5IP7I

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5ip7I02
1TWFI 1ZB9A 2PK7A 1I6HI 4BBSI 3S1QI 4A93I 3S2HI 1RLYA 2NVTI 1TWGI 3HOUI 2HF1A 5IP7I 2P3YA 2R7ZI 3VMHA 2J6AA 3GTKI 4NB9A 4X6AI 3GTMI 3HOWI 3Q87A 4A3BI 4NB8A 4A3FI 3S1RI 1ZB8A 3S2DI 2YU9I 2AKLA 4QTUA 3I4MI 3K7AI 2DE6A 2VUMI 3S14I 1SFOI 4A3LI 3RZDI 2R93I 3GTPI 1R9TI 2DE7A 3GTQI 3VMIA 4NBBA 3HOXI 1I3QI 2JR6A 2NVQI 2JA8I 4A3CI 3PO3S 5CM2M 1Y1VI 5C44I 1USPB 4NBDA 4Y7NI 2JA7I 3M3YI 3GTMS 4A3GI 3VB9A 5IP9I 1TFIA 5FLMI 4A3II 3H3VJ 3GTLI 1WCMI 3GTGI 1RO4A 3GCFA 2F4MA 2B63I 3S17I 3LUSA 1Y1WI 3PO2I 1ML8A 3ESWA 5C4XI 2JA6I 2E2II 4NBHA 4NBEA 2NVYI 1N2FA 2NVXI 3S1MI 5C3EI 1NUIA 5C4JI 2JA5I 1TWAI 3EERA 3I07A 1QYPA 3VMGA 4NBCA 1WW9A 1USPA 4NBGA 3PO3I 3S15I 1Y1VS 2JS4A 4MH4A 4A3EI 4BY7I 3S16I 3S1NI 3GKQA 2DE5A 2JNYA 2R92I 2F4OA 3CQZI 4BXXI 4QTTA 3HOVI 4A3MI 3D6WA 3FKII 4XX2A 1TWCI 4BBRI 1YUAA 3H0GI 1PFTA 2RBLA 2E2HI 3GTOI 3HOZI 1LQLA 1L1OC 3GTJI 1X3ZA 3U50C 4Y52I 2K5RA 1I50I 1DL6A 4A3JI 4NOZA 2KPIA 4NBAA 1X3WA 3I4NI 1K83I 3HOYI 3M4OI 4NBFA 4A3KI 4BY1I 2E2JI 1TWHI 4A3DI 1VLAA 3RZOI 2BJOA
chains in the Genus database with same CATH superfamily
2PK7A 2OTLZ 3F3PC 3JAMb 4BBSI 2LIYA 2Y0SA 3S1QI 5IP7I 5D1PA 2EGTA 3CCLZ 1Z02A 3Q87A 3CC21 2QA4Z 5FLXb 2WAQA 4QTUA 5A2Qf 1Q811 3CCU1 1VQL1 3KIFA 3GTQI 4NBBA 1YHQ1 2WB1A 3HOXI 1VQMZ 1VQOZ 1I3QI 1NJI2 1N8R2 1Z01A 2NVQI 1Q16A 4TNUA 5AN9F 1QVGY 2E7ZA 4NBDA 1YIJ1 3GTMS 3VB9A 2RIQA 2QKDA 5FLMI 4A3II 3GTGI 1RO4A 2OOXB 3GCFA 3I551 4MD7A 3PO2I 1YJN1 1ML8A 2ZAEB 1YITZ 2V8KA 4NBHA 3CCS1 1N2FA 2HU9A 1WZNA 5C3EI 2RT9A 3F3FC 3I07A 3QWUA 3VMGA 5LL6f 1VQ51 3S15I 3CC7Z 3TDHB 4HH4A 1M902 3S16I 2IZ3A 4BXXI 2G2KA 3H0GI 2IZ4A 4DK1A 3GTOI 5T64A 3U50C 1DL6A 4RS4A 1VQ7Z 4A3JI 2E9HA 3OW2Y 2KPIA 1X3WA 4A3KI 2V45A 1VQ71 2I3CA 1KQSY 3CC2Z 1VQ8Z 2LEXA 2KI7B 1RLYA 2V3VA 1YIJZ 3HOUI 3CPWZ 2HF1A 3CCEZ 1RQFA 3CCJ1 2R7ZI 3VMHA 2J6AA 1YHQZ 3GTKI 1QVGZ 2M48A 1Q812 4E30A 3HOWI 3NDIA 1AA6A 3CMAZ 4DQYB 1W2BZ 4A3FI 4AYBA 3OW2Z 2AKLA 3I4MI 2OTJZ 3CCSZ 3I561 2DE6A 3CMA1 3S14I 4A3LI 3GTPI 2DE7A 1VQ61 1JJ2Y 1YUKA 3CC71 1YJNZ 3J7A4 3PO3S 1K9M1 1Y1VI 1K8A2 5C44I 1KD11 4RVGA 3M3YI 1YJW1 3KIHA 2OZKA 1WCMI 