1Q7Y2

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q7y200
3CCUZ 1Q862 1YI21 3CMEZ 1YIJ1 3CMA1 3CCV1 1YJ91 1VQ71 1VQ41 1M1K2 3CCM1 3CCEZ 3CCQZ 1K732 1KC81 3CPWY 3G6E1 1YJNZ 1VQMZ 1YITZ 3G4SZ 1VQNZ 3G711 1Q811 1QVGY 1VQOZ 1K8A1 3CCJ1 3CC2Z 3CD6Z 1S72Z 1KD11 3I551 3CCE1 3CC7Z 1Q7Y1 1YJWZ 1KQSZ 1KQSY 2QEXZ 2OTLZ 1VQ91 1Q7Y2 3CCRZ 1YIT1 1VQLZ 1VQ5Z 3CCS1 3CPWZ 1JJ2Y 1JJ2Z 1N8R1 1KC82 1K9M1 1VQ6Z 3CCU1 1QVGZ 1N8R2 1VQKZ 3CME1 1YHQZ 2QA4Z 1K9M2 3CCLZ 1Q812 1QVFY 3CXCY 3CXCZ 1K8A2 1QVFZ 2OTL1 1KD12 3CCQ1 3CCR1 1YIJZ 1VQPZ 2OTJZ 1M901 1VQ7Z 1YJ9Z 1VQ4Z 1Q821 1YJN1 1VQM1 3I56Z 3G4S1 1W2BY 1W2BZ 1VQN1 1VQO1 3CC21 1VQ8Z 3CD61 3G6EZ 1Q861 1S721 3CC4Z 3G71Z 3CCJZ 3CC71 1NJI1 1M1K1 1YJW1 1K731 3I55Z 1VQP1 2OTJ1 2QEX1 1NJI2 1YI2Z 3CMAZ 3I561 3CCVZ 3OW2Z 3OW2Y 1VQL1 1VQ51 1VQ81 1VQ9Z 3CCMZ 1VQ61 1M902 3CC41 1Q822 3CCSZ 1VQK1 1YHQ1 2QA41 3CCL1
chains in the Genus database with same CATH superfamily
3RZDI 3CCUZ 1YI21 3GTOI 4NBDA 2JA8I 3M3YI 1VQ71 2QRDB 1M1K2 2JIMA 2ZAEB 1KC81 1TWAI 4RVFA 2OZKA 3G4SZ 4RVGA 3VMIA 1VQNZ 1VQOZ 1K8A1 1Q16A 2GU2A 1I3QI 3IF8A 4A3GI 3CCE1 2LFUA 2F4OA 3CC7Z 1KQSY 3GKQA 3NH8A 3I4NI 1RLYA 1I6HI 3M4OI 1YIT1 3FQMA 2QLVB 2JA5I 3S15I 2GTHA 2IV2X 2J6AA 3S16I 3PO3I 2K5RA 2V8IA 1K9M1 3P5JB 3EERA 4HGZA 1QYPA 3FQQA 1YUAA 4HH4A 2RBLA 1QVFZ 3CXCY 2RT9A 2OTL1 3GTLI 3QWUA 3TDHB 1QXFA 3CCR1 1RO2A 4A3LI 2QREB 1VQPZ 2E2JI 1VQ7Z 1KRLA 3HOZI 4S1TA 2G2KA 3LUSA 3S1NI 1VQ8Z 3F3FC 3S17I 3D6WA 4NBEA 2QKDA 3EEDA 4NBBA 4QTUA 4E33A 2V45A 2V8JA 1M1K1 2I3CA 5IT9f 3PO2I 1NJI2 4MXUA 3NDIA 2PK7A 1RQFA 4NFRA 4RV9A 2IZ4A 1K83I 3CCMZ 4XX2A 5C44I 1YHQ1 2P3YA 3U50C 2QA41 3TE5B 3GCFA 2PMZA 4A3DI 1Q862 5IP9I 1ML8A 4A93I 3CMA1 3CCV1 3J7A4 2K3RA 2KI7B 1TWGI 4E2ZA 5C3EI 3CPWY 5AN9F 1Z02A 3J80f 3CQZI 1SIWA 3G711 1QVGY 1USPA 3CCJ1 3D9XA 3I551 3GTMS 1RO4A 3PO3S 5D1PA 1WW9A 5IT9b 3HOYI 1VQ91 1Q7Y2 1NUIA 3GTJI 3HOXI 3CPWZ 3VTNA 2R92I 1L1OC 2JMOA 2JIQA 3S14I 4BY7I 1QVGZ 1N8R2 1YHQZ 2QA4Z 3S1QI 2JA6I 3JAMf 1NP6A 1Q812 1QVFY 2NVYI 4TNUA 2YADA 1KD12 3CCQ1 1Z03A 3FKII 5C4JI 4AYBA 2JNYA 1VQM1 2WAQA 2PM9A 5D1OA 3I4MI 