1Q7Y2

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q7y200
1M1K1 3I561 1YIJZ 1VQ9Z 1Q7Y2 3CCRZ 3CC71 1QVGY 1VQKZ 3I55Z 1VQ81 1YJNZ 1K732 1VQL1 1QVFY 1VQP1 1VQ7Z 3CCEZ 1VQO1 3CMAZ 1KC82 1Q822 1JJ2Y 2QA4Z 1Q821 1W2BZ 1VQ91 3CCR1 1VQK1 3I551 3G71Z 1YJN1 3CCQZ 3CPWY 1VQ71 3CCMZ 1KD12 2OTLZ 3CMA1 3CCJZ 1KD11 1Q861 1VQ4Z 3CCLZ 2QEXZ 1QVGZ 3G4SZ 1QVFZ 3G6EZ 3G711 3CCQ1 1KQSY 1JJ2Z 3CMEZ 3CCM1 1S72Z 2OTL1 1YJ9Z 2OTJZ 1YIJ1 1VQ41 1VQ5Z 3CXCY 2QEX1 3G4S1 1YI2Z 3CPWZ 3CCUZ 3CCE1 1M1K2 1K9M1 1Q862 3CME1 1S721 2QA41 3CC2Z 1VQMZ 3OW2Y 2OTJ1 1M901 1VQ51 1YJWZ 1NJI1 3CCU1 1KQSZ 1VQ6Z 1K8A1 3CD6Z 1YHQZ 3CCJ1 3CCVZ 3CC21 3CCL1 1VQM1 3CC4Z 3CCSZ 1YITZ 1K9M2 3G6E1 1YJW1 1Q7Y1 1VQNZ 1VQ61 3CD61 1M902 1K731 1YHQ1 1YJ91 1Q812 3CCV1 3OW2Z 1N8R2 3I56Z 1Q811 1N8R1 1NJI2 3CC41 3CC7Z 3CCS1 1KC81 1YIT1 1YI21 1VQ8Z 1W2BY 1K8A2 1VQLZ 1VQPZ 1VQN1 1VQOZ 3CXCZ
chains in the Genus database with same CATH superfamily
3S2DI 4AYBA 1RO4A 4A3LI 1VQ9Z 5IP7I 1QVGY 3M3YI 2E2II 3CCEZ 2AYDA 2OOYB 1DL6A 1PFTA 3CMAZ 3I07A 1KC82 3F3PC 1NUIA 2RHBA 5T67A 2M6NA 3JAMb 3MZKB 3CCR1 3I551 2VUMI 1TWGI 1Y1VS 1YJN1 1VQ71 3F3FC 3J81f 3HOYI 1KD11 2JA6I 4E2WA 4QTTA 4A3MI 5FLMI 2DE6A 2F4OA 3LUSA 5C3EI 3G6EZ 2QRDB 1JJ2Z 4NOZA 3CCM1 1S72Z 4NH1C 1YJ9Z 1KRLA 1YIJ1 3GTKI 1RNIA 2YADA 2JA7I 3CPWZ 5IT9f 3GTMS 2JIRA 3BG1B 1TWCI 2E9HA 1VQMZ 2OTJ1 3HOXI 1VQ51 1Y8CA 3D6WA 3VMHA 1YJWZ 4NBBA 1QXFA 2O4HA 3HOZI 3HKZA 1K8A1 5C44I 1YHQZ 3CCJ1 2E2JI 2NAPA 3CCL1 3IX0A 3CC4Z 3K7AI 2I3CA 2Q4ZA 2WAQA 4DK1A 5IP9I 4RVGA 1WZNA 1K731 1Q812 3MONA 3OW2Z 3I56Z 2QR1B 1N8R1 2P3YA 4NBFA 3MZLB 3VB9A 1K8A2 1L1OC 3NH5A 2PK7A 1VQPZ 3HOWI 2R6MA 4E2ZA 2OZKA 1M1K2 2W03A 2PMZA 5D1OA 1YIJZ 2LFUA 3S17I 1ZH1A 2JIPA 1Y1VI 1K732 1VQL1 2YU9I 3PO2I 4NBGA 1VQO1 1JWHC 1JJ2Y 3GTQI 1TFIA 3QWUA 1W2BZ 1WCMI 2Q51A 3P5JB 1VQK1 2OOXB 4MD8A 2JA5I 3CCQZ 3CPWY 2OTLZ 4HH4A 3CCJZ 1AA6A 4HGYA 3CCLZ 3S1NI 3GTLI 3VTNA 4MONA 3G711 3GTMI 4E30A 4XX2A 1USPA 3CMEZ 4QTUA 2V8JA 2JR6A 3J80f 4NBEA 5D1OB 2V45A 1VQ41 2QEX1 3G4S1 1VLAA 2R7ZI 2KPIA 3CCUZ 3KIHA 1YUAA 3M4OI 1Z01A 5A2Qb 3CC2Z 3OW2Y 2GTIA 2QREB 