1Q7Y2

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q7y200
1M901 1VQ61 1VQ51 1YIJ1 1N8R1 1QVFZ 3G4SZ 1N8R2 3CC71 1KQSY 3I55Z 1VQ41 1QVGY 2OTJZ 1M1K2 1Q822 1VQ6Z 1M1K1 3I551 1W2BY 3CCUZ 3CC7Z 1Q862 3CPWZ 1YIT1 1YJ9Z 1YJNZ 1NJI2 1VQ5Z 2OTJ1 1VQ4Z 1VQO1 2QA41 3CCQ1 3CMEZ 1S72Z 3I561 1YJW1 1VQKZ 1VQ9Z 1M902 1VQ8Z 3G6E1 3CC2Z 1YI2Z 1K9M2 1VQLZ 3CCL1 3G711 3CCM1 3CCR1 1YHQ1 1Q861 1Q812 3CCE1 1K732 1K731 1QVFY 3CCJ1 3CC4Z 2QEXZ 3CCV1 1VQPZ 1VQN1 3CPWY 3CMA1 1K9M1 1VQMZ 3CD6Z 1K8A1 1VQM1 1VQ71 3OW2Y 3CC21 1Q821 1VQ7Z 3CC41 3CCJZ 1VQ81 1Q811 1KD12 1VQK1 3I56Z 1YJWZ 1W2BZ 3CCVZ 1VQP1 3CMAZ 1Q7Y1 1KC82 1YJ91 1KQSZ 2OTL1 1VQNZ 2OTLZ 3CXCZ 1QVGZ 1VQL1 1NJI1 3CXCY 3CD61 1JJ2Z 3G6EZ 1K8A2 3CCU1 2QEX1 3CCRZ 3CCMZ 1KD11 1YJN1 3G4S1 3CCLZ 3CME1 1S721 3CCQZ 2QA4Z 1VQOZ 3OW2Z 3CCEZ 1YIJZ 1Q7Y2 1YI21 1KC81 1VQ91 1YHQZ 3CCS1 1JJ2Y 3G71Z 3CCSZ 1YITZ
chains in the Genus database with same CATH superfamily
1WIIA 2NAPA 1N8R2 1WCMI 4Y7NI 3HOXI 2R7ZI 1RLYA 4RVGA 4E31A 1QVGY 2M6NA 4HH4A 3CC7Z 2KPIA 3CPWZ 1TWGI 1Y1VI 4NBAA 1I3QI 1VQKZ 3EEDA 4NOZA 3BG1B 3P5JB 1YI2Z 2Y0SA 3KIFA 4MH4A 2OOYB 3G711 3GTKI 2M48A 4MD8A 2B63I 1Q861 3NDIA 3PO3S 3S16I 2E2II 1K731 3GTPI 4NBHA 3CC4Z 4A3GI 2QEXZ 1SFOI 3ESWA 3PO2I 1VQPZ 2K3RA 3CPWY 3CD6Z 1X3WA 4MRIA 5D1OA 2PK7A 2WAQA 2E2HI 2YU9I 1Q821 1VQ7Z 2QREB 2OZKA 1Q811 3H3VJ 2PMZA 2RPRA 1X3ZA 1VQP1 4BBRI 1KC82 5FLMI 1L1OC 1I50I 2O53A 2AKLA 4DGLA 1K8A2 4NBDA 3CQZI 3CCU1 4S1TA 2P28A 3CCMZ 1KD11 1YJN1 2NVXI 2QA4Z 1VQOZ 1YIJZ 1Q7Y2 1QYPA 1YHQZ 3GTOI 3CCS1 4DQYB 1JJ2Y 2LFUA 2VPZA 4E2XA 1M901 1Z03A 2V8IA 1Y8CA 2HF1A 3GCFA 4AYBA 3GKQA 1K83I 5C4XI 2AYDA 4HGZA 2OTJZ 3JAMf 3J80b 4A3DI 4NFRA 2GTIA 2NVYI 2VUGA 1M1K1 3I551 1YUKA 3J81f 1W2BY 3Q87A 1PFTA 3U50C 1YJ9Z 2JA7I 1YJNZ 2J6AA 2Q4ZA 1VQ5Z 1DL6A 3HOZI 1S72Z 3I561 4A93I 1VQ8Z 3PO3I 2DE7A 2JNYA 3CC2Z 4BY1I 1ZB9A 2IZ4A 3D9XA 3CCL1 4RVHA 5AN9F 2R92I 2JA8I 3CCR1 3RZOI 1Q812 5D1PA 3CCE1 1P9NA 1S7MA 2W03A 4TNUA 2NVTI 3VMGA 2RHBA 2JA6I 4BXXI 1RO0A 1K9M1 4A3II 4E2WA 1K8A1 5IT9f 4E2YA 4MONA 3VB9A 3CC41 1VQ81 2JR6A 3I56Z 2IZ3A 4A3CI 3CMAZ 1Q7Y1 