1W2BZ 3GTMI 3CC21 5LL6f 2E7ZA 4EWCA 3J80b 1Q861 2DE7A 2B63I 4MD7A 2IZ3A 3J81f 3CC4Z 4A3KI 3G71Z 3KIHA 1N2FA 3CCJZ 4E32A 1YJW1 3I55Z 1TWFI 3BG0B 2LEXA 2OTJ1 2V3VA 2JR6A 4A3CI 1YI2Z 2BJOA 2P28A 1I50I 3I561 3OW2Z 1VQ51 4BBRI 2NVQI 1WZNA 1VQ9Z 4Y52I 2QRCB 1VQ61 4E30A 2RIQA 1ZB8A 2E9HA 4DK1A 1TWCI 3MONA 2QR1B 2NVTI 3JAMb 2O4HA 3H3VJ 3GTQI 4RS4A 4A3MI 1VQ41 1WIIA 2JIOA 3CCEZ 3GTKI 4NBCA 3CCQZ 1K732 2R6MA 1X3WA 3G6E1 1VQMZ 4RVHA 1YITZ 2E2II 3VMHA 3S1RI 4NBFA 1Q811 3CC2Z 3S2HI 1KD11 2VUMI 4MONA 3J81b 1X3ZA 2AYDA 3IFUA 3H0GI 1YJWZ 1TFIA 2OTLZ 2VUGA 2OOXB 4A3EI 3CCRZ 2JIRA 2YU9I 2H85A 3NFZA 1VQ5Z 3CCS1 2VPYA 1USPB 3S2DI 1JJ2Z 3KIFA 5FLMI 3NH4A 1VQ6Z 4MD9A 3CME1 1K9M2 3GTPI 2Q51A 4NB8A 2VPXA 5CM2M 2HF1A 4E2WA 1FDIA 4E2YA 4NBGA 1VQ4Z 2DE5A 3IX0A 1YJN1 1W2BY 4QTTA 1JWHC 1Y1VS 2M48A 3CD61 3G6EZ 1RO0A 1S721 3VB9A 2EGTA 4MD8A 2Q4ZA 2OOYB 2E2HI 5T6BA 1NJI1 1K731 1VQP1 2QEX1 3Q87A 5A2Qf 2JS4A 3CMAZ 3CCVZ 5D1OB 3OW2Y 1VQL1 1S7MA 1VQ81 4NBAA 1LQLA 4A3II 1M902 2VPWA 1Q822 3T4NB 3CCSZ 1VQK1 3CCL1 2JA7I 4RVDA 1TWHI 2R93I 3NDJA 3CMEZ 4A3JI 2NVXI 1YIJ1 3F3PC 1P9NA 1Y1VI 1YJ91 4MH4A 3CCM1 3RZOI 3K7AI 4CL1A 4NOZA 1YJNZ 3HKZA 5FLXf 1AA6A 4A3FI 2RHBA 2V8KA 3D2LA 3CD6Z 2W04A 1S72Z 4X6AI 4A3BI 3IR7A 2W03A 2RPRA 4DQYB 1X0TA 1Q7Y1 2R7ZI 2Y0SA 4NBHA 1KQSZ 1R9TI 1WJ2A 2QEXZ 5A2Qb 2JIPA 2AKLA 3GTGI 1VQLZ 3ESWA 1ZH1A 1Y8CA 1JJ2Y 1N8R1 3I07A 1WCMI 1KC82 1PFTA 4NH1C 3CCU1 1VQKZ 3HOWI 3HOUI 3CCLZ 3CXCZ 1K8A2 2DE6A 3MZLB 4BXXI 3MZKB 1YIJZ 1ZB9A 4BY1I 2GTIA 1Z01A 4Y7NI 2OTJZ 2VPZA 3HOVI 1M901 1YJ9Z 1Q821 3I56Z 3G4S1 1VQN1 1FDOA 1VQO1 5T67A 4DGLA 4BBSI 2KPIA 2LIYA 5FLXb 4HGYA 2VF1A 3CC71 4MRIA 4E31A 1DL6A 5T64A 3NH5A 2NAPA 2HU9A 2F4MA 2M6NA 4NB9A 1QF8A 5IP7I 3S1MI 3VMGA 1Y1WI 2JUBA 3BG1B 1YUKA 1VLAA 3CC41 5C4XI 1SFOI 2O53A 4E2XA 2WB1A 1RNIA
chains in the Genus database with same CATH topology