4X6AI 4A3CI 4NBDA 3TE5B 1ZB9A 4MD7A 1WW9A 4BBRI 3GTOI 3CCVZ 2G2KA 2B63I 1X0TA 3S1RI 3CCSZ 1YITZ 4E31A 5CM2M 2NVTI 1VQNZ 1VQ61 4MRIA 3CD61 1USPB 2E7ZA 4NB8A 4EWCA 1Y1WI 2H85A 2VPXA 1Q811 3IFUA 4RS4A 3S2HI 2RBLA 1YI21 1W2BY 1Q16A 3BG0B 3U50C 3NH4A 3FKII 3EERA 4A3FI 3GCFA 2QLVB 3S1QI 2V8KA 2DE7A 1M1K1 3CCRZ 3CC71 3I55Z 1VQ81 3GKQA 4A3DI 1YJNZ 1VQ7Z 3TDHB 2JIQA 3FQMA 2J6AA 2AKLA 1Q822 1RO2A 1TWHI 2M48A 2WB1A 4S1TA 1VQ91 3JAMf 2RT9A 2JS4A 4RVHA 1I6HI 3J81b 3CCMZ 3CMA1 2F4MA 2JMOA 3H3VJ 4A3BI 3NDJA 2LEXA 1QVFZ 3NDIA 1Z02A 2LIYA 2KI7B 3S16I 5FLXb 2JNYA 2OTJZ 1WIIA 4HGZA 3D9XA 2VPYA 1VQ5Z 5C4XI 5IT9b 2IZ4A 3T4NB 3HOUI 1FDOA 2Y0SA 1YI2Z 3RZOI 3D2LA 5C4JI 1K9M1 1RLYA 4TNUA 2DE5A 3S1MI 1S721 2QA41 5T6BA 3PO3S 4E32A 2ZAEB 4A3EI 3IF8A 2W04A 2R93I 4NBAA 3ESWA 2VPZA 1KQSZ 2JIMA 3S15I 4A93I 1QF8A 2NVYI 3FQQA 3CQZI 3Q87A 1I3QI 4MXUA 3VMGA 1YUKA 1VQM1 2K3RA 2O53A 1K9M2 2V3VA 1YJW1 4RV9A 1Q7Y1 1ZB8A 4NFRA 3I4NI 2IZ3A 1YHQ1 3HOVI 4NBCA 3CC41 1X3WA 2BJOA 2EGTA 2P28A 1VQLZ 3GTPI 1Z03A 4A3GI 1VQOZ 2RPRA 2JUBA 2QRCB 3VMIA 3I561 2QKDA 1Q7Y2 1I50I 1VQKZ 2HF1A 1QVFY 1S7MA 1VQP1 2K5RA 3RZDI 5D1PA 2E2HI 1RQFA 1X3ZA 2QA4Z 3IR7A 2NVQI 1Q821 1SIWA 5FLXf 3NH8A 3G71Z 3GTGI 4NBHA 1KD12 4DGLA 2VPWA 2HU9A 1Q861 1VQ4Z 2QEXZ 1QVGZ 2JA8I 3G4SZ 5AN9F 2IV2X 3I4MI 4DQYB 3CCQ1 3NFZA 1KQSY 3J80b 5T64A 2OTL1 3H0GI 3PO3I 3EEDA 3GTJI 1RO0A 3CXCY 4BXXI 1K83I 1ML8A 1TWAI 1P9NA 4MD9A 3CCE1 2GU2A 4BY7I 1LQLA 2JIOA 4A3II 1R9TI 1Q862 1FDIA 3CME1 4BY1I 4RVDA 2RIQA 5A2Qf 1M901 3J7A4 2NVXI 4E2XA 1N2FA 1NJI1 3CCU1 4BBSI 1VQ6Z 4E2YA 3CD6Z 3KIFA 4A3KI 2GTHA 3CC21 4NB9A 5LL6f 3S14I 1QYPA 4Y52I 3G6E1 1WJ2A 2R92I 1NP6A 4Y7NI 1M902 1YJ91 4MH4A 3CCV1 1N8R2 4A3JI 1NJI2 3CC7Z 1KC81 3CCS1 1YIT1 1VQ8Z 2V8IA 1SFOI 2PM9A 2VF1A 2VUGA 1VQN1 4CL1A 4E33A 4RVFA 1TWFI 3CXCZ
chains in the Genus database with same CATH topology