3CCM1 2R6MA 4MD9A 2B63I 1Y1WI 3J80f 1YJ9Z 2RHBA 5C4XI 1K731 2JA6I 3CCMZ 2NVXI 3S1MI 2JA5I 2AYDA 1S72Z 1VQ91 2JIPA 4NBCA 3PO3I 4MRIA 1Y1VS 1Q821 3CC41 2JS4A 4MH4A 4CL1A 4A3EI 2V8JA 3J80b 1RO2A 1WJ2A 1VQPZ 2F4OA 4QTTA 3HOVI 4A3MI 3D6WA 4XX2A 3T4NB 3CXCZ 2JIOA 4BBRI 2RBLA 2LFUA 4RV9A 1LQLA 2VPZA 2VUGA 1FDOA 1Y8CA 3NH4A 3P5JB 5D1OA 3CCE1 1JWHC 3I4NI 1QXFA 2VPYA 2O53A 3M4OI 2VPWA 3CCQZ 1VQKZ 1Q7Y1 4A3DI 2BJOA 1TWFI 2OTJ1 2JMOA 1Q7Y2 1QVFY 3TE5B 2P3YA 1M1K2 3NH8A 4NB9A 1W2BY 4X6AI 1RNIA 3IF8A 2JIRA 3JAMf 4NB8A 4RVHA 1YI2Z 1Q862 1VQ5Z 3S2DI 1FDIA 1M1K1 1VQN1 3G6E1 3VMIA 3G71Z 1P9NA 5CM2M 3CMEZ 4E33A 3G711 1USPB 2W03A 3EEDA 1KRLA 3NH5A 1TFIA 2P28A 2PMZA 3CME1 2F4MA 4HGYA 1K9M2 2JUBA 3CC4Z 3IX0A 3ESWA 4MXUA 2E2II 1WIIA 1TWAI 3FQQA 2QA41 3CPWY 1USPA 3CCQ1 4NBGA 2O4HA 1S7MA 4E32A 3CCJZ 1KD12 2Q51A 3D9XA 1VQLZ 1KC81 3S1NI 3GKQA 2DE5A 5T6BA 4E2WA 2V8IA 2VF1A 3MONA 1RO0A 2OOYB 3FKII 1YUAA 4RVFA 1PFTA 3I56Z 1VQK1 3D2LA 4NH1C 5T67A 3HOZI 4HGZA 1L1OC 3G4SZ 4NFRA 5IT9b 3GTJI 1VQ6Z 4Y52I 2K5RA 1I50I 1KC82 4NOZA 3I55Z 4NBAA 1K83I 3G4S1 2YADA 2M6NA 3HOYI 1KQSZ 4BY1I 3G6EZ 2E2JI 1TWHI 3FQMA 1NP6A 1YJWZ 2PM9A 5FLXf 1ZB9A 1YI21 1I6HI 4A93I 3S2HI 2QEXZ 3CCV1 2QR1B 1TWGI 1ZH1A 2W04A 2NVTI 3J81b 3VTNA 1YJ91 1VQNZ 2GTHA 3J81f 2NAPA 3GTMI 1Q861 4A3BI 1VQ9Z 3S1RI 1X0TA 1ZB8A 2YU9I 3IR7A 3K7AI 2VUMI 1SFOI 3RZDI 2R93I 4MD8A 1R9TI 3CCL1 1VQP1 2QLVB 2JR6A 3BG0B 2JA8I 4A3CI 4E2YA 5IT9f 2OTL1 2H85A 3BG1B 4Y7NI 2JA7I 3CCUZ 3MZLB 1VQ81 4A3GI 5IP9I 3H3VJ 3GTLI 4RVDA 2GTIA 1SIWA 1VQM1 1VQO1 2K3RA 3S17I 3CCRZ 3IFUA 3LUSA 1VQ41 1NJI1 1K732 2RPRA 4NBEA 2NVYI 3NFZA 1QF8A 3NDJA 1NUIA 5C4JI 3CCR1 1VQ4Z 3MZKB 3EERA 2QRDB 1QYPA 2IV2X 4DGLA 1WW9A 3CD61 1QVFZ 2Q4ZA 1M901 4BY7I 1K8A1 1YIT1 4E31A 3CXCY 3CD6Z 3HKZA 2JNYA 4S1TA 2QEX1 1N8R1 2R92I 3CQZI 2QREB 4MONA 4E2ZA 1TWCI 2E2HI 1JJ2Z 5D1OB 1X3ZA 3CCVZ 2QRCB 2JIQA 4NBFA 4EWCA 1Q822 2GU2A 2VPXA 1Z03A 4E2XA 2JIMA 1VLAA 5A2Qb 3RZOI 1S721
chains in the Genus database with same CATH topology