3RZDI 3CCUZ 1YI21 3GTOI 4NBDA 2JA8I 3M3YI 1VQ71 2QRDB 1M1K2 2ZAEB 1KC81 1TWAI 4RVFA 2OZKA 3G4SZ 4RVGA 3VMIA 1VQNZ 1VQOZ 1K8A1 2GU2A 1I3QI 3IF8A 4A3GI 3CCE1 2LFUA 2F4OA 3CC7Z 1KQSY 3GKQA 3NH8A 3I4NI 1RLYA 1I6HI 3M4OI 1YIT1 3FQMA 2QLVB 2JA5I 3S15I 2GTHA 2J6AA 3S16I 3PO3I 2K5RA 2V8IA 1K9M1 3P5JB 3EERA 4HGZA 1QYPA 3FQQA 1YUAA 4HH4A 2RBLA 1QVFZ 3CXCY 2RT9A 2OTL1 3GTLI 3QWUA 3TDHB 3CCR1 1RO2A 4A3LI 2QREB 1VQPZ 2E2JI 1VQ7Z 1KRLA 3HOZI 4S1TA 2G2KA 3LUSA 3S1NI 1VQ8Z 3F3FC 3S17I 3D6WA 4NBEA 2QKDA 3EEDA 4NBBA 4QTUA 4E33A 2V8JA 1M1K1 2I3CA 5IT9f 3PO2I 1NJI2 4MXUA 3NDIA 2PK7A 1RQFA 4NFRA 4RV9A 2IZ4A 1K83I 3CCMZ 4XX2A 5C44I 1YHQ1 2P3YA 3U50C 2QA41 3TE5B 3GCFA 2PMZA 4A3DI 1Q862 5IP9I 1ML8A 4A93I 3CMA1 3CCV1 3J7A4 2K3RA 2KI7B 1TWGI 4E2ZA 5C3EI 3CPWY 5AN9F 1Z02A 3J80f 3CQZI 3G711 1QVGY 1USPA 3CCJ1 3D9XA 3I551 3GTMS 1RO4A 3PO3S 5D1PA 1WW9A 5IT9b 3HOYI 1VQ91 1Q7Y2 1NUIA 3GTJI 3HOXI 3CPWZ 3VTNA 2R92I 1L1OC 2JMOA 3S14I 4BY7I 1QVGZ 1N8R2 1YHQZ 2QA4Z 3S1QI 2JA6I 3JAMf 1NP6A 1Q812 1QVFY 2NVYI 4TNUA 2YADA 1KD12 3CCQ1 1Z03A 3FKII 5C4JI 4AYBA 2JNYA 1VQM1 2WAQA 2PM9A 5D1OA 3I4MI 1W2BZ 3GTMI 3CC21 5LL6f 4EWCA 3J80b 1Q861 2DE7A 2B63I 4MD7A 2IZ3A 3J81f 3CC4Z 4A3KI 3G71Z 3KIHA 1N2FA 3CCJZ 4E32A 1YJW1 3I55Z 1TWFI 3BG0B 2OTJ1 2JR6A 4A3CI 1YI2Z 2BJOA 2P28A 1I50I 3I561 3OW2Z 1VQ51 4BBRI 2NVQI 1VQ9Z 4Y52I 2QRCB 1VQ61 4E30A 2RIQA 1ZB8A 2E9HA 4DK1A 1TWCI 3MONA 2QR1B 2NVTI 3JAMb 2O4HA 3H3VJ 3GTQI 4RS4A 4A3MI 1VQ41 1WIIA 3GTKI 3CCEZ 4NBCA 3CCQZ 1K732 2R6MA 1X3WA 3G6E1 1VQMZ 4RVHA 1YITZ 2E2II 3VMHA 3S1RI 4NBFA 1Q811 3CC2Z 3S2HI 1KD11 2VUMI 4MONA 3J81b 1X3ZA 3IFUA 3H0GI 1YJWZ 1TFIA 2OTLZ 2VUGA 2OOXB 4A3EI 3CCRZ 2YU9I 2H85A 3NFZA 1VQ5Z 3CCS1 1USPB 3S2DI 1JJ2Z 3KIFA 5FLMI 3NH4A 1VQ6Z 4MD9A 3CME1 1K9M2 3GTPI 2Q51A 4NB8A 5CM2M 2HF1A 4E2WA 4E2YA 4NBGA 1VQ4Z 2DE5A 3IX0A 1YJN1 1W2BY 4QTTA 1JWHC 1Y1VS 2M48A 3CD61 3G6EZ 1RO0A 1S721 3VB9A 2EGTA 4MD8A 2Q4ZA 2OOYB 2E2HI 5T6BA 1NJI1 1K731 1VQP1 2QEX1 3Q87A 5A2Qf 2JS4A 3CMAZ 3CCVZ 3OW2Y 5D1OB 1VQL1 1S7MA 1VQ81 4NBAA 1LQLA 4A3II 1M902 1Q822 3T4NB 3CCSZ 1VQK1 3CCL1 2JA7I 4RVDA 1TWHI 2R93I 3NDJA 3CMEZ 4A3JI 2NVXI 1YIJ1 3F3PC 1P9NA 1Y1VI 1YJ91 4MH4A 3CCM1 3RZOI 3K7AI 4CL1A 4NOZA 1YJNZ 3HKZA 5FLXf 4A3FI 2RHBA 2V8KA 3CD6Z 2W04A 1S72Z 4X6AI 4A3BI 2W03A 2RPRA 4DQYB 1X0TA 1Q7Y1 2R7ZI 2Y0SA 4NBHA 1KQSZ 1R9TI 2QEXZ 5A2Qb 2AKLA 