1YJ91 1KQSZ 4BY7I 2F4OA 5CM2M 4X6AI 3MONA 5IP7I 2JA5I 2WB1A 1VQL1 3CXCY 3CD61 4A3LI 1RO2A 2JIQA 5FLXb 1KRLA 4BBSI 2RT9A 3G4S1 3CCLZ 1FDOA 3GTMS 3HOWI 3CME1 2Q51A 3CCQZ 3CCEZ 1KC81 1VQ91 1ZB8A 2JIRA 1I6HI 2JIPA 2RBLA 1YITZ 2OOXB 2QRDB 1VQ61 1VQ51 2VF1A 1YIJ1 3IFUA 3HOVI 3G4SZ 4DK1A 2R93I 5C4JI 2QKDA 1NP6A 1M1K2 1Q822 2VPYA 4RS4A 2E2JI 4NBEA 4MXUA 3HKZA 3CCUZ 1TWAI 4MD9A 3T4NB 3GTQI 4NBFA 5A2Qb 3GTJI 1SIWA 2OTJ1 3CCQ1 4A3FI 3IF8A 3RZDI 1Q16A 1ML8A 1LQLA 2GU2A 3HOUI 3M3YI 4E30A 1K9M2 4EWCA 2P3YA 3CCM1 3NH5A 2VPWA 1YHQ1 2JUBA 3GTGI 1RQFA 4NB9A 3S1RI 2I3CA 1QVFY 3CCJ1 1USPA 2JMOA 3H0GI 2QRCB 5IP9I 3CCV1 4RVDA 1JWHC 3CMA1 2RIQA 1VQMZ 4RV9A 1VQM1 3OW2Y 4A3EI 3CC21 2V8JA 3MZLB 3NH4A 3D2LA 4XX2A 3CCJZ 5LL6f 3S1NI 1W2BZ 3CCVZ 4A3MI 1RNIA 2OTL1 1TWFI 5T6BA 3LUSA 1YUAA 2DE5A 1NUIA 2O4HA 4E2ZA 1NJI1 2W04A 3G6EZ 1AA6A 3I07A 2R6MA 2QEX1 5C44I 3CCRZ 3JAMb 1VLAA 3J80f 2LIYA 2KI7B 2NVQI 3D6WA 2JIOA 3OW2Z 1R9TI 2VPXA 3FKII 3F3PC 1TWHI 1TFIA 3K7AI 3G71Z 3CCSZ 3S1QI 2V45A 1N8R1 3HOYI 1QVFZ 3S17I 3CC71 1KQSY 4Y52I 3NDJA 3I55Z 3M4OI 4QTTA 5FLXf 1VQ41 3GTLI 2JIMA 2PM9A 4MD7A 3S1MI 5C3EI 1VQ6Z 3F3FC 1FDIA 4NBCA 5T64A 1WW9A 4CL1A 1Q862 2G2KA 2V8KA 1YIT1 3S15I 1RO4A 2DE6A 2LEXA 1USPB 3VTNA 1NJI2 1VQ4Z 2QA41 1VQO1 3CMEZ 1Z02A 1YJW1 2QR1B 1ZH1A 4NBGA 1VQ9Z 1M902 3S14I 4A3BI 3G6E1 2VUMI 1VQLZ 4NB8A 3VMIA 3I4NI 3I4MI 2BJOA 1N2FA 1Y1VS 1TWCI 3BG0B 1X0TA 3J81b 1K732 3J7A4 2YADA 2H85A 5A2Qf 2JS4A 4A3JI 2V3VA 3IR7A 4RVFA 2IV2X 1WJ2A 1VQN1 2F4MA 4HGYA 1Z01A 3NH8A 1Y1WI 3FQMA 1VQ71 5D1OB 4E32A 3S2DI 2ZAEB 3VMHA 1KD12 1VQK1 1YJWZ 2GTHA 4NH1C 1WZNA 4E33A 3TE5B 1VQNZ 2E9HA 2OTLZ 3CXCZ 1QVGZ 3TDHB 2EGTA 1JJ2Z 2E7ZA 3NFZA 4QTUA 3EERA 1QXFA 5IT9b 2K5RA 2QLVB 3MZKB 3GTMI 3QWUA 4A3KI 1S721 3FQQA 1YI21 2HU9A 5T67A 3IX0A 3KIHA 1QF8A 4NBBA 3S2HI
chains in the Genus database with same CATH topology