2PK7A 2OTLZ 3F3PC 3JAMb 4BBSI 2LIYA 2Y0SA 3S1QI 5IP7I 5D1PA 2EGTA 3CCLZ 1Z02A 3Q87A 3CC21 2QA4Z 5FLXb 2WAQA 4QTUA 5A2Qf 1Q811 3CCU1 1VQL1 3KIFA 3GTQI 4NBBA 1YHQ1 2WB1A 3HOXI 1VQMZ 1VQOZ 1I3QI 1NJI2 1N8R2 1Z01A 2NVQI 4TNUA 5AN9F 1QVGY 4NBDA 1YIJ1 3GTMS 3VB9A 2RIQA 2QKDA 5FLMI 4A3II 3GTGI 1RO4A 2OOXB 3GCFA 3I551 4MD7A 3PO2I 1YJN1 1ML8A 2ZAEB 1YITZ 2V8KA 4NBHA 3CCS1 1N2FA 2HU9A 5C3EI 2RT9A 3F3FC 3I07A 3QWUA 3VMGA 5LL6f 1VQ51 3S15I 3CC7Z 3TDHB 4HH4A 1M902 3S16I 2IZ3A 4BXXI 2G2KA 3H0GI 2IZ4A 4DK1A 3GTOI 5T64A 3U50C 1DL6A 4RS4A 1VQ7Z 4A3JI 2E9HA 3OW2Y 2KPIA 1X3WA 4A3KI 1VQ71 2I3CA 1KQSY 3CC2Z 1VQ8Z 2KI7B 1RLYA 1YIJZ 3HOUI 3CPWZ 2HF1A 3CCEZ 1RQFA 3CCJ1 2R7ZI 3VMHA 2J6AA 1YHQZ 3GTKI 1QVGZ 2M48A 1Q812 4E30A 3HOWI 3NDIA 3CMAZ 4DQYB 1W2BZ 4A3FI 4AYBA 3OW2Z 2AKLA 3I4MI 2OTJZ 3CCSZ 3I561 2DE6A 3CMA1 3S14I 4A3LI 3GTPI 2DE7A 1VQ61 1JJ2Y 1YUKA 3CC71 1YJNZ 3J7A4 3PO3S 1K9M1 1Y1VI 1K8A2 5C44I 1KD11 4RVGA 3M3YI 1YJW1 3KIHA 2OZKA 1WCMI 3CCM1 2R6MA 4MD9A 2B63I 1Y1WI 3J80f 1YJ9Z 2RHBA 5C4XI 1K731 2JA6I 3CCMZ 2NVXI 3S1MI 2JA5I 1S72Z 1VQ91 4NBCA 3PO3I 4MRIA 1Y1VS 1Q821 3CC41 2JS4A 4MH4A 4CL1A 4A3EI 2V8JA 3J80b 1RO2A 1VQPZ 2F4OA 4QTTA 3HOVI 4A3MI 3D6WA 4XX2A 3T4NB 3CXCZ 4BBRI 2RBLA 2LFUA 4RV9A 1LQLA 2VUGA 3NH4A 3P5JB 5D1OA 3CCE1 1JWHC 3I4NI 2O53A 3M4OI 3CCQZ 1VQKZ 1Q7Y1 4A3DI 2BJOA 1TWFI 2OTJ1 2JMOA 1Q7Y2 1QVFY 3TE5B 2P3YA 1M1K2 3NH8A 4NB9A 1W2BY 4X6AI 1RNIA 3IF8A 3JAMf 4NB8A 4RVHA 1YI2Z 1Q862 1VQ5Z 3S2DI 1M1K1 1VQN1 3G6E1 3VMIA 3G71Z 1P9NA 5CM2M 4E33A 3CMEZ 3G711 1USPB 2W03A 3EEDA 1KRLA 3NH5A 1TFIA 2P28A 2PMZA 3CME1 2F4MA 4HGYA 1K9M2 2JUBA 3CC4Z 3IX0A 3ESWA 4MXUA 2E2II 1WIIA 1TWAI 3FQQA 2QA41 3CPWY 1USPA 3CCQ1 4NBGA 2O4HA 1S7MA 4E32A 3CCJZ 1KD12 2Q51A 3D9XA 1VQLZ 1KC81 3S1NI 3GKQA 2DE5A 5T6BA 4E2WA 2V8IA 2VF1A 3MONA 1RO0A 2OOYB 3FKII 1YUAA 4RVFA 1PFTA 3I56Z 1VQK1 4NH1C 5T67A 3HOZI 4HGZA 1L1OC 3G4SZ 4NFRA 5IT9b 3GTJI 1VQ6Z 4Y52I 2K5RA 1I50I 1KC82 4NOZA 3I55Z 4NBAA 1K83I 3G4S1 2YADA 2M6NA 3HOYI 1KQSZ 4BY1I 3G6EZ 2E2JI 1TWHI 3FQMA 1NP6A 1YJWZ 2PM9A 5FLXf 1ZB9A 1YI21 1I6HI 4A93I 3S2HI 2QEXZ 3CCV1 2QR1B 1TWGI 1ZH1A 2W04A 2NVTI 3J81b 3VTNA 1YJ91 1VQNZ 2GTHA 3J81f 3GTMI 1Q861 4A3BI 1VQ9Z 3S1RI 1X0TA 1ZB8A 2YU9I 3K7AI 2VUMI 1SFOI 3RZDI 2R93I 4MD8A 1R9TI 3CCL1 1VQP1 2QLVB 2JR6A 3BG0B 2JA8I 4A3CI 4E2YA 5IT9f 2OTL1 2H85A 3BG1B 4Y7NI 