3S2DI 4AYBA 1RO4A 4A3LI 1VQ9Z 5IP7I 1QVGY 3M3YI 2E2II 3CCEZ 2OOYB 1DL6A 1PFTA 3CMAZ 3I07A 1KC82 3F3PC 1NUIA 2RHBA 5T67A 2M6NA 3JAMb 3MZKB 3CCR1 3I551 2VUMI 1TWGI 1Y1VS 1YJN1 1VQ71 3F3FC 3J81f 3HOYI 1KD11 2JA6I 4E2WA 4QTTA 4A3MI 5FLMI 2DE6A 2F4OA 3LUSA 5C3EI 3G6EZ 2QRDB 1JJ2Z 4NOZA 3CCM1 1S72Z 4NH1C 1YJ9Z 1KRLA 1YIJ1 3GTKI 1RNIA 2YADA 2JA7I 3CPWZ 5IT9f 3GTMS 3BG1B 1TWCI 2E9HA 1VQMZ 2OTJ1 3HOXI 1VQ51 3D6WA 3VMHA 1YJWZ 4NBBA 2O4HA 3HOZI 3HKZA 1K8A1 5C44I 1YHQZ 3CCJ1 2E2JI 3CCL1 3IX0A 3CC4Z 3K7AI 2I3CA 2Q4ZA 2WAQA 4DK1A 5IP9I 4RVGA 1K731 1Q812 3MONA 3OW2Z 3I56Z 2QR1B 1N8R1 2P3YA 4NBFA 3MZLB 3VB9A 1K8A2 1L1OC 3NH5A 2PK7A 1VQPZ 3HOWI 2R6MA 4E2ZA 2OZKA 1M1K2 2W03A 2PMZA 5D1OA 1YIJZ 2LFUA 3S17I 1ZH1A 1Y1VI 1K732 1VQL1 2YU9I 3PO2I 4NBGA 1VQO1 1JWHC 1JJ2Y 3GTQI 1TFIA 3QWUA 1W2BZ 1WCMI 2Q51A 3P5JB 1VQK1 2OOXB 4MD8A 2JA5I 3CCQZ 3CPWY 2OTLZ 4HH4A 3CCJZ 3CCLZ 4HGYA 3S1NI 3GTLI 3VTNA 4MONA 3G711 3GTMI 4E30A 4XX2A 1USPA 3CMEZ 4QTUA 2V8JA 2JR6A 3J80f 4NBEA 5D1OB 1VQ41 2QEX1 3G4S1 1VLAA 2R7ZI 2KPIA 3CCUZ 3KIHA 1YUAA 3M4OI 1Z01A 5A2Qb 3CC2Z 3OW2Y 2GTIA 2QREB 4X6AI 4A3CI 4NBDA 3TE5B 1ZB9A 4MD7A 1WW9A 4BBRI 3GTOI 3CCVZ 2G2KA 2B63I 1X0TA 3S1RI 3CCSZ 1YITZ 4E31A 5CM2M 2NVTI 1VQNZ 1VQ61 4MRIA 3CD61 1USPB 4NB8A 4EWCA 1Y1WI 2H85A 1Q811 3IFUA 4RS4A 3S2HI 2RBLA 1YI21 1W2BY 3BG0B 3U50C 3NH4A 3FKII 3EERA 4A3FI 3GCFA 2QLVB 3S1QI 2V8KA 2DE7A 1M1K1 3CCRZ 3CC71 3I55Z 1VQ81 3GKQA 4A3DI 1YJNZ 1VQ7Z 3TDHB 3FQMA 2J6AA 2AKLA 1Q822 1RO2A 1TWHI 2M48A 2WB1A 4S1TA 1VQ91 3JAMf 2RT9A 2JS4A 4RVHA 1I6HI 3J81b 3CCMZ 3CMA1 2F4MA 2JMOA 3H3VJ 4A3BI 3NDJA 1QVFZ 3NDIA 1Z02A 2LIYA 2KI7B 3S16I 5FLXb 2JNYA 2OTJZ 1WIIA 4HGZA 3D9XA 1VQ5Z 5C4XI 5IT9b 2IZ4A 3T4NB 3HOUI 2Y0SA 1YI2Z 3RZOI 5C4JI 1K9M1 1RLYA 4TNUA 2DE5A 3S1MI 1S721 2QA41 5T6BA 3PO3S 4E32A 2ZAEB 4A3EI 3IF8A 2W04A 2R93I 4NBAA 3ESWA 1KQSZ 3S15I 4A93I 1QF8A 2NVYI 3FQQA 3CQZI 3Q87A 1I3QI 4MXUA 3VMGA 1YUKA 1VQM1 2K3RA 2O53A 1K9M2 1YJW1 4RV9A 1Q7Y1 1ZB8A 4NFRA 3I4NI 2IZ3A 1YHQ1 3HOVI 4NBCA 3CC41 1X3WA 2BJOA 2EGTA 2P28A 1VQLZ 3GTPI 1Z03A 4A3GI 1VQOZ 2RPRA 2JUBA 2QRCB 3VMIA 3I561 2QKDA 1Q7Y2 1I50I 1VQKZ 2HF1A 1QVFY 1S7MA 1VQP1 2K5RA 3RZDI 5D1PA 2E2HI 1RQFA 1X3ZA 2QA4Z 2NVQI 1Q821 5FLXf 3NH8A 3G71Z 3GTGI 4NBHA 1KD12 4DGLA 2HU9A 1Q861 1VQ4Z 2QEXZ 1QVGZ 2JA8I 3G4SZ 5AN9F 3I4MI 4DQYB 3CCQ1 3NFZA 1KQSY 3J80b 5T64A 2OTL1 