3GTGI 1VQLZ 3ESWA 1ZH1A 1JJ2Y 1N8R1 3I07A 1WCMI 1KC82 1PFTA 4NH1C 3CCU1 1VQKZ 3HOWI 3HOUI 3CCLZ 3CXCZ 1K8A2 2DE6A 3MZLB 4BXXI 3MZKB 1YIJZ 1ZB9A 4BY1I 2GTIA 1Z01A 4Y7NI 2OTJZ 3HOVI 1M901 1YJ9Z 1Q821 3I56Z 3G4S1 1VQN1 1VQO1 5T67A 4DGLA 4BBSI 2KPIA 2LIYA 5FLXb 4HGYA 2VF1A 3CC71 4MRIA 4E31A 1DL6A 5T64A 3NH5A 2HU9A 2F4MA 2M6NA 4NB9A 1QF8A 5IP7I 3S1MI 3VMGA 1Y1WI 2JUBA 3BG1B 1YUKA 1VLAA 3CC41 5C4XI 1SFOI 2O53A 4E2XA 2WB1A 1RNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Z;  1Q86 2;  1YI2 1;  3CME Z;  1YIJ 1;  3CMA 1;  3CCV 1;  1YJ9 1;  1VQ7 1;  1VQ4 1;  1M1K 2;  3CCM 1;  3CCE Z;  3CCQ Z;  1K73 2;  1KC8 1;  3CPW Y;  3G6E 1;  1YJN Z;  1VQM Z;  1YIT Z;  3G4S Z;  1VQN Z;  3G71 1;  1Q81 1;  1QVG Y;  1VQO Z;  1K8A 1;  3CCJ 1;  3CC2 Z;  3CD6 Z;  1S72 Z;  1KD1 1;  3I55 1;  3CCE 1;  3CC7 Z;  1Q7Y 1;  1YJW Z;  1KQS Z;  1KQS Y;  2QEX Z;  2OTL Z;  1VQ9 1;  1Q7Y 2;  3CCR Z;  1YIT 1;  1VQL Z;  1VQ5 Z;  3CCS 1;  3CPW Z;  1JJ2 Y;  1JJ2 Z;  1N8R 1;  1KC8 2;  1K9M 1;  1VQ6 Z;  3CCU 1;  1QVG Z;  1N8R 2;  1VQK Z;  3CME 1;  1YHQ Z;  2QA4 Z;  1K9M 2;  3CCL Z;  1Q81 2;  1QVF Y;  3CXC Y;  3CXC Z;  1K8A 2;  1QVF Z;  2OTL 1;  1KD1 2;  3CCQ 1;  3CCR 1;  1YIJ Z;  1VQP Z;  2OTJ Z;  1M90 1;  1VQ7 Z;  1YJ9 Z;  1VQ4 Z;  1Q82 1;  1YJN 1;  1VQM 1;  3I56 Z;  3G4S 1;  1W2B Y;  1W2B Z;  1VQN 1;  1VQO 1;  3CC2 1;  1VQ8 Z;  3CD6 1;  3G6E Z;  1Q86 1;  1S72 1;  3CC4 Z;  3G71 Z;  3CCJ Z;  3CC7 1;  1NJI 1;  1M1K 1;  1YJW 1;  1K73 1;  3I55 Z;  1VQP 1;  2OTJ 1;  2QEX 1;  1NJI 2;  1YI2 Z;  3CMA Z;  3I56 1;  3CCV Z;  3OW2 Z;  3OW2 Y;  1VQL 1;  1VQ5 1;  1VQ8 1;  1VQ9 Z;  3CCM Z;  1VQ6 1;  1M90 2;  3CC4 1;  1Q82 2;  3CCS Z;  1VQK 1;  1YHQ 1;  2QA4 1;  3CCL 1; 
#chains in the Genus database with same CATH topology
 3RZD I;  3CCU Z;  1YI2 1;  3GTO I;  4NBD A;  2JA8 I;  3M3Y I;  1VQ7 1;  2QRD B;  1M1K 2;  2JIM A;  2ZAE B;  1KC8 1;  1TWA I;  4RVF A;  2OZK A;  3G4S Z;  4RVG A;  3VMI A;  1VQN Z;  1VQO Z;  1K8A 1;  1Q16 A;  2GU2 A;  1I3Q I;  3IF8 A;  4A3G I;  3CCE 1;  2LFU A;  2F4O A;  3CC7 Z;  1KQS Y;  3GKQ A;  3NH8 A;  3I4N I;  1RLY A;  1I6H I;  3M4O I;  1YIT 1;  3FQM A;  2QLV B;  2JA5 I;  3S15 I;  2GTH A;  2IV2 X;  2J6A A;  3S16 I;  3PO3 I;  2K5R A;  2V8I A;  1K9M 1;  3P5J B;  3EER A;  4HGZ A;  1QYP A;  3FQQ A;  1YUA A;  4HH4 A;  2RBL A;  1QVF Z;  3CXC Y;  2RT9 A;  2OTL 1;  3GTL I;  3QWU A;  3TDH B;  1QXF A;  3CCR 1;  1RO2 A;  4A3L I;  2QRE B;  1VQP Z;  2E2J I;  1VQ7 Z;  1KRL A;  3HOZ I;  4S1T A;  2G2K A;  3LUS A;  3S1N I;  1VQ8 Z;  3F3F C;  3S17 I;  3D6W A;  4NBE A;  2QKD A;  3EED A;  4NBB A;  4QTU A;  4E33 A;  2V45 A;  2V8J A;  1M1K 1;  2I3C A;  5IT9 f;  3PO2 I;  1NJI 2;  4MXU A;  3NDI A;  2PK7 A;  1RQF A;  4NFR A;  4RV9 A;  2IZ4 A;  1K83 I;  3CCM Z;  4XX2 A;  5C44 I;  1YHQ 1;  2P3Y A;  3U50 C;  2QA4 1;  3TE5 B;  3GCF A;  2PMZ A;  4A3D I;  1Q86 2;  5IP9 I;  1ML8 A;  4A93 I;  3CMA 1;  3CCV 1;  3J7A 4;  2K3R A;  2KI7 B;  1TWG I;  4E2Z A;  5C3E I;  3CPW Y;  5AN9 F;  1Z02 A;  3J80 f;  3CQZ I;  1SIW A;  3G71 1;  1QVG Y;  1USP A;  3CCJ 1;  3D9X A;  3I55 1;  3GTM S;  1RO4 A;  3PO3 S;  5D1P A;  1WW9 A;  5IT9 b;  3HOY I;  1VQ9 1;  1Q7Y 2;  1NUI A;  3GTJ I;  3HOX I;  3CPW Z;  3VTN A;  2R92 I;  1L1O C;  2JMO A;  2JIQ A;  3S14 I;  4BY7 I;  1QVG Z;  1N8R 2;  1YHQ Z;  2QA4 Z;  3S1Q I;  2JA6 I;  3JAM f;  1NP6 A;  1Q81 2;  1QVF Y;  2NVY I;  4TNU A;  2YAD A;  1KD1 2;  3CCQ 1;  1Z03 A;  3FKI I;  5C4J I;  4AYB A;  2JNY A;  1VQM 1;  2WAQ A;  2PM9 A;  5D1O A;  3I4M I;  1W2B Z;  3GTM I;  3CC2 1;  5LL6 f;  2E7Z A;  4EWC A;  3J80 b;  1Q86 1;  2DE7 A;  2B63 I;  4MD7 A;  2IZ3 A;  3J81 f;  3CC4 Z;  4A3K I;  3G71 Z;  3KIH A;  1N2F A;  3CCJ Z;  4E32 A;  1YJW 1;  3I55 Z;  1TWF I;  3BG0 B;  2LEX A;  2OTJ 1;  2V3V A;  2JR6 A;  4A3C I;  1YI2 Z;  2BJO A;  2P28 A;  1I50 I;  3I56 1;  3OW2 Z;  1VQ5 1;  4BBR I;  2NVQ I;  1WZN A;  1VQ9 Z;  4Y52 I;  2QRC B;  1VQ6 1;  4E30 A;  2RIQ A;  1ZB8 A;  2E9H A;  4DK1 A;  1TWC I;  3MON A;  2QR1 B;  2NVT I;  3JAM b;  2O4H A;  3H3V J;  3GTQ I;  4RS4 A;  4A3M I;  1VQ4 1;  1WII A;  2JIO A;  3CCE Z;  3GTK I;  4NBC A;  3CCQ Z;  1K73 2;  2R6M A;  1X3W A;  3G6E 1;  1VQM Z;  4RVH A;  1YIT Z;  2E2I I;  3VMH A;  