2JA7I 3CCUZ 3MZLB 1VQ81 4A3GI 5IP9I 3H3VJ 3GTLI 4RVDA 2GTIA 1VQM1 1VQO1 2K3RA 3S17I 3CCRZ 3IFUA 3LUSA 1VQ41 1NJI1 1K732 2RPRA 4NBEA 2NVYI 3NFZA 1QF8A 3NDJA 1NUIA 5C4JI 3CCR1 1VQ4Z 3MZKB 3EERA 2QRDB 1QYPA 4DGLA 1WW9A 3CD61 1QVFZ 2Q4ZA 1M901 4BY7I 1K8A1 1YIT1 4E31A 3CXCY 3CD6Z 3HKZA 2JNYA 4S1TA 2QEX1 1N8R1 2R92I 3CQZI 2QREB 4MONA 4E2ZA 1TWCI 2E2HI 1JJ2Z 5D1OB 1X3ZA 3CCVZ 2QRCB 4NBFA 4EWCA 1Q822 2GU2A 1Z03A 4E2XA 1VLAA 5A2Qb 3RZOI 1S721
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF I;  1ZB9 A;  2PK7 A;  1I6H I;  4BBS I;  3S1Q I;  4A93 I;  3S2H I;  1RLY A;  2NVT I;  1TWG I;  3HOU I;  2HF1 A;  5IP7 I;  2P3Y A;  2R7Z I;  3VMH A;  2J6A A;  3GTK I;  4NB9 A;  4X6A I;  3GTM I;  3HOW I;  3Q87 A;  4A3B I;  4NB8 A;  4A3F I;  3S1R I;  1ZB8 A;  3S2D I;  2YU9 I;  2AKL A;  4QTU A;  3I4M I;  3K7A I;  2DE6 A;  2VUM I;  3S14 I;  1SFO I;  4A3L I;  3RZD I;  2R93 I;  3GTP I;  1R9T I;  2DE7 A;  3GTQ I;  3VMI A;  4NBB A;  3HOX I;  1I3Q I;  2JR6 A;  2NVQ I;  2JA8 I;  4A3C I;  3PO3 S;  5CM2 M;  1Y1V I;  5C44 I;  1USP B;  4NBD A;  4Y7N I;  2JA7 I;  3M3Y I;  3GTM S;  4A3G I;  3VB9 A;  5IP9 I;  1TFI A;  5FLM I;  4A3I I;  3H3V J;  3GTL I;  1WCM I;  3GTG I;  1RO4 A;  3GCF A;  2F4M A;  2B63 I;  3S17 I;  3LUS A;  1Y1W I;  3PO2 I;  1ML8 A;  3ESW A;  5C4X I;  2JA6 I;  2E2I I;  4NBH A;  4NBE A;  2NVY I;  1N2F A;  2NVX I;  3S1M I;  5C3E I;  1NUI A;  5C4J I;  2JA5 I;  1TWA I;  3EER A;  3I07 A;  1QYP A;  3VMG A;  4NBC A;  1WW9 A;  1USP A;  4NBG A;  3PO3 I;  3S15 I;  1Y1V S;  2JS4 A;  4MH4 A;  4A3E I;  4BY7 I;  3S16 I;  3S1N I;  3GKQ A;  2DE5 A;  2JNY A;  2R92 I;  2F4O A;  3CQZ I;  4BXX I;  4QTT A;  3HOV I;  4A3M I;  3D6W A;  3FKI I;  4XX2 A;  1TWC I;  4BBR I;  1YUA A;  3H0G I;  1PFT A;  2RBL A;  2E2H I;  3GTO I;  3HOZ I;  1LQL A;  1L1O C;  3GTJ I;  1X3Z A;  3U50 C;  4Y52 I;  2K5R A;  1I50 I;  1DL6 A;  4A3J I;  4NOZ A;  2KPI A;  4NBA A;  1X3W A;  3I4N I;  1K83 I;  3HOY I;  3M4O I;  4NBF A;  4A3K I;  4BY1 I;  2E2J I;  1TWH I;  4A3D I;  1VLA A;  3RZO I;  2BJO A; 
#chains in the Genus database with same CATH topology
