1Q7Y2

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q7y200
1YJ9Z 1KD11 1VQ81 3CCRZ 1VQ61 1VQ51 3I56Z 3CME1 1VQPZ 1YIJ1 1YJNZ 3CD61 1VQ8Z 1K731 1VQ6Z 1VQ5Z 3CMEZ 1VQM1 1YIJZ 1KD12 1N8R1 3CD6Z 3CMA1 1Q861 1K732 1VQ41 1VQO1 1VQ71 1QVFY 3CPWZ 1JJ2Z 1VQ4Z 1VQOZ 1VQ91 3CCJ1 1YHQ1 1Q862 1NJI2 1QVGZ 1M1K2 1YJW1 1VQ9Z 3CCJZ 1YHQZ 3I55Z 3CCL1 3CCS1 1YJWZ 3G711 1K8A1 1KC81 1VQN1 1VQMZ 3CCSZ 3CCLZ 1Q7Y1 3G71Z 1Q821 3CXCY 1YIT1 3CXCZ 3CMAZ 1VQNZ 1JJ2Y 3CPWY 1N8R2 1YITZ 1VQ7Z 1Q811 2QA41 1QVGY 1VQL1 1Q822 1M901 2QA4Z 1VQLZ 3CCE1 1S721 3CCU1 3CCQ1 3CC41 1K9M1 3CC21 3CCEZ 1S72Z 1KQSZ 3CCUZ 3CCQZ 3CC4Z 3CC2Z 1W2BZ 2OTL1 1K9M2 1K8A2 1KC82 3G6E1 3G4S1 2OTLZ 1YI21 1Q7Y2 3G6EZ 2QEX1 3G4SZ 2OTJ1 1YI2Z 3CC71 3OW2Y 3CCV1 3OW2Z 3CCM1 1Q812 2QEXZ 1NJI1 1KQSY 1M902 2OTJZ 1VQK1 3I551 3CC7Z 1M1K1 1YJ91 3CCVZ 3CCR1 3I561 3CCMZ 1W2BY 1VQP1 1QVFZ 1VQKZ 1YJN1
chains in the Genus database with same CATH superfamily
3RZDI 4A3DI 1VQ81 2JIPA 3KIHA 2QRDB 1YIJ1 4A3CI 2E2II 3Q87A 3S15I 2JA6I 2V8JA 3CD6Z 1Q16A 1TWAI 2JIRA 2NVQI 3S1NI 2F4MA 2PM9A 3S16I 1NUIA 3HOUI 2LEXA 3S1MI 3H0GI 2RIQA 2VUMI 4MXUA 1ZH1A 2P3YA 1QVGZ 3GTQI 2VF1A 2GTHA 2HU9A 4NH1C 1YHQZ 2DE6A 1TWCI 2PMZA 4A3FI 3CCS1 1TWGI 1YJWZ 3G711 2BJOA 1K8A1 2NVTI 4TNUA 3CXCY 3GTMI 2B63I 1VQNZ 1KRLA 3GCFA 1USPA 5A2Qf 1YITZ 1Q811 2JUBA 1S7MA 4Y52I 3GTLI 2QA4Z 2R93I 1S721 3RZOI 3CCQ1 3MZKB 2QLVB 3CC41 3I4NI 4QTUA 3IFUA 3PO3I 1ZB9A 3PO3S 1WIIA 5FLMI 1JWHC 2LIYA 4E32A 3G6E1 4BXXI 3G4S1 3M3YI 1K83I 2JIOA 3GTGI 3S1RI 2R7ZI 4A3KI 2E2JI 3S2HI 2W03A 1Y1WI 1VLAA 1KQSY 2OTJZ 3I551 1M1K1 3QWUA 2EGTA 1QF8A 1W2BY 3PO2I 5D1OA 4MD7A 3J81f 2G2KA 3GTJI 1KD11 3I56Z 1Y1VI 3HOVI 1Y1VS 1I6HI 