1WIIA 1N8R2 1WCMI 4Y7NI 3HOXI 2R7ZI 1RLYA 4RVGA 4E31A 1QVGY 2M6NA 4HH4A 3CC7Z 2KPIA 3CPWZ 1TWGI 1Y1VI 4NBAA 1I3QI 1VQKZ 3EEDA 4NOZA 3BG1B 3P5JB 1YI2Z 2Y0SA 3KIFA 4MH4A 2OOYB 3G711 3GTKI 2M48A 4MD8A 2B63I 1Q861 3NDIA 3PO3S 3S16I 2E2II 1K731 3GTPI 4NBHA 3CC4Z 4A3GI 2QEXZ 1SFOI 3ESWA 3PO2I 1VQPZ 2K3RA 3CPWY 3CD6Z 1X3WA 4MRIA 5D1OA 2PK7A 2WAQA 2E2HI 2YU9I 1Q821 1VQ7Z 2QREB 2OZKA 1Q811 3H3VJ 2PMZA 2RPRA 1X3ZA 1VQP1 4BBRI 1KC82 5FLMI 1L1OC 1I50I 2O53A 2AKLA 4DGLA 1K8A2 4NBDA 3CQZI 3CCU1 4S1TA 2P28A 3CCMZ 1KD11 1YJN1 2NVXI 2QA4Z 1VQOZ 1YIJZ 1Q7Y2 1QYPA 1YHQZ 3GTOI 3CCS1 4DQYB 1JJ2Y 2LFUA 4E2XA 1M901 1Z03A 2V8IA 2HF1A 3GCFA 4AYBA 3GKQA 1K83I 5C4XI 4HGZA 2OTJZ 3JAMf 3J80b 4A3DI 4NFRA 2GTIA 2NVYI 2VUGA 1M1K1 3I551 1YUKA 3J81f 1W2BY 3Q87A 1PFTA 3U50C 1YJ9Z 2JA7I 1YJNZ 2J6AA 2Q4ZA 1VQ5Z 1DL6A 3HOZI 1S72Z 3I561 4A93I 1VQ8Z 3PO3I 2DE7A 2JNYA 3CC2Z 4BY1I 1ZB9A 2IZ4A 3D9XA 3CCL1 4RVHA 5AN9F 2R92I 2JA8I 3CCR1 3RZOI 1Q812 5D1PA 3CCE1 1P9NA 1S7MA 2W03A 4TNUA 2NVTI 3VMGA 2RHBA 2JA6I 4BXXI 1RO0A 1K9M1 4A3II 4E2WA 1K8A1 5IT9f 4E2YA 4MONA 3VB9A 3CC41 1VQ81 2JR6A 3I56Z 2IZ3A 4A3CI 3CMAZ 1Q7Y1 1YJ91 1KQSZ 4BY7I 2F4OA 5CM2M 4X6AI 3MONA 5IP7I 2JA5I 2WB1A 1VQL1 3CXCY 3CD61 4A3LI 1RO2A 5FLXb 1KRLA 4BBSI 2RT9A 3G4S1 3CCLZ 3GTMS 3HOWI 3CME1 2Q51A 3CCQZ 3CCEZ 1KC81 1VQ91 1ZB8A 1I6HI 2RBLA 1YITZ 2OOXB 2QRDB 1VQ61 1VQ51 2VF1A 1YIJ1 3IFUA 3HOVI 3G4SZ 4DK1A 2R93I 5C4JI 2QKDA 1NP6A 1M1K2 1Q822 4RS4A 2E2JI 4NBEA 4MXUA 3HKZA 3CCUZ 1TWAI 4MD9A 3T4NB 3GTQI 4NBFA 5A2Qb 3GTJI 2OTJ1 3CCQ1 4A3FI 3IF8A 3RZDI 1ML8A 1LQLA 2GU2A 3HOUI 3M3YI 4E30A 1K9M2 4EWCA 2P3YA 3CCM1 3NH5A 1YHQ1 2JUBA 3GTGI 1RQFA 4NB9A 3S1RI 2I3CA 1QVFY 3CCJ1 1USPA 2JMOA 3H0GI 2QRCB 5IP9I 3CCV1 4RVDA 1JWHC 3CMA1 2RIQA 1VQMZ 4RV9A 1VQM1 3OW2Y 4A3EI 3CC21 2V8JA 3MZLB 3NH4A 4XX2A 3CCJZ 5LL6f 3S1NI 1W2BZ 3CCVZ 4A3MI 1RNIA 2OTL1 1TWFI 5T6BA 3LUSA 1YUAA 2DE5A 1NUIA 2O4HA 4E2ZA 1NJI1 2W04A 3G6EZ 3I07A 2R6MA 2QEX1 5C44I 3CCRZ 3JAMb 1VLAA 3J80f 2LIYA 2KI7B 2NVQI 3D6WA 3OW2Z 1R9TI 3FKII 3F3PC 1TWHI 1TFIA 3K7AI 3G71Z 3CCSZ 3S1QI 1N8R1 3HOYI 1QVFZ 3S17I 3CC71 1KQSY 4Y52I 3NDJA 3I55Z 3M4OI 4QTTA 5FLXf 1VQ41 3GTLI 2PM9A 4MD7A 3S1MI 5C3EI 1VQ6Z 3F3FC 4NBCA 5T64A 1WW9A 4CL1A 1Q862 2G2KA 2V8KA 1YIT1 3S15I 1RO4A 2DE6A 1USPB 3VTNA 1NJI2 1VQ4Z 2QA41 1VQO1 3CMEZ 1Z02A 1YJW1 2QR1B 1ZH1A 4NBGA 1VQ9Z 1M902 3S14I 