 2PK7 A;  2OTL Z;  3F3P C;  3JAM b;  4BBS I;  2LIY A;  2Y0S A;  3S1Q I;  5IP7 I;  5D1P A;  2EGT A;  3CCL Z;  1Z02 A;  3Q87 A;  3CC2 1;  2QA4 Z;  5FLX b;  2WAQ A;  4QTU A;  5A2Q f;  1Q81 1;  3CCU 1;  1VQL 1;  3KIF A;  3GTQ I;  4NBB A;  1YHQ 1;  2WB1 A;  3HOX I;  1VQM Z;  1VQO Z;  1I3Q I;  1NJI 2;  1N8R 2;  1Z01 A;  2NVQ I;  1Q16 A;  4TNU A;  5AN9 F;  1QVG Y;  2E7Z A;  4NBD A;  1YIJ 1;  3GTM S;  3VB9 A;  2RIQ A;  2QKD A;  5FLM I;  4A3I I;  3GTG I;  1RO4 A;  2OOX B;  3GCF A;  3I55 1;  4MD7 A;  3PO2 I;  1YJN 1;  1ML8 A;  2ZAE B;  1YIT Z;  2V8K A;  4NBH A;  3CCS 1;  1N2F A;  2HU9 A;  1WZN A;  5C3E I;  2RT9 A;  3F3F C;  3I07 A;  3QWU A;  3VMG A;  5LL6 f;  1VQ5 1;  3S15 I;  3CC7 Z;  3TDH B;  4HH4 A;  1M90 2;  3S16 I;  2IZ3 A;  4BXX I;  2G2K A;  3H0G I;  2IZ4 A;  4DK1 A;  3GTO I;  5T64 A;  3U50 C;  1DL6 A;  4RS4 A;  1VQ7 Z;  4A3J I;  2E9H A;  3OW2 Y;  2KPI A;  1X3W A;  4A3K I;  2V45 A;  1VQ7 1;  2I3C A;  1KQS Y;  3CC2 Z;  1VQ8 Z;  2LEX A;  2KI7 B;  1RLY A;  2V3V A;  1YIJ Z;  3HOU I;  3CPW Z;  2HF1 A;  3CCE Z;  1RQF A;  3CCJ 1;  2R7Z I;  3VMH A;  2J6A A;  1YHQ Z;  3GTK I;  1QVG Z;  2M48 A;  1Q81 2;  4E30 A;  3HOW I;  3NDI A;  1AA6 A;  3CMA Z;  4DQY B;  1W2B Z;  4A3F I;  4AYB A;  3OW2 Z;  2AKL A;  3I4M I;  2OTJ Z;  3CCS Z;  3I56 1;  2DE6 A;  3CMA 1;  3S14 I;  4A3L I;  3GTP I;  2DE7 A;  1VQ6 1;  1JJ2 Y;  1YUK A;  3CC7 1;  1YJN Z;  3J7A 4;  3PO3 S;  1K9M 1;  1Y1V I;  1K8A 2;  5C44 I;  1KD1 1;  4RVG A;  3M3Y I;  1YJW 1;  3KIH A;  2OZK A;  1WCM I;  3CCM 1;  2R6M A;  4MD9 A;  2B63 I;  1Y1W I;  3J80 f;  1YJ9 Z;  2RHB A;  5C4X I;  1K73 1;  2JA6 I;  3CCM Z;  2NVX I;  3S1M I;  2JA5 I;  2AYD A;  1S72 Z;  1VQ9 1;  2JIP A;  4NBC A;  3PO3 I;  4MRI A;  1Y1V S;  1Q82 1;  3CC4 1;  2JS4 A;  4MH4 A;  4CL1 A;  4A3E I;  2V8J A;  3J80 b;  1RO2 A;  1WJ2 A;  1VQP Z;  2F4O A;  4QTT A;  3HOV I;  4A3M I;  3D6W A;  4XX2 A;  3T4N B;  3CXC Z;  2JIO A;  4BBR I;  2RBL A;  2LFU A;  4RV9 A;  1LQL A;  2VPZ A;  2VUG A;  1FDO A;  1Y8C A;  3NH4 A;  3P5J B;  5D1O A;  3CCE 1;  1JWH C;  3I4N I;  1QXF A;  2VPY A;  2O53 A;  3M4O I;  2VPW A;  3CCQ Z;  1VQK Z;  1Q7Y 1;  4A3D I;  2BJO A;  1TWF I;  2OTJ 1;  2JMO A;  1Q7Y 2;  1QVF Y;  3TE5 B;  2P3Y A;  1M1K 2;  