3H0GI 3PO3I 3EEDA 3GTJI 1RO0A 3CXCY 4BXXI 1K83I 1ML8A 1TWAI 1P9NA 4MD9A 3CCE1 2GU2A 4BY7I 1LQLA 1R9TI 4A3II 1Q862 3CME1 4BY1I 4RVDA 2RIQA 5A2Qf 1M901 3J7A4 2NVXI 4E2XA 1N2FA 1NJI1 3CCU1 4BBSI 1VQ6Z 4E2YA 3CD6Z 3KIFA 4A3KI 2GTHA 3CC21 4NB9A 5LL6f 3S14I 1QYPA 4Y52I 3G6E1 2R92I 1NP6A 4Y7NI 1M902 1YJ91 4MH4A 3CCV1 1N8R2 4A3JI 1NJI2 3CC7Z 1KC81 3CCS1 1YIT1 1VQ8Z 2V8IA 1SFOI 2PM9A 2VF1A 2VUGA 1VQN1 4CL1A 4E33A 4RVFA 1TWFI 3CXCZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 1;  3I56 1;  1YIJ Z;  1VQ9 Z;  1Q7Y 2;  3CCR Z;  3CC7 1;  1QVG Y;  1VQK Z;  3I55 Z;  1VQ8 1;  1YJN Z;  1K73 2;  1VQL 1;  1QVF Y;  1VQP 1;  1VQ7 Z;  3CCE Z;  1VQO 1;  3CMA Z;  1KC8 2;  1Q82 2;  1JJ2 Y;  2QA4 Z;  1Q82 1;  1W2B Z;  1VQ9 1;  3CCR 1;  1VQK 1;  3I55 1;  3G71 Z;  1YJN 1;  3CCQ Z;  3CPW Y;  1VQ7 1;  3CCM Z;  1KD1 2;  2OTL Z;  3CMA 1;  3CCJ Z;  1KD1 1;  1Q86 1;  1VQ4 Z;  3CCL Z;  2QEX Z;  1QVG Z;  3G4S Z;  1QVF Z;  3G6E Z;  3G71 1;  3CCQ 1;  1KQS Y;  1JJ2 Z;  3CME Z;  3CCM 1;  1S72 Z;  2OTL 1;  1YJ9 Z;  2OTJ Z;  1YIJ 1;  1VQ4 1;  1VQ5 Z;  3CXC Y;  2QEX 1;  3G4S 1;  1YI2 Z;  3CPW Z;  3CCU Z;  3CCE 1;  1M1K 2;  1K9M 1;  1Q86 2;  3CME 1;  1S72 1;  2QA4 1;  3CC2 Z;  1VQM Z;  3OW2 Y;  2OTJ 1;  1M90 1;  1VQ5 1;  1YJW Z;  1NJI 1;  3CCU 1;  1KQS Z;  1VQ6 Z;  1K8A 1;  3CD6 Z;  1YHQ Z;  3CCJ 1;  3CCV Z;  3CC2 1;  3CCL 1;  1VQM 1;  3CC4 Z;  3CCS Z;  1YIT Z;  1K9M 2;  3G6E 1;  1YJW 1;  1Q7Y 1;  1VQN Z;  1VQ6 1;  3CD6 1;  1M90 2;  1K73 1;  1YHQ 1;  1YJ9 1;  1Q81 2;  3CCV 1;  3OW2 Z;  1N8R 2;  3I56 Z;  1Q81 1;  1N8R 1;  1NJI 2;  3CC4 1;  3CC7 Z;  3CCS 1;  1KC8 1;  1YIT 1;  1YI2 1;  1VQ8 Z;  1W2B Y;  1K8A 2;  1VQL Z;  1VQP Z;  1VQN 1;  1VQO Z;  3CXC Z; 
#chains in the Genus database with same CATH topology
 3S2D I;  4AYB A;  1RO4 A;  4A3L I;  1VQ9 Z;  5IP7 I;  1QVG Y;  3M3Y I;  2E2I I;  3CCE Z;  2AYD A;  2OOY B;  1DL6 A;  1PFT A;  3CMA Z;  3I07 A;  1KC8 2;  3F3P C;  1NUI A;  2RHB A;  5T67 A;  2M6N A;  3JAM b;  3MZK B;  3CCR 1;  3I55 1;  2VUM I;  1TWG I;  1Y1V S;  1YJN 1;  1VQ7 1;  3F3F C;  3J81 f;  3HOY I;  1KD1 1;  