4A3BI 3G6E1 2VUMI 1VQLZ 4NB8A 3VMIA 3I4NI 3I4MI 2BJOA 1N2FA 1Y1VS 1TWCI 3BG0B 1X0TA 3J81b 1K732 3J7A4 2YADA 2H85A 5A2Qf 2JS4A 4A3JI 4RVFA 1VQN1 2F4MA 4HGYA 1Z01A 3NH8A 1Y1WI 3FQMA 1VQ71 5D1OB 4E32A 3S2DI 2ZAEB 3VMHA 1KD12 1VQK1 1YJWZ 2GTHA 4NH1C 4E33A 3TE5B 1VQNZ 2E9HA 2OTLZ 3CXCZ 1QVGZ 3TDHB 2EGTA 1JJ2Z 3NFZA 4QTUA 3EERA 5IT9b 2K5RA 2QLVB 3MZKB 3GTMI 3QWUA 4A3KI 1S721 3FQQA 1YI21 2HU9A 5T67A 3IX0A 3KIHA 1QF8A 4NBBA 3S2HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 1;  1VQ6 1;  1VQ5 1;  1YIJ 1;  1N8R 1;  1QVF Z;  3G4S Z;  1N8R 2;  3CC7 1;  1KQS Y;  3I55 Z;  1VQ4 1;  1QVG Y;  2OTJ Z;  1M1K 2;  1Q82 2;  1VQ6 Z;  1M1K 1;  3I55 1;  1W2B Y;  3CCU Z;  3CC7 Z;  1Q86 2;  3CPW Z;  1YIT 1;  1YJ9 Z;  1YJN Z;  1NJI 2;  1VQ5 Z;  2OTJ 1;  1VQ4 Z;  1VQO 1;  2QA4 1;  3CCQ 1;  3CME Z;  1S72 Z;  3I56 1;  1YJW 1;  1VQK Z;  1VQ9 Z;  1M90 2;  1VQ8 Z;  3G6E 1;  3CC2 Z;  1YI2 Z;  1K9M 2;  1VQL Z;  3CCL 1;  3G71 1;  3CCM 1;  3CCR 1;  1YHQ 1;  1Q86 1;  1Q81 2;  3CCE 1;  1K73 2;  1K73 1;  1QVF Y;  3CCJ 1;  3CC4 Z;  2QEX Z;  3CCV 1;  1VQP Z;  1VQN 1;  3CPW Y;  3CMA 1;  1K9M 1;  1VQM Z;  3CD6 Z;  1K8A 1;  1VQM 1;  1VQ7 1;  3OW2 Y;  3CC2 1;  1Q82 1;  1VQ7 Z;  3CC4 1;  3CCJ Z;  1VQ8 1;  1Q81 1;  1KD1 2;  1VQK 1;  3I56 Z;  1YJW Z;  1W2B Z;  3CCV Z;  1VQP 1;  3CMA Z;  1Q7Y 1;  1KC8 2;  1YJ9 1;  1KQS Z;  2OTL 1;  1VQN Z;  2OTL Z;  3CXC Z;  1QVG Z;  1VQL 1;  1NJI 1;  3CXC Y;  3CD6 1;  1JJ2 Z;  3G6E Z;  1K8A 2;  3CCU 1;  2QEX 1;  3CCR Z;  3CCM Z;  1KD1 1;  1YJN 1;  3G4S 1;  3CCL Z;  3CME 1;  1S72 1;  3CCQ Z;  2QA4 Z;  1VQO Z;  3OW2 Z;  3CCE Z;  1YIJ Z;  1Q7Y 2;  1YI2 1;  1KC8 1;  1VQ9 1;  1YHQ Z;  3CCS 1;  1JJ2 Y;  3G71 Z;  3CCS Z;  1YIT Z; 
#chains in the Genus database with same CATH topology
 1WII A;  2NAP A;  1N8R 2;  1WCM I;  4Y7N I;  3HOX I;  2R7Z I;  1RLY A;  4RVG A;  4E31 A;  1QVG Y;  2M6N A;  4HH4 A;  3CC7 Z;  2KPI A;  3CPW Z;  1TWG I;  1Y1V I;  4NBA A;  1I3Q I;  1VQK Z;  3EED A;  4NOZ A;  3BG1 B;  3P5J B;  1YI2 Z;  2Y0S A;  3KIF A;  4MH4 A;  2OOY B;  3G71 1;  3GTK I;  2M48 A;  4MD8 A;  2B63 I;  