2P28A 3CD61 1VQ6Z 1VQ5Z 2NVXI 1KD12 4NBCA 3F3FC 3VMIA 3D6WA 3CMA1 1Q861 5FLXb 1PFTA 1VQ71 1RO0A 2O53A 2YADA 1QVFY 1JJ2Z 1VQOZ 3JAMb 1YHQ1 4QTTA 1Q862 4NBAA 1YJW1 1VQ9Z 4HH4A 4AYBA 3VTNA 2WB1A 2E7ZA 3IX0A 3J80f 2JMOA 1RLYA 1KC81 2QRCB 1VQN1 2K5RA 2IV2X 3HOYI 1YIT1 3S2DI 2GU2A 3CMAZ 3CPWY 1Y8CA 2RT9A 1N2FA 1VQ7Z 2QA41 1M901 1TWFI 2J6AA 4CL1A 4A3EI 1K9M1 1USPB 2GTIA 1TFIA 3TE5B 2JIQA 2I3CA 3CCEZ 2Q4ZA 1ZB8A 3HKZA 4DGLA 3KIFA 3FQMA 4NBGA 2R92I 1K9M2 4XX2A 1K8A2 2JIMA 3FKII 2V8KA 2OTLZ 3LUSA 2OOYB 4E2YA 2OTJ1 1YI2Z 1Q812 2JA8I 5T6BA 3H3VJ 2QEXZ 1NJI1 2M48A 2JNYA 1I50I 2AYDA 3I561 2KI7B 2VPXA 1YUAA 5CM2M 5C3EI 1YUKA 1VQKZ 1YJ9Z 2IZ3A 1VQ61 1VQ51 1R9TI 1VQPZ 3CQZI 3HOWI 3NDIA 3M4OI 3NDJA 1YJNZ 3D2LA 5C44I 3NFZA 3CMEZ 2RBLA 1QXFA 4A3II 1N8R1 2RHBA 4E2XA 4NBHA 3GTPI 4DK1A 1VQO1 2VPZA 3IF8A 5IP9I 4A3MI 1VQ4Z 1VQ91 5IP7I 3FQQA 1M1K2 3CCJZ 4BY1I 1WZNA 3TDHB 3D9XA 5LL6f 4RS4A 3S17I 4E2ZA 4NB9A 3MZLB 3T4NB 3HOXI 3CCLZ 3NH8A 3GTOI 4MH4A 3U50C 1Q7Y1 2LFUA 4RVDA 1Q821 4NBBA 2DE7A 1X3WA 3S1QI 1RO4A 4E2WA 1QVGY 4E30A 1Q822 2O4HA 3I07A 3HOZI 1Z02A 3S14I 1VQLZ 3CCE1 2VPWA 1WCMI 2KPIA 3BG1B 2E9HA 2NVYI 4BY7I 1KQSZ 4HGZA 5C4XI 3CCUZ 4RVGA 2JA5I 3CC2Z 1W2BZ 2OTL1 2AKLA 5IT9f 1FDOA 3P5JB 4NBEA 1KC82 4HGYA 4MD8A 2OOXB 4RVHA 4NBFA 1YI21 4EWCA 2V45A 2M6NA 5A2Qb 2QEX1 3NH5A 5FLXf 3OW2Z 1I3QI 4RVFA 1RO2A 3VMGA 4A3JI 2V3VA 2JA7I 5T64A 1X3ZA 1LQLA 4BBSI 1M902 1VQK1 3JAMf 3CC7Z 2V8IA 1YJ91 3CCVZ 4NOZA 3CCMZ 1WJ2A 1VQP1 2ZAEB 4MRIA 3VB9A 1QVFZ 2VUGA 1YJN1 3CCRZ 4DQYB 2QKDA 3CME1 4NFRA 2F4OA 5C4JI 1VQ8Z 1K731 1VQM1 1YIJZ 3ESWA 2NAPA 1DL6A 4NB8A 3EEDA 2Q51A 3EERA 4Y7NI 1K732 1VQ41 1ML8A 4A3BI 2IZ4A 3GTMS 5AN9F 2W04A 3NH4A 