2JA6 I;  4E2W A;  4QTT A;  4A3M I;  5FLM I;  2DE6 A;  2F4O A;  3LUS A;  5C3E I;  3G6E Z;  2QRD B;  1JJ2 Z;  4NOZ A;  3CCM 1;  1S72 Z;  4NH1 C;  1YJ9 Z;  1KRL A;  1YIJ 1;  3GTK I;  1RNI A;  2YAD A;  2JA7 I;  3CPW Z;  5IT9 f;  3GTM S;  2JIR A;  3BG1 B;  1TWC I;  2E9H A;  1VQM Z;  2OTJ 1;  3HOX I;  1VQ5 1;  1Y8C A;  3D6W A;  3VMH A;  1YJW Z;  4NBB A;  1QXF A;  2O4H A;  3HOZ I;  3HKZ A;  1K8A 1;  5C44 I;  1YHQ Z;  3CCJ 1;  2E2J I;  2NAP A;  3CCL 1;  3IX0 A;  3CC4 Z;  3K7A I;  2I3C A;  2Q4Z A;  2WAQ A;  4DK1 A;  5IP9 I;  4RVG A;  1WZN A;  1K73 1;  1Q81 2;  3MON A;  3OW2 Z;  3I56 Z;  2QR1 B;  1N8R 1;  2P3Y A;  4NBF A;  3MZL B;  3VB9 A;  1K8A 2;  1L1O C;  3NH5 A;  2PK7 A;  1VQP Z;  3HOW I;  2R6M A;  4E2Z A;  2OZK A;  1M1K 2;  2W03 A;  2PMZ A;  5D1O A;  1YIJ Z;  2LFU A;  3S17 I;  1ZH1 A;  2JIP A;  1Y1V I;  1K73 2;  1VQL 1;  2YU9 I;  3PO2 I;  4NBG A;  1VQO 1;  1JWH C;  1JJ2 Y;  3GTQ I;  1TFI A;  3QWU A;  1W2B Z;  1WCM I;  2Q51 A;  3P5J B;  1VQK 1;  2OOX B;  4MD8 A;  2JA5 I;  3CCQ Z;  3CPW Y;  2OTL Z;  4HH4 A;  3CCJ Z;  1AA6 A;  4HGY A;  3CCL Z;  3S1N I;  3GTL I;  3VTN A;  4MON A;  3G71 1;  3GTM I;  4E30 A;  4XX2 A;  1USP A;  3CME Z;  4QTU A;  2V8J A;  2JR6 A;  3J80 f;  4NBE A;  5D1O B;  2V45 A;  1VQ4 1;  2QEX 1;  3G4S 1;  1VLA A;  2R7Z I;  2KPI A;  3CCU Z;  3KIH A;  1YUA A;  3M4O I;  1Z01 A;  5A2Q b;  3CC2 Z;  3OW2 Y;  2GTI A;  2QRE B;  4X6A I;  4A3C I;  4NBD A;  3TE5 B;  1ZB9 A;  4MD7 A;  1WW9 A;  4BBR I;  3GTO I;  3CCV Z;  2G2K A;  2B63 I;  1X0T A;  3S1R I;  3CCS Z;  1YIT Z;  4E31 A;  5CM2 M;  2NVT I;  1VQN Z;  1VQ6 1;  4MRI A;  3CD6 1;  1USP B;  2E7Z A;  4NB8 A;  4EWC A;  1Y1W I;  2H85 A;  2VPX A;  1Q81 1;  3IFU A;  4RS4 A;  3S2H I;  2RBL A;  1YI2 1;  1W2B Y;  1Q16 A;  3BG0 B;  3U50 C;  3NH4 A;  3FKI I;  3EER A;  4A3F I;  3GCF A;  2QLV B;  3S1Q I;  2V8K A;  2DE7 A;  1M1K 1;  3CCR Z;  3CC7 1;  3I55 Z;  1VQ8 1;  3GKQ A;  4A3D I;  1YJN Z;  1VQ7 Z;  3TDH B;  2JIQ A;  3FQM A;  2J6A A;  2AKL A;  1Q82 2;  1RO2 A;  1TWH I;  2M48 A;  2WB1 A;  4S1T A;  1VQ9 1;  3JAM f;  2RT9 A;  2JS4 A;  4RVH A;  