1Q86 1;  3NDI A;  3PO3 S;  3S16 I;  2E2I I;  1K73 1;  3GTP I;  4NBH A;  3CC4 Z;  4A3G I;  2QEX Z;  1SFO I;  3ESW A;  3PO2 I;  1VQP Z;  2K3R A;  3CPW Y;  3CD6 Z;  1X3W A;  4MRI A;  5D1O A;  2PK7 A;  2WAQ A;  2E2H I;  2YU9 I;  1Q82 1;  1VQ7 Z;  2QRE B;  2OZK A;  1Q81 1;  3H3V J;  2PMZ A;  2RPR A;  1X3Z A;  1VQP 1;  4BBR I;  1KC8 2;  5FLM I;  1L1O C;  1I50 I;  2O53 A;  2AKL A;  4DGL A;  1K8A 2;  4NBD A;  3CQZ I;  3CCU 1;  4S1T A;  2P28 A;  3CCM Z;  1KD1 1;  1YJN 1;  2NVX I;  2QA4 Z;  1VQO Z;  1YIJ Z;  1Q7Y 2;  1QYP A;  1YHQ Z;  3GTO I;  3CCS 1;  4DQY B;  1JJ2 Y;  2LFU A;  2VPZ A;  4E2X A;  1M90 1;  1Z03 A;  2V8I A;  1Y8C A;  2HF1 A;  3GCF A;  4AYB A;  3GKQ A;  1K83 I;  5C4X I;  2AYD A;  4HGZ A;  2OTJ Z;  3JAM f;  3J80 b;  4A3D I;  4NFR A;  2GTI A;  2NVY I;  2VUG A;  1M1K 1;  3I55 1;  1YUK A;  3J81 f;  1W2B Y;  3Q87 A;  1PFT A;  3U50 C;  1YJ9 Z;  2JA7 I;  1YJN Z;  2J6A A;  2Q4Z A;  1VQ5 Z;  1DL6 A;  3HOZ I;  1S72 Z;  3I56 1;  4A93 I;  1VQ8 Z;  3PO3 I;  2DE7 A;  2JNY A;  3CC2 Z;  4BY1 I;  1ZB9 A;  2IZ4 A;  3D9X A;  3CCL 1;  4RVH A;  5AN9 F;  2R92 I;  2JA8 I;  3CCR 1;  3RZO I;  1Q81 2;  5D1P A;  3CCE 1;  1P9N A;  1S7M A;  2W03 A;  4TNU A;  2NVT I;  3VMG A;  2RHB A;  2JA6 I;  4BXX I;  1RO0 A;  1K9M 1;  4A3I I;  4E2W A;  1K8A 1;  5IT9 f;  4E2Y A;  4MON A;  3VB9 A;  3CC4 1;  1VQ8 1;  2JR6 A;  3I56 Z;  2IZ3 A;  4A3C I;  3CMA Z;  1Q7Y 1;  1YJ9 1;  1KQS Z;  4BY7 I;  2F4O A;  5CM2 M;  4X6A I;  3MON A;  5IP7 I;  2JA5 I;  2WB1 A;  1VQL 1;  3CXC Y;  3CD6 1;  4A3L I;  1RO2 A;  2JIQ A;  5FLX b;  1KRL A;  4BBS I;  2RT9 A;  3G4S 1;  3CCL Z;  1FDO A;  3GTM S;  3HOW I;  3CME 1;  2Q51 A;  3CCQ Z;  3CCE Z;  1KC8 1;  1VQ9 1;  1ZB8 A;  2JIR A;  1I6H I;  2JIP A;  2RBL A;  1YIT Z;  2OOX B;  2QRD B;  1VQ6 1;  1VQ5 1;  2VF1 A;  1YIJ 1;  3IFU A;  3HOV I;  3G4S Z;  4DK1 A;  2R93 I;  5C4J I;  2QKD A;  1NP6 A;  1M1K 2;  1Q82 2;  2VPY A;  4RS4 A;  2E2J I;  4NBE A;  4MXU A;  3HKZ A;  3CCU Z;  1TWA I;  4MD9 A;  3T4N B;  3GTQ I;  4NBF A;  5A2Q b;  3GTJ I;  1SIW A;  2OTJ 1;  3CCQ 1;  4A3F I;  3IF8 A;  3RZD I;  1Q16 A;  