3NH8 A;  4NB9 A;  1W2B Y;  4X6A I;  1RNI A;  3IF8 A;  2JIR A;  3JAM f;  4NB8 A;  4RVH A;  1YI2 Z;  1Q86 2;  1VQ5 Z;  3S2D I;  1FDI A;  1M1K 1;  1VQN 1;  3G6E 1;  3VMI A;  3G71 Z;  1P9N A;  5CM2 M;  3CME Z;  4E33 A;  3G71 1;  1USP B;  2W03 A;  3EED A;  1KRL A;  3NH5 A;  1TFI A;  2P28 A;  2PMZ A;  3CME 1;  2F4M A;  4HGY A;  1K9M 2;  2JUB A;  3CC4 Z;  3IX0 A;  3ESW A;  4MXU A;  2E2I I;  1WII A;  1TWA I;  3FQQ A;  2QA4 1;  3CPW Y;  1USP A;  3CCQ 1;  4NBG A;  2O4H A;  1S7M A;  4E32 A;  3CCJ Z;  1KD1 2;  2Q51 A;  3D9X A;  1VQL Z;  1KC8 1;  3S1N I;  3GKQ A;  2DE5 A;  5T6B A;  4E2W A;  2V8I A;  2VF1 A;  3MON A;  1RO0 A;  2OOY B;  3FKI I;  1YUA A;  4RVF A;  1PFT A;  3I56 Z;  1VQK 1;  3D2L A;  4NH1 C;  5T67 A;  3HOZ I;  4HGZ A;  1L1O C;  3G4S Z;  4NFR A;  5IT9 b;  3GTJ I;  1VQ6 Z;  4Y52 I;  2K5R A;  1I50 I;  1KC8 2;  4NOZ A;  3I55 Z;  4NBA A;  1K83 I;  3G4S 1;  2YAD A;  2M6N A;  3HOY I;  1KQS Z;  4BY1 I;  3G6E Z;  2E2J I;  1TWH I;  3FQM A;  1NP6 A;  1YJW Z;  2PM9 A;  5FLX f;  1ZB9 A;  1YI2 1;  1I6H I;  4A93 I;  3S2H I;  2QEX Z;  3CCV 1;  2QR1 B;  1TWG I;  1ZH1 A;  2W04 A;  2NVT I;  3J81 b;  3VTN A;  1YJ9 1;  1VQN Z;  2GTH A;  3J81 f;  2NAP A;  3GTM I;  1Q86 1;  4A3B I;  1VQ9 Z;  3S1R I;  1X0T A;  1ZB8 A;  2YU9 I;  3IR7 A;  3K7A I;  2VUM I;  1SFO I;  3RZD I;  2R93 I;  4MD8 A;  1R9T I;  3CCL 1;  1VQP 1;  2QLV B;  2JR6 A;  3BG0 B;  2JA8 I;  4A3C I;  4E2Y A;  5IT9 f;  2OTL 1;  2H85 A;  3BG1 B;  4Y7N I;  2JA7 I;  3CCU Z;  3MZL B;  1VQ8 1;  4A3G I;  5IP9 I;  3H3V J;  3GTL I;  4RVD A;  2GTI A;  1SIW A;  1VQM 1;  1VQO 1;  2K3R A;  3S17 I;  3CCR Z;  3IFU A;  3LUS A;  1VQ4 1;  1NJI 1;  1K73 2;  2RPR A;  4NBE A;  2NVY I;  3NFZ A;  1QF8 A;  3NDJ A;  1NUI A;  5C4J I;  3CCR 1;  1VQ4 Z;  3MZK B;  3EER A;  2QRD B;  1QYP A;  2IV2 X;  4DGL A;  1WW9 A;  3CD6 1;  1QVF Z;  2Q4Z A;  1M90 1;  4BY7 I;  1K8A 1;  1YIT 1;  4E31 A;  3CXC Y;  3CD6 Z;  3HKZ A;  2JNY A;  4S1T A;  2QEX 1;  1N8R 1;  2R92 I;  3CQZ I;  2QRE B;  4MON A;  4E2Z A;  1TWC I;  2E2H I;  1JJ2 Z;  5D1O B;  1X3Z A;  3CCV Z;  2QRC B;  2JIQ A;  4NBF A;  4EWC A;  1Q82 2;  2GU2 A;  2VPX A;  1Z03 A;  4E2X A;  2JIM A;  1VLA A;  5A2Q b;  3RZO I;  1S72 1; 