3S1R I;  4NBF A;  1Q81 1;  3CC2 Z;  3S2H I;  1KD1 1;  2VUM I;  4MON A;  3J81 b;  1X3Z A;  2AYD A;  3IFU A;  3H0G I;  1YJW Z;  1TFI A;  2OTL Z;  2VUG A;  2OOX B;  4A3E I;  3CCR Z;  2JIR A;  2YU9 I;  2H85 A;  3NFZ A;  1VQ5 Z;  3CCS 1;  2VPY A;  1USP B;  3S2D I;  1JJ2 Z;  3KIF A;  5FLM I;  3NH4 A;  1VQ6 Z;  4MD9 A;  3CME 1;  1K9M 2;  3GTP I;  2Q51 A;  4NB8 A;  2VPX A;  5CM2 M;  2HF1 A;  4E2W A;  1FDI A;  4E2Y A;  4NBG A;  1VQ4 Z;  2DE5 A;  3IX0 A;  1YJN 1;  1W2B Y;  4QTT A;  1JWH C;  1Y1V S;  2M48 A;  3CD6 1;  3G6E Z;  1RO0 A;  1S72 1;  3VB9 A;  2EGT A;  4MD8 A;  2Q4Z A;  2OOY B;  2E2H I;  5T6B A;  1NJI 1;  1K73 1;  1VQP 1;  2QEX 1;  3Q87 A;  5A2Q f;  2JS4 A;  3CMA Z;  3CCV Z;  5D1O B;  3OW2 Y;  1VQL 1;  1S7M A;  1VQ8 1;  4NBA A;  1LQL A;  4A3I I;  1M90 2;  2VPW A;  1Q82 2;  3T4N B;  3CCS Z;  1VQK 1;  3CCL 1;  2JA7 I;  4RVD A;  1TWH I;  2R93 I;  3NDJ A;  3CME Z;  4A3J I;  2NVX I;  1YIJ 1;  3F3P C;  1P9N A;  1Y1V I;  1YJ9 1;  4MH4 A;  3CCM 1;  3RZO I;  3K7A I;  4CL1 A;  4NOZ A;  1YJN Z;  3HKZ A;  5FLX f;  1AA6 A;  4A3F I;  2RHB A;  2V8K A;  3D2L A;  3CD6 Z;  2W04 A;  1S72 Z;  4X6A I;  4A3B I;  3IR7 A;  2W03 A;  2RPR A;  4DQY B;  1X0T A;  1Q7Y 1;  2R7Z I;  2Y0S A;  4NBH A;  1KQS Z;  1R9T I;  1WJ2 A;  2QEX Z;  5A2Q b;  2JIP A;  2AKL A;  3GTG I;  1VQL Z;  3ESW A;  1ZH1 A;  1Y8C A;  1JJ2 Y;  1N8R 1;  3I07 A;  1WCM I;  1KC8 2;  1PFT A;  4NH1 C;  3CCU 1;  1VQK Z;  3HOW I;  3HOU I;  3CCL Z;  3CXC Z;  1K8A 2;  2DE6 A;  3MZL B;  4BXX I;  3MZK B;  1YIJ Z;  1ZB9 A;  4BY1 I;  2GTI A;  1Z01 A;  4Y7N I;  2OTJ Z;  2VPZ A;  3HOV I;  1M90 1;  1YJ9 Z;  1Q82 1;  3I56 Z;  3G4S 1;  1VQN 1;  1FDO A;  1VQO 1;  5T67 A;  4DGL A;  4BBS I;  2KPI A;  2LIY A;  5FLX b;  4HGY A;  2VF1 A;  3CC7 1;  4MRI A;  4E31 A;  1DL6 A;  5T64 A;  3NH5 A;  2NAP A;  2HU9 A;  2F4M A;  2M6N A;  4NB9 A;  1QF8 A;  5IP7 I;  3S1M I;  3VMG A;  1Y1W I;  2JUB A;  3BG1 B;  1YUK A;  1VLA A;  3CC4 1;  5C4X I;  1SFO I;  2O53 A;  4E2X A;  2WB1 A;  1RNI A; 
#chains in the Genus database with same CATH homology