1ML8 A;  1LQL A;  2GU2 A;  3HOU I;  3M3Y I;  4E30 A;  1K9M 2;  4EWC A;  2P3Y A;  3CCM 1;  3NH5 A;  2VPW A;  1YHQ 1;  2JUB A;  3GTG I;  1RQF A;  4NB9 A;  3S1R I;  2I3C A;  1QVF Y;  3CCJ 1;  1USP A;  2JMO A;  3H0G I;  2QRC B;  5IP9 I;  3CCV 1;  4RVD A;  1JWH C;  3CMA 1;  2RIQ A;  1VQM Z;  4RV9 A;  1VQM 1;  3OW2 Y;  4A3E I;  3CC2 1;  2V8J A;  3MZL B;  3NH4 A;  3D2L A;  4XX2 A;  3CCJ Z;  5LL6 f;  3S1N I;  1W2B Z;  3CCV Z;  4A3M I;  1RNI A;  2OTL 1;  1TWF I;  5T6B A;  3LUS A;  1YUA A;  2DE5 A;  1NUI A;  2O4H A;  4E2Z A;  1NJI 1;  2W04 A;  3G6E Z;  1AA6 A;  3I07 A;  2R6M A;  2QEX 1;  5C44 I;  3CCR Z;  3JAM b;  1VLA A;  3J80 f;  2LIY A;  2KI7 B;  2NVQ I;  3D6W A;  2JIO A;  3OW2 Z;  1R9T I;  2VPX A;  3FKI I;  3F3P C;  1TWH I;  1TFI A;  3K7A I;  3G71 Z;  3CCS Z;  3S1Q I;  2V45 A;  1N8R 1;  3HOY I;  1QVF Z;  3S17 I;  3CC7 1;  1KQS Y;  4Y52 I;  3NDJ A;  3I55 Z;  3M4O I;  4QTT A;  5FLX f;  1VQ4 1;  3GTL I;  2JIM A;  2PM9 A;  4MD7 A;  3S1M I;  5C3E I;  1VQ6 Z;  3F3F C;  1FDI A;  4NBC A;  5T64 A;  1WW9 A;  4CL1 A;  1Q86 2;  2G2K A;  2V8K A;  1YIT 1;  3S15 I;  1RO4 A;  2DE6 A;  2LEX A;  1USP B;  3VTN A;  1NJI 2;  1VQ4 Z;  2QA4 1;  1VQO 1;  3CME Z;  1Z02 A;  1YJW 1;  2QR1 B;  1ZH1 A;  4NBG A;  1VQ9 Z;  1M90 2;  3S14 I;  4A3B I;  3G6E 1;  2VUM I;  1VQL Z;  4NB8 A;  3VMI A;  3I4N I;  3I4M I;  2BJO A;  1N2F A;  1Y1V S;  1TWC I;  3BG0 B;  1X0T A;  3J81 b;  1K73 2;  3J7A 4;  2YAD A;  2H85 A;  5A2Q f;  2JS4 A;  4A3J I;  2V3V A;  3IR7 A;  4RVF A;  2IV2 X;  1WJ2 A;  1VQN 1;  2F4M A;  4HGY A;  1Z01 A;  3NH8 A;  1Y1W I;  3FQM A;  1VQ7 1;  5D1O B;  4E32 A;  3S2D I;  2ZAE B;  3VMH A;  1KD1 2;  1VQK 1;  1YJW Z;  2GTH A;  4NH1 C;  1WZN A;  4E33 A;  3TE5 B;  1VQN Z;  2E9H A;  2OTL Z;  3CXC Z;  1QVG Z;  3TDH B;  2EGT A;  1JJ2 Z;  2E7Z A;  3NFZ A;  4QTU A;  3EER A;  1QXF A;  5IT9 b;  2K5R A;  2QLV B;  3MZK B;  3GTM I;  3QWU A;  4A3K I;  1S72 1;  3FQQ A;  1YI2 1;  2HU9 A;  5T67 A;  3IX0 A;  3KIH A;  1QF8 A;  4NBB A;  3S2H I; 
#chains in the Genus database with same CATH homology