1I6H I;  3J81 b;  3CCM Z;  3CMA 1;  2F4M A;  2JMO A;  3H3V J;  4A3B I;  3NDJ A;  2LEX A;  1QVF Z;  3NDI A;  1Z02 A;  2LIY A;  2KI7 B;  3S16 I;  5FLX b;  2JNY A;  2OTJ Z;  1WII A;  4HGZ A;  3D9X A;  2VPY A;  1VQ5 Z;  5C4X I;  5IT9 b;  2IZ4 A;  3T4N B;  3HOU I;  1FDO A;  2Y0S A;  1YI2 Z;  3RZO I;  3D2L A;  5C4J I;  1K9M 1;  1RLY A;  4TNU A;  2DE5 A;  3S1M I;  1S72 1;  2QA4 1;  5T6B A;  3PO3 S;  4E32 A;  2ZAE B;  4A3E I;  3IF8 A;  2W04 A;  2R93 I;  4NBA A;  3ESW A;  2VPZ A;  1KQS Z;  2JIM A;  3S15 I;  4A93 I;  1QF8 A;  2NVY I;  3FQQ A;  3CQZ I;  3Q87 A;  1I3Q I;  4MXU A;  3VMG A;  1YUK A;  1VQM 1;  2K3R A;  2O53 A;  1K9M 2;  2V3V A;  1YJW 1;  4RV9 A;  1Q7Y 1;  1ZB8 A;  4NFR A;  3I4N I;  2IZ3 A;  1YHQ 1;  3HOV I;  4NBC A;  3CC4 1;  1X3W A;  2BJO A;  2EGT A;  2P28 A;  1VQL Z;  3GTP I;  1Z03 A;  4A3G I;  1VQO Z;  2RPR A;  2JUB A;  2QRC B;  3VMI A;  3I56 1;  2QKD A;  1Q7Y 2;  1I50 I;  1VQK Z;  2HF1 A;  1QVF Y;  1S7M A;  1VQP 1;  2K5R A;  3RZD I;  5D1P A;  2E2H I;  1RQF A;  1X3Z A;  2QA4 Z;  3IR7 A;  2NVQ I;  1Q82 1;  1SIW A;  5FLX f;  3NH8 A;  3G71 Z;  3GTG I;  4NBH A;  1KD1 2;  4DGL A;  2VPW A;  2HU9 A;  1Q86 1;  1VQ4 Z;  2QEX Z;  1QVG Z;  2JA8 I;  3G4S Z;  5AN9 F;  2IV2 X;  3I4M I;  4DQY B;  3CCQ 1;  3NFZ A;  1KQS Y;  3J80 b;  5T64 A;  2OTL 1;  3H0G I;  3PO3 I;  3EED A;  3GTJ I;  1RO0 A;  3CXC Y;  4BXX I;  1K83 I;  1ML8 A;  1TWA I;  1P9N A;  4MD9 A;  3CCE 1;  2GU2 A;  4BY7 I;  1LQL A;  2JIO A;  4A3I I;  1R9T I;  1Q86 2;  1FDI A;  3CME 1;  4BY1 I;  4RVD A;  2RIQ A;  5A2Q f;  1M90 1;  3J7A 4;  2NVX I;  4E2X A;  1N2F A;  1NJI 1;  3CCU 1;  4BBS I;  1VQ6 Z;  4E2Y A;  3CD6 Z;  3KIF A;  4A3K I;  2GTH A;  3CC2 1;  4NB9 A;  5LL6 f;  3S14 I;  1QYP A;  4Y52 I;  3G6E 1;  1WJ2 A;  2R92 I;  1NP6 A;  4Y7N I;  1M90 2;  1YJ9 1;  4MH4 A;  3CCV 1;  1N8R 2;  4A3J I;  1NJI 2;  3CC7 Z;  1KC8 1;  3CCS 1;  1YIT 1;  1VQ8 Z;  2V8I A;  1SFO I;  2PM9 A;  2VF1 A;  2VUG A;  1VQN 1;  4CL1 A;  4E33 A;  4RVF A;  1TWF I;  3CXC Z; 
#chains in the Genus database with same CATH homology