#chains in the Genus database with same CATH homology
 2PK7 A;  2OTL Z;  3F3P C;  3JAM b;  4BBS I;  2LIY A;  2Y0S A;  3S1Q I;  5IP7 I;  5D1P A;  2EGT A;  3CCL Z;  1Z02 A;  3Q87 A;  3CC2 1;  2QA4 Z;  5FLX b;  2WAQ A;  4QTU A;  5A2Q f;  1Q81 1;  3CCU 1;  1VQL 1;  3KIF A;  3GTQ I;  4NBB A;  1YHQ 1;  2WB1 A;  3HOX I;  1VQM Z;  1VQO Z;  1I3Q I;  1NJI 2;  1N8R 2;  1Z01 A;  2NVQ I;  4TNU A;  5AN9 F;  1QVG Y;  4NBD A;  1YIJ 1;  3GTM S;  3VB9 A;  2RIQ A;  2QKD A;  5FLM I;  4A3I I;  3GTG I;  1RO4 A;  2OOX B;  3GCF A;  3I55 1;  4MD7 A;  3PO2 I;  1YJN 1;  1ML8 A;  2ZAE B;  1YIT Z;  2V8K A;  4NBH A;  3CCS 1;  1N2F A;  2HU9 A;  5C3E I;  2RT9 A;  3F3F C;  3I07 A;  3QWU A;  3VMG A;  5LL6 f;  1VQ5 1;  3S15 I;  3CC7 Z;  3TDH B;  4HH4 A;  1M90 2;  3S16 I;  2IZ3 A;  4BXX I;  2G2K A;  3H0G I;  2IZ4 A;  4DK1 A;  3GTO I;  5T64 A;  3U50 C;  1DL6 A;  4RS4 A;  1VQ7 Z;  4A3J I;  2E9H A;  3OW2 Y;  2KPI A;  1X3W A;  4A3K I;  1VQ7 1;  2I3C A;  1KQS Y;  3CC2 Z;  1VQ8 Z;  2KI7 B;  1RLY A;  1YIJ Z;  3HOU I;  3CPW Z;  2HF1 A;  3CCE Z;  1RQF A;  3CCJ 1;  2R7Z I;  3VMH A;  2J6A A;  1YHQ Z;  3GTK I;  1QVG Z;  2M48 A;  1Q81 2;  4E30 A;  3HOW I;  3NDI A;  3CMA Z;  4DQY B;  1W2B Z;  4A3F I;  4AYB A;  3OW2 Z;  2AKL A;  3I4M I;  2OTJ Z;  3CCS Z;  3I56 1;  2DE6 A;  3CMA 1;  3S14 I;  4A3L I;  3GTP I;  2DE7 A;  1VQ6 1;  1JJ2 Y;  1YUK A;  3CC7 1;  1YJN Z;  3J7A 4;  3PO3 S;  1K9M 1;  1Y1V I;  1K8A 2;  5C44 I;  1KD1 1;  4RVG A;  3M3Y I;  1YJW 1;  3KIH A;  2OZK A;  1WCM I;  3CCM 1;  2R6M A;  4MD9 A;  2B63 I;  1Y1W I;  3J80 f;  1YJ9 Z;  2RHB A;  5C4X I;  1K73 1;  2JA6 I;  3CCM Z;  2NVX I;  3S1M I;  2JA5 I;  1S72 Z;  1VQ9 1;  4NBC A;  3PO3 I;  4MRI A;  1Y1V S;  1Q82 1;  3CC4 1;  2JS4 A;  4MH4 A;  4CL1 A;  4A3E I;  2V8J A;  3J80 b;  1RO2 A;  1VQP Z;  2F4O A;  4QTT A;  3HOV I;  4A3M I;  3D6W A;  4XX2 A;  3T4N B;  3CXC Z;  4BBR I;  2RBL A;  2LFU A;  4RV9 A;  1LQL A;  2VUG A;  3NH4 A;  3P5J B;  5D1O A;  3CCE 1;  1JWH C;  3I4N I;  2O53 A;  3M4O I;  3CCQ Z;  1VQK Z;  1Q7Y 1;  4A3D I;  2BJO A;  1TWF I;  2OTJ 1;  2JMO A;  1Q7Y 2;  1QVF Y;  3TE5 B;  2P3Y A;  1M1K 