 1WII A;  1N8R 2;  1WCM I;  4Y7N I;  3HOX I;  2R7Z I;  1RLY A;  4RVG A;  4E31 A;  1QVG Y;  2M6N A;  4HH4 A;  3CC7 Z;  2KPI A;  3CPW Z;  1TWG I;  1Y1V I;  4NBA A;  1I3Q I;  1VQK Z;  3EED A;  4NOZ A;  3BG1 B;  3P5J B;  1YI2 Z;  2Y0S A;  3KIF A;  4MH4 A;  2OOY B;  3G71 1;  3GTK I;  2M48 A;  4MD8 A;  2B63 I;  1Q86 1;  3NDI A;  3PO3 S;  3S16 I;  2E2I I;  1K73 1;  3GTP I;  4NBH A;  3CC4 Z;  4A3G I;  2QEX Z;  1SFO I;  3ESW A;  3PO2 I;  1VQP Z;  2K3R A;  3CPW Y;  3CD6 Z;  1X3W A;  4MRI A;  5D1O A;  2PK7 A;  2WAQ A;  2E2H I;  2YU9 I;  1Q82 1;  1VQ7 Z;  2QRE B;  2OZK A;  1Q81 1;  3H3V J;  2PMZ A;  2RPR A;  1X3Z A;  1VQP 1;  4BBR I;  1KC8 2;  5FLM I;  1L1O C;  1I50 I;  2O53 A;  2AKL A;  4DGL A;  1K8A 2;  4NBD A;  3CQZ I;  3CCU 1;  4S1T A;  2P28 A;  3CCM Z;  1KD1 1;  1YJN 1;  2NVX I;  2QA4 Z;  1VQO Z;  1YIJ Z;  1Q7Y 2;  1QYP A;  1YHQ Z;  3GTO I;  3CCS 1;  4DQY B;  1JJ2 Y;  2LFU A;  4E2X A;  1M90 1;  1Z03 A;  2V8I A;  2HF1 A;  3GCF A;  4AYB A;  3GKQ A;  1K83 I;  5C4X I;  4HGZ A;  2OTJ Z;  3JAM f;  3J80 b;  4A3D I;  4NFR A;  2GTI A;  2NVY I;  2VUG A;  1M1K 1;  3I55 1;  1YUK A;  3J81 f;  1W2B Y;  3Q87 A;  1PFT A;  3U50 C;  1YJ9 Z;  2JA7 I;  1YJN Z;  2J6A A;  2Q4Z A;  1VQ5 Z;  1DL6 A;  3HOZ I;  1S72 Z;  3I56 1;  4A93 I;  1VQ8 Z;  3PO3 I;  2DE7 A;  2JNY A;  3CC2 Z;  4BY1 I;  1ZB9 A;  2IZ4 A;  3D9X A;  3CCL 1;  4RVH A;  5AN9 F;  2R92 I;  2JA8 I;  3CCR 1;  3RZO I;  1Q81 2;  5D1P A;  3CCE 1;  1P9N A;  1S7M A;  2W03 A;  4TNU A;  2NVT I;  3VMG A;  2RHB A;  2JA6 I;  4BXX I;  1RO0 A;  1K9M 1;  4A3I I;  4E2W A;  1K8A 1;  5IT9 f;  4E2Y A;  4MON A;  3VB9 A;  3CC4 1;  1VQ8 1;  2JR6 A;  3I56 Z;  2IZ3 A;  4A3C I;  3CMA Z;  1Q7Y 1;  1YJ9 1;  1KQS Z;  4BY7 I;  2F4O A;  5CM2 M;  4X6A I;  3MON A;  5IP7 I;  2JA5 I;  2WB1 A;  1VQL 1;  3CXC Y;  3CD6 1;  4A3L I;  1RO2 A;  5FLX b;  1KRL A;  4BBS I;  2RT9 A;  3G4S 1;  3CCL Z;  3GTM S;  3HOW I;  3CME 1;  2Q51 A;  3CCQ Z;  3CCE Z;  1KC8 1;  1VQ9 1;  1ZB8 A;  1I6H I;  2RBL A;  1YIT Z;  2OOX B;  2QRD B;  1VQ6 1;  1VQ5 1;  2VF1 A;  1YIJ 1;  3IFU A;  3HOV I;  3G4S Z;  4DK1 A;  2R93 I;  5C4J I;  2QKD A;  1NP6 A;  