 3S2D I;  4AYB A;  1RO4 A;  4A3L I;  1VQ9 Z;  5IP7 I;  1QVG Y;  3M3Y I;  2E2I I;  3CCE Z;  2OOY B;  1DL6 A;  1PFT A;  3CMA Z;  3I07 A;  1KC8 2;  3F3P C;  1NUI A;  2RHB A;  5T67 A;  2M6N A;  3JAM b;  3MZK B;  3CCR 1;  3I55 1;  2VUM I;  1TWG I;  1Y1V S;  1YJN 1;  1VQ7 1;  3F3F C;  3J81 f;  3HOY I;  1KD1 1;  2JA6 I;  4E2W A;  4QTT A;  4A3M I;  5FLM I;  2DE6 A;  2F4O A;  3LUS A;  5C3E I;  3G6E Z;  2QRD B;  1JJ2 Z;  4NOZ A;  3CCM 1;  1S72 Z;  4NH1 C;  1YJ9 Z;  1KRL A;  1YIJ 1;  3GTK I;  1RNI A;  2YAD A;  2JA7 I;  3CPW Z;  5IT9 f;  3GTM S;  3BG1 B;  1TWC I;  2E9H A;  1VQM Z;  2OTJ 1;  3HOX I;  1VQ5 1;  3D6W A;  3VMH A;  1YJW Z;  4NBB A;  2O4H A;  3HOZ I;  3HKZ A;  1K8A 1;  5C44 I;  1YHQ Z;  3CCJ 1;  2E2J I;  3CCL 1;  3IX0 A;  3CC4 Z;  3K7A I;  2I3C A;  2Q4Z A;  2WAQ A;  4DK1 A;  5IP9 I;  4RVG A;  1K73 1;  1Q81 2;  3MON A;  3OW2 Z;  3I56 Z;  2QR1 B;  1N8R 1;  2P3Y A;  4NBF A;  3MZL B;  3VB9 A;  1K8A 2;  1L1O C;  3NH5 A;  2PK7 A;  1VQP Z;  3HOW I;  2R6M A;  4E2Z A;  2OZK A;  1M1K 2;  2W03 A;  2PMZ A;  5D1O A;  1YIJ Z;  2LFU A;  3S17 I;  1ZH1 A;  1Y1V I;  1K73 2;  1VQL 1;  2YU9 I;  3PO2 I;  4NBG A;  1VQO 1;  1JWH C;  1JJ2 Y;  3GTQ I;  1TFI A;  3QWU A;  1W2B Z;  1WCM I;  2Q51 A;  3P5J B;  1VQK 1;  2OOX B;  4MD8 A;  2JA5 I;  3CCQ Z;  3CPW Y;  2OTL Z;  4HH4 A;  3CCJ Z;  3CCL Z;  4HGY A;  3S1N I;  3GTL I;  3VTN A;  4MON A;  3G71 1;  3GTM I;  4E30 A;  4XX2 A;  1USP A;  3CME Z;  4QTU A;  2V8J A;  2JR6 A;  3J80 f;  4NBE A;  5D1O B;  1VQ4 1;  2QEX 1;  3G4S 1;  1VLA A;  2R7Z I;  2KPI A;  3CCU Z;  3KIH A;  1YUA A;  3M4O I;  1Z01 A;  5A2Q b;  3CC2 Z;  3OW2 Y;  2GTI A;  2QRE B;  4X6A I;  4A3C I;  4NBD A;  3TE5 B;  1ZB9 A;  4MD7 A;  1WW9 A;  4BBR I;  3GTO I;  3CCV Z;  2G2K A;  2B63 I;  1X0T A;  3S1R I;  3CCS Z;  1YIT Z;  4E31 A;  5CM2 M;  2NVT I;  1VQN Z;  1VQ6 1;  4MRI A;  3CD6 1;  1USP B;  4NB8 A;  4EWC A;  1Y1W I;  2H85 A;  1Q81 1;  3IFU A;  4RS4 A;  3S2H I;  2RBL A;  1YI2 1;  1W2B Y;  3BG0 B;  3U50 C;  3NH4 A;  3FKI I;  3EER A;  4A3F I;  3GCF A;  2QLV B;  3S1Q I;  2V8K A;  2DE7 A;  1M1K 1;  3CCR Z;  3CC7 1;  3I55 Z;  1VQ8 1;  3GKQ A;  4A3D I;  1YJN Z;  1VQ7 Z;  3TDH B;  3FQM A;  2J6A A;  2AKL A;  1Q82 2;  1RO2 A;  1TWH I;  2M48 A;  2WB1 A;  4S1T A;  1VQ9 1;  3JAM f;  2RT9 A;  2JS4 A;  4RVH A;  1I6H I;  3J81 b;  3CCM Z;  3CMA 1;  2F4M A;  2JMO A;  3H3V J;  4A3B I;  3NDJ A;  1QVF Z;  3NDI A;  1Z02 A;  2LIY A;  2KI7 B;  3S16 I;  5FLX b;  2JNY A;  2OTJ Z;  1WII A;  4HGZ A;  3D9X A;  1VQ5 Z;  5C4X I;  5IT9 b;  2IZ4 A;  3T4N B;  3HOU I;  2Y0S A;  1YI2 Z;  3RZO I;  5C4J I;  1K9M 1;  1RLY A;  4TNU A;  2DE5 A;  3S1M I;  1S72 1;  2QA4 1;  5T6B A;  3PO3 S;  4E32 A;  2ZAE B;  4A3E I;  3IF8 A;  2W04 A;  2R93 I;  4NBA A;  3ESW A;  1KQS Z;  3S15 I;  4A93 I;  1QF8 A;  2NVY I;  3FQQ A;  3CQZ I;  3Q87 A;  1I3Q I;  4MXU A;  3VMG A;  1YUK A;  1VQM 1;  2K3R A;  2O53 A;  1K9M 2;  1YJW 1;  4RV9 A;  1Q7Y 1;  1ZB8 A;  4NFR A;  3I4N I;  2IZ3 A;  1YHQ 1;  3HOV I;  4NBC A;  3CC4 1;  1X3W A;  2BJO A;  2EGT A;  2P28 A;  1VQL Z;  3GTP I;  1Z03 A;  4A3G I;  1VQO Z;  2RPR A;  2JUB A;  2QRC B;  3VMI A;  3I56 1;  2QKD A;  1Q7Y 2;  1I50 I;  1VQK Z;  2HF1 A;  1QVF Y;  1S7M A;  1VQP 1;  2K5R A;  3RZD I;  5D1P A;  2E2H I;  1RQF A;  1X3Z A;  2QA4 Z;  2NVQ I;  1Q82 1;  5FLX f;  3NH8 A;  3G71 Z;  3GTG I;  4NBH A;  1KD1 2;  4DGL A;  2HU9 A;  1Q86 1;  1VQ4 Z;  2QEX Z;  1QVG Z;  2JA8 I;  3G4S Z;  5AN9 F;  3I4M I;  4DQY B;  3CCQ 1;  3NFZ A;  1KQS Y;  3J80 b;  5T64 A;  2OTL 1;  3H0G I;  3PO3 I;  3EED A;  3GTJ I;  1RO0 A;  3CXC Y;  4BXX I;  1K83 I;  1ML8 A;  1TWA I;  1P9N A;  4MD9 A;  3CCE 1;  2GU2 A;  4BY7 I;  1LQL A;  1R9T I;  4A3I I;  1Q86 2;  3CME 1;  4BY1 I;  4RVD A;  2RIQ A;  5A2Q f;  1M90 1;  3J7A 4;  2NVX I;  4E2X A;  1N2F A;  1NJI 1;  3CCU 1;  4BBS I;  1VQ6 Z;  4E2Y A;  3CD6 Z;  3KIF A;  4A3K I;  2GTH A;  3CC2 1;  4NB9 A;  5LL6 f;  3S14 I;  1QYP A;  4Y52 I;  3G6E 1;  2R92 I;  1NP6 A;  4Y7N I;  1M90 2;  1YJ9 1;  4MH4 A;  3CCV 1;  1N8R 2;  4A3J I;  1NJI 2;  3CC7 Z;  1KC8 1;  3CCS 1;  1YIT 1;  1VQ8 Z;  2V8I A;  1SFO I;  2PM9 A;  2VF1 A;  2VUG A;  1VQN 1;  4CL1 A;  4E33 A;  4RVF A;  1TWF I;  3CXC Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...