2;  3NH8 A;  4NB9 A;  1W2B Y;  4X6A I;  1RNI A;  3IF8 A;  3JAM f;  4NB8 A;  4RVH A;  1YI2 Z;  1Q86 2;  1VQ5 Z;  3S2D I;  1M1K 1;  1VQN 1;  3G6E 1;  3VMI A;  3G71 Z;  1P9N A;  5CM2 M;  4E33 A;  3CME Z;  3G71 1;  1USP B;  2W03 A;  3EED A;  1KRL A;  3NH5 A;  1TFI A;  2P28 A;  2PMZ A;  3CME 1;  2F4M A;  4HGY A;  1K9M 2;  2JUB A;  3CC4 Z;  3IX0 A;  3ESW A;  4MXU A;  2E2I I;  1WII A;  1TWA I;  3FQQ A;  2QA4 1;  3CPW Y;  1USP A;  3CCQ 1;  4NBG A;  2O4H A;  1S7M A;  4E32 A;  3CCJ Z;  1KD1 2;  2Q51 A;  3D9X A;  1VQL Z;  1KC8 1;  3S1N I;  3GKQ A;  2DE5 A;  5T6B A;  4E2W A;  2V8I A;  2VF1 A;  3MON A;  1RO0 A;  2OOY B;  3FKI I;  1YUA A;  4RVF A;  1PFT A;  3I56 Z;  1VQK 1;  4NH1 C;  5T67 A;  3HOZ I;  4HGZ A;  1L1O C;  3G4S Z;  4NFR A;  5IT9 b;  3GTJ I;  1VQ6 Z;  4Y52 I;  2K5R A;  1I50 I;  1KC8 2;  4NOZ A;  3I55 Z;  4NBA A;  1K83 I;  3G4S 1;  2YAD A;  2M6N A;  3HOY I;  1KQS Z;  4BY1 I;  3G6E Z;  2E2J I;  1TWH I;  3FQM A;  1NP6 A;  1YJW Z;  2PM9 A;  5FLX f;  1ZB9 A;  1YI2 1;  1I6H I;  4A93 I;  3S2H I;  2QEX Z;  3CCV 1;  2QR1 B;  1TWG I;  1ZH1 A;  2W04 A;  2NVT I;  3J81 b;  3VTN A;  1YJ9 1;  1VQN Z;  2GTH A;  3J81 f;  3GTM I;  1Q86 1;  4A3B I;  1VQ9 Z;  3S1R I;  1X0T A;  1ZB8 A;  2YU9 I;  3K7A I;  2VUM I;  1SFO I;  3RZD I;  2R93 I;  4MD8 A;  1R9T I;  3CCL 1;  1VQP 1;  2QLV B;  2JR6 A;  3BG0 B;  2JA8 I;  4A3C I;  4E2Y A;  5IT9 f;  2OTL 1;  2H85 A;  3BG1 B;  4Y7N I;  2JA7 I;  3CCU Z;  3MZL B;  1VQ8 1;  4A3G I;  5IP9 I;  3H3V J;  3GTL I;  4RVD A;  2GTI A;  1VQM 1;  1VQO 1;  2K3R A;  3S17 I;  3CCR Z;  3IFU A;  3LUS A;  1VQ4 1;  1NJI 1;  1K73 2;  2RPR A;  4NBE A;  2NVY I;  3NFZ A;  1QF8 A;  3NDJ A;  1NUI A;  5C4J I;  3CCR 1;  1VQ4 Z;  3MZK B;  3EER A;  2QRD B;  1QYP A;  4DGL A;  1WW9 A;  3CD6 1;  1QVF Z;  2Q4Z A;  1M90 1;  4BY7 I;  1K8A 1;  1YIT 1;  4E31 A;  3CXC Y;  3CD6 Z;  3HKZ A;  2JNY A;  4S1T A;  2QEX 1;  1N8R 1;  2R92 I;  3CQZ I;  2QRE B;  4MON A;  4E2Z A;  1TWC I;  2E2H I;  1JJ2 Z;  5D1O B;  1X3Z A;  3CCV Z;  2QRC B;  4NBF A;  4EWC A;  1Q82 2;  2GU2 A;  1Z03 A;  4E2X A;  1VLA A;  5A2Q b;  3RZO I;  1S72 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...