1M1K 2;  1Q82 2;  4RS4 A;  2E2J I;  4NBE A;  4MXU A;  3HKZ A;  3CCU Z;  1TWA I;  4MD9 A;  3T4N B;  3GTQ I;  4NBF A;  5A2Q b;  3GTJ I;  2OTJ 1;  3CCQ 1;  4A3F I;  3IF8 A;  3RZD I;  1ML8 A;  1LQL A;  2GU2 A;  3HOU I;  3M3Y I;  4E30 A;  1K9M 2;  4EWC A;  2P3Y A;  3CCM 1;  3NH5 A;  1YHQ 1;  2JUB A;  3GTG I;  1RQF A;  4NB9 A;  3S1R I;  2I3C A;  1QVF Y;  3CCJ 1;  1USP A;  2JMO A;  3H0G I;  2QRC B;  5IP9 I;  3CCV 1;  4RVD A;  1JWH C;  3CMA 1;  2RIQ A;  1VQM Z;  4RV9 A;  1VQM 1;  3OW2 Y;  4A3E I;  3CC2 1;  2V8J A;  3MZL B;  3NH4 A;  4XX2 A;  3CCJ Z;  5LL6 f;  3S1N I;  1W2B Z;  3CCV Z;  4A3M I;  1RNI A;  2OTL 1;  1TWF I;  5T6B A;  3LUS A;  1YUA A;  2DE5 A;  1NUI A;  2O4H A;  4E2Z A;  1NJI 1;  2W04 A;  3G6E Z;  3I07 A;  2R6M A;  2QEX 1;  5C44 I;  3CCR Z;  3JAM b;  1VLA A;  3J80 f;  2LIY A;  2KI7 B;  2NVQ I;  3D6W A;  3OW2 Z;  1R9T I;  3FKI I;  3F3P C;  1TWH I;  1TFI A;  3K7A I;  3G71 Z;  3CCS Z;  3S1Q I;  1N8R 1;  3HOY I;  1QVF Z;  3S17 I;  3CC7 1;  1KQS Y;  4Y52 I;  3NDJ A;  3I55 Z;  3M4O I;  4QTT A;  5FLX f;  1VQ4 1;  3GTL I;  2PM9 A;  4MD7 A;  3S1M I;  5C3E I;  1VQ6 Z;  3F3F C;  4NBC A;  5T64 A;  1WW9 A;  4CL1 A;  1Q86 2;  2G2K A;  2V8K A;  1YIT 1;  3S15 I;  1RO4 A;  2DE6 A;  1USP B;  3VTN A;  1NJI 2;  1VQ4 Z;  2QA4 1;  1VQO 1;  3CME Z;  1Z02 A;  1YJW 1;  2QR1 B;  1ZH1 A;  4NBG A;  1VQ9 Z;  1M90 2;  3S14 I;  4A3B I;  3G6E 1;  2VUM I;  1VQL Z;  4NB8 A;  3VMI A;  3I4N I;  3I4M I;  2BJO A;  1N2F A;  1Y1V S;  1TWC I;  3BG0 B;  1X0T A;  3J81 b;  1K73 2;  3J7A 4;  2YAD A;  2H85 A;  5A2Q f;  2JS4 A;  4A3J I;  4RVF A;  1VQN 1;  2F4M A;  4HGY A;  1Z01 A;  3NH8 A;  1Y1W I;  3FQM A;  1VQ7 1;  5D1O B;  4E32 A;  3S2D I;  2ZAE B;  3VMH A;  1KD1 2;  1VQK 1;  1YJW Z;  2GTH A;  4NH1 C;  4E33 A;  3TE5 B;  1VQN Z;  2E9H A;  2OTL Z;  3CXC Z;  1QVG Z;  3TDH B;  2EGT A;  1JJ2 Z;  3NFZ A;  4QTU A;  3EER A;  5IT9 b;  2K5R A;  2QLV B;  3MZK B;  3GTM I;  3QWU A;  4A3K I;  1S72 1;  3FQQ A;  1YI2 1;  2HU9 A;  5T67 A;  3IX0 A;  3KIH A;  1QF8 A;  4NBB A;  3S2H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...