 3RZD I;  3CCU Z;  1YI2 1;  3GTO I;  4NBD A;  2JA8 I;  3M3Y I;  1VQ7 1;  2QRD B;  1M1K 2;  2ZAE B;  1KC8 1;  1TWA I;  4RVF A;  2OZK A;  3G4S Z;  4RVG A;  3VMI A;  1VQN Z;  1VQO Z;  1K8A 1;  2GU2 A;  1I3Q I;  3IF8 A;  4A3G I;  3CCE 1;  2LFU A;  2F4O A;  3CC7 Z;  1KQS Y;  3GKQ A;  3NH8 A;  3I4N I;  1RLY A;  1I6H I;  3M4O I;  1YIT 1;  3FQM A;  2QLV B;  2JA5 I;  3S15 I;  2GTH A;  2J6A A;  3S16 I;  3PO3 I;  2K5R A;  2V8I A;  1K9M 1;  3P5J B;  3EER A;  4HGZ A;  1QYP A;  3FQQ A;  1YUA A;  4HH4 A;  2RBL A;  1QVF Z;  3CXC Y;  2RT9 A;  2OTL 1;  3GTL I;  3QWU A;  3TDH B;  3CCR 1;  1RO2 A;  4A3L I;  2QRE B;  1VQP Z;  2E2J I;  1VQ7 Z;  1KRL A;  3HOZ I;  4S1T A;  2G2K A;  3LUS A;  3S1N I;  1VQ8 Z;  3F3F C;  3S17 I;  3D6W A;  4NBE A;  2QKD A;  3EED A;  4NBB A;  4QTU A;  4E33 A;  2V8J A;  1M1K 1;  2I3C A;  5IT9 f;  3PO2 I;  1NJI 2;  4MXU A;  3NDI A;  2PK7 A;  1RQF A;  4NFR A;  4RV9 A;  2IZ4 A;  1K83 I;  3CCM Z;  4XX2 A;  5C44 I;  1YHQ 1;  2P3Y A;  3U50 C;  2QA4 1;  3TE5 B;  3GCF A;  2PMZ A;  4A3D I;  1Q86 2;  5IP9 I;  1ML8 A;  4A93 I;  3CMA 1;  3CCV 1;  3J7A 4;  2K3R A;  2KI7 B;  1TWG I;  4E2Z A;  5C3E I;  3CPW Y;  5AN9 F;  1Z02 A;  3J80 f;  3CQZ I;  3G71 1;  1QVG Y;  1USP A;  3CCJ 1;  3D9X A;  3I55 1;  3GTM S;  1RO4 A;  3PO3 S;  5D1P A;  1WW9 A;  5IT9 b;  3HOY I;  1VQ9 1;  1Q7Y 2;  1NUI A;  3GTJ I;  3HOX I;  3CPW Z;  3VTN A;  2R92 I;  1L1O C;  2JMO A;  3S14 I;  4BY7 I;  1QVG Z;  1N8R 2;  1YHQ Z;  2QA4 Z;  3S1Q I;  2JA6 I;  3JAM f;  1NP6 A;  1Q81 2;  1QVF Y;  2NVY I;  4TNU A;  2YAD A;  1KD1 2;  3CCQ 1;  1Z03 A;  3FKI I;  5C4J I;  4AYB A;  2JNY A;  1VQM 1;  2WAQ A;  2PM9 A;  5D1O A;  3I4M I;  1W2B Z;  3GTM I;  3CC2 1;  5LL6 f;  4EWC A;  3J80 b;  1Q86 1;  2DE7 A;  2B63 I;  4MD7 A;  2IZ3 A;  3J81 f;  3CC4 Z;  4A3K I;  3G71 Z;  3KIH A;  1N2F A;  3CCJ Z;  4E32 A;  1YJW 1;  3I55 Z;  1TWF I;  3BG0 B;  2OTJ 1;  2JR6 A;  4A3C I;  1YI2 Z;  2BJO A;  2P28 A;  1I50 I;  3I56 1;  3OW2 Z;  1VQ5 1;  4BBR I;  2NVQ I;  1VQ9 Z;  4Y52 I;  2QRC B;  1VQ6 1;  4E30 A;  2RIQ A;  1ZB8 A;  2E9H A;  4DK1 A;  1TWC I;  3MON A;  2QR1 B;  2NVT I;  3JAM b;  2O4H