z;  3S1Q I;  1M1K 1;  1WW9 A;  4Y52 I;  2O4H A;  4EWC A;  3J80 f;  1ZH1 A;  3GCF A;  1RLY A;  1SFO I;  2DE7 A;  4RS4 A;  1VQM 1;  2Y0S A;  2ZAE B;  2Q4Z A;  2F4M A;  1QVG Z;  3TE5 B;  5C4J I;  3KIF A;  4DGL A;  3H3V J;  4MXU A;  1YI2 Z;  1Z01 A;  3CCM 1;  2GU2 A;  3EED A;  2DE6 A;  1NUI A;  3CC4 1;  1JJ2 Y;  3S16 I;  5CM2 M;  2KPI A;  2RT9 A;  1RNI A;  4A3I I;  3CCE Z;  3HOU I;  1VQM Z;  5IP9 I;  1VQ9 1;  1Y1V I;  3J81 b;  2JA6 I;  1Q86 1;  3H0G I;  3CC2 Z;  3HOX I;  2JS4 A;  3PO3 I;  3CCM Z;  3CC4 Z;  2AKL A;  5D1P A;  4A3E I;  4NB9 A;  1N8R 1;  4RVG A;  3JAM f;  3JAM b;  1ML8 A;  2QKD A;  3OW2 Y;  4NBF A;  1VQ8 Z;  1S72 1;  4A3G I;  1KC8 1;  5C44 I;  3BG1 B;  1Q86 2;  3S14 I;  1YUK A;  1TWA I;  1KQS Y;  1QYP A;  2F4O A;  1K8A 1;  4DK1 A;  1VQ6 Z;  4A3K I;  3GTP I;  1X3W A;  1TWC I;  3S1M I;  2VUM I;  3NDJ A;  1N8R 2;  2G2K A;  4BBS I;  1I3Q I;  1VLA A;  3GTM I;  3GTL I;  4HH4 A;  1VQN Z;  3HOV I;  2OOY B;  2OTL 1;  2BJO A;  1NP6 A;  3EER A;  5FLM I;  4MD9 A;  1KC8 2;  3BG0 B;  1TWH I;  2PM9 A;  3S1R I;  4MRI A;  4AYB A;  3NH5 A;  2M48 A;  1K8A 2;  2R92 I;  4NOZ A;  2E2I I;  2WAQ A;  4A3B I;  1NJI 1;  3CCQ Z;  1VQ5 Z;  5LL6 f;  2JA8 I;  3GTO I;  3CCR Z;  2QA4 Z;  4BY7 I;  3CXC Y;  3GTM S;  2E9H A;  3CD6 1;  3CPW Z;  1YHQ Z;  3Q87 A;  3CQZ I;  4NBD A;  1QF8 A;  1YIT Z;  1YI2 1;  4XX2 A;  4BBR I;  3J80 b;  4DQY B;  4BY1 I;  4NBC A;  1Q7Y 1;  5A2Q f;  1Q81 1;  3GTG I;  3CCE 1;  3NFZ A;  3NDI A;  3I4N I;  4E2W A;  1S7M A;  4QTT A;  4A93 I;  2V8J A;  3FQM A;  2JA7 I;  2RIQ A;  5FLX f;  2JR6 A;  5FLX b;  1NJI 2;  1ZB9 A;  3D9X A;  3CC2 1;  1RQF A;  3ESW A;  4MH4 A;  3CD6 Z;  2JNY A;  3NH4 A;  4BXX I;  3I56 1;  4NBB A;  2OZK A;  2NVT I;  3G4S Z;  1YUA A;  2VUG A;  3CME 1;  1Y1W I;  1Q82 1;  1M1K 2;  3CCL Z;  4NBG A;  5T64 A;  3M3Y I;  5D1O B;  3P5J B;  2RHB A;  2QRD B;  5T6B A;  1YIJ 1;  3S2D I;  1Q7Y 2;  2RPR A;  1Q81 2;  2NVX I;  3CMA Z;  1I50 I;  1VQ8 1;  3I56 Z;  1WII A;  2I3C A;  2WB1 A;  4S1T A;  5T67 A;  3I55 Z;  3CME Z;  4A3L I;  3S1N I;  3MON A;  4A3C I;  2YU9 I;  2R7Z I;  1VQ6 1;  1RO0 A;  1YIJ Z;  1TWG I;  2OOX B;  1Q82 2;  2PMZ A;  3RZO I;  2E2J I;  3PO2 I;  4NFR A;  1PFT A;  1X3Z A;  4X6A I;  1VQN 1;  4MD7 A;  4MON A;  2IZ4 A;  1Y1V S;  1QVF Z;  3HOY I;  1M90 1;  1TFI A;  2KI7 B;  3CCV Z;  3HOW I;  3PO3 S;  4Y7N I;  1K9M 1;  4A3F I;  4A3J I;  3LUS A;  1YJ9 Z;  2QRE B;  3F3F C;  3CCQ 1;  1VQ5 1;  4HGZ A;  5IT9 f;  3IF8 A;  3F3P C;  3G71 Z;  3MZK B;  3CCR 1;  2QA4 1;  1YHQ 1;  4HGY A;  3IFU A;  2PK7 A;  2QEX Z;  2QRC B;  1YIT 1;  1VQO Z;  1M90 2;  4NBA A;  3RZD I;  2HU9 A;  3FQQ A;  4E30 A;  3FKI I;  3G6E Z;  1K83 I;  3S17 I;  3MZL B;  1K9M 2;  4A3D I;  2V8K A;  3VMG A;  3CCS 1;  3HKZ A;  2RBL A;  4NB8 A;  2NVY I;  5IP7 I;  3J7A 4;  3S2H I;  3CC7 1;  2J6A A;  1YJN 1;  3G4S 1;  2W04 A;  2Q51 A;  3HOZ I;  3CCL 1;  3I07 A;  3KIH A;  1VQK Z;  3CCU Z;  5A2Q b;  1W2B Y;  2OTJ Z;  1VQ4 1;  3CCS Z;  1RO2 A;  1WCM I;  2VF1 A;  3CPW Y;  1ZB8 A;  3VMI A;  1P9N A;  3CCJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...