A;  3H3V J;  3GTQ I;  4RS4 A;  4A3M I;  1VQ4 1;  1WII A;  3GTK I;  3CCE Z;  4NBC A;  3CCQ Z;  1K73 2;  2R6M A;  1X3W A;  3G6E 1;  1VQM Z;  4RVH A;  1YIT Z;  2E2I I;  3VMH A;  3S1R I;  4NBF A;  1Q81 1;  3CC2 Z;  3S2H I;  1KD1 1;  2VUM I;  4MON A;  3J81 b;  1X3Z A;  3IFU A;  3H0G I;  1YJW Z;  1TFI A;  2OTL Z;  2VUG A;  2OOX B;  4A3E I;  3CCR Z;  2YU9 I;  2H85 A;  3NFZ A;  1VQ5 Z;  3CCS 1;  1USP B;  3S2D I;  1JJ2 Z;  3KIF A;  5FLM I;  3NH4 A;  1VQ6 Z;  4MD9 A;  3CME 1;  1K9M 2;  3GTP I;  2Q51 A;  4NB8 A;  5CM2 M;  2HF1 A;  4E2W A;  4E2Y A;  4NBG A;  1VQ4 Z;  2DE5 A;  3IX0 A;  1YJN 1;  1W2B Y;  4QTT A;  1JWH C;  1Y1V S;  2M48 A;  3CD6 1;  3G6E Z;  1RO0 A;  1S72 1;  3VB9 A;  2EGT A;  4MD8 A;  2Q4Z A;  2OOY B;  2E2H I;  5T6B A;  1NJI 1;  1K73 1;  1VQP 1;  2QEX 1;  3Q87 A;  5A2Q f;  2JS4 A;  3CMA Z;  3CCV Z;  3OW2 Y;  5D1O B;  1VQL 1;  1S7M A;  1VQ8 1;  4NBA A;  1LQL A;  4A3I I;  1M90 2;  1Q82 2;  3T4N B;  3CCS Z;  1VQK 1;  3CCL 1;  2JA7 I;  4RVD A;  1TWH I;  2R93 I;  3NDJ A;  3CME Z;  4A3J I;  2NVX I;  1YIJ 1;  3F3P C;  1P9N A;  1Y1V I;  1YJ9 1;  4MH4 A;  3CCM 1;  3RZO I;  3K7A I;  4CL1 A;  4NOZ A;  1YJN Z;  3HKZ A;  5FLX f;  4A3F I;  2RHB A;  2V8K A;  3CD6 Z;  2W04 A;  1S72 Z;  4X6A I;  4A3B I;  2W03 A;  2RPR A;  4DQY B;  1X0T A;  1Q7Y 1;  2R7Z I;  2Y0S A;  4NBH A;  1KQS Z;  1R9T I;  2QEX Z;  5A2Q b;  2AKL A;  3GTG I;  1VQL Z;  3ESW A;  1ZH1 A;  1JJ2 Y;  1N8R 1;  3I07 A;  1WCM I;  1KC8 2;  1PFT A;  4NH1 C;  3CCU 1;  1VQK Z;  3HOW I;  3HOU I;  3CCL Z;  3CXC Z;  1K8A 2;  2DE6 A;  3MZL B;  4BXX I;  3MZK B;  1YIJ Z;  1ZB9 A;  4BY1 I;  2GTI A;  1Z01 A;  4Y7N I;  2OTJ Z;  3HOV I;  1M90 1;  1YJ9 Z;  1Q82 1;  3I56 Z;  3G4S 1;  1VQN 1;  1VQO 1;  5T67 A;  4DGL A;  4BBS I;  2KPI A;  2LIY A;  5FLX b;  4HGY A;  2VF1 A;  3CC7 1;  4MRI A;  4E31 A;  1DL6 A;  5T64 A;  3NH5 A;  2HU9 A;  2F4M A;  2M6N A;  4NB9 A;  1QF8 A;  5IP7 I;  3S1M I;  3VMG A;  1Y1W I;  2JUB A;  3BG1 B;  1YUK A;  1VLA A;  3CC4 1;  5C4X I;  1SFO I;  2O53 A;  4E2X A;  2WB1 A;  1RNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...