2R6MA 3CPWZ 2H85A 3CCJ1 3MONA 1NJI2 5T67A 2YU9I 2JS4A 3J81b 5D1OB 1L1OC 3CCL1 3F3PC 4BBRI 2VPYA 1Z01A 1TWHI 2RPRA 1VQMZ 3CCSZ 3VMHA 4S1TA 4X6AI 3G71Z 1SIWA 4A3LI 3CXCZ 4A93I 1JJ2Y 4NBDA 1AA6A 1N8R2 4MD9A 1VQL1 1FDIA 1Z03A 4E33A 2K3RA 2OZKA 4MONA 5D1PA 2QREB 1RNIA 1X0TA 3CCU1 3CC21 3BG0B 3J80b 1S72Z 4A3GI 3CCQZ 3K7AI 3CC4Z 4E31A 2QR1B 3GKQA 2WAQA 3IR7A 1P9NA 5IT9b 2E2HI 1Q7Y2 3G6EZ 2Y0SA 3I4MI 3G4SZ 2HF1A 3CC71 3OW2Y 2DE5A 3CCV1 3CCM1 3J7A4 1NP6A 2JR6A 4RV9A 1SFOI 2PK7A 3CCR1 3GTKI 1QYPA 1RQFA 1WW9A 3I55Z
chains in the Genus database with same CATH topology
3RZDI 4A3DI 1VQ81 3KIHA 2QRDB 1YIJ1 4A3CI 2E2II 3Q87A 3S15I 2JA6I 2V8JA 3CD6Z 1TWAI 2NVQI 3S1NI 2F4MA 2PM9A 3S16I 1NUIA 3HOUI 3S1MI 3H0GI 2RIQA 2VUMI 4MXUA 1ZH1A 2P3YA 1QVGZ 3GTQI 2VF1A 2GTHA 2HU9A 4NH1C 1YHQZ 2DE6A 1TWCI 2PMZA 4A3FI 3CCS1 1TWGI 1YJWZ 3G711 2BJOA 1K8A1 2NVTI 4TNUA 3CXCY 3GTMI 2B63I 1VQNZ 1KRLA 3GCFA 1USPA 5A2Qf 1YITZ 1Q811 2JUBA 1S7MA 4Y52I 3GTLI 2QA4Z 2R93I 1S721 3RZOI 3CCQ1 3MZKB 2QLVB 3CC41 3I4NI 4QTUA 3IFUA 3PO3I 1ZB9A 3PO3S 1WIIA 5FLMI 1JWHC 2LIYA 4E32A 3G6E1 4BXXI 3G4S1 3M3YI 1K83I 3GTGI 3S1RI 2R7ZI 4A3KI 2E2JI 3S2HI 2W03A 1Y1WI 1VLAA 1KQSY 2OTJZ 3I551 1M1K1 3QWUA 2EGTA 1QF8A 1W2BY 3PO2I 5D1OA 4MD7A 3J81f 2G2KA 3GTJI 1KD11 3I56Z 1Y1VI 3HOVI 1Y1VS 1I6HI 2P28A 3CD61 1VQ6Z 1VQ5Z 2NVXI 1KD12 4NBCA 3F3FC 3VMIA 3D6WA 3CMA1 1Q861 5FLXb 1PFTA 1VQ71 1RO0A 2O53A 2YADA 1QVFY 1JJ2Z 1VQOZ 3JAMb 1YHQ1 4QTTA 1Q862 4NBAA 1YJW1 1VQ9Z 4HH4A 4AYBA 3VTNA 2WB1A 3IX0A 3J80f 2JMOA 1RLYA 1KC81 2QRCB 1VQN1 2K5RA 3HOYI 1YIT1 3S2DI 2GU2A 3CMAZ 3CPWY 2RT9A 1N2FA 1VQ7Z 2QA41 1M901 1TWFI 2J6AA 4CL1A 4A3EI 1K9M1 1USPB 2GTIA 1TFIA 3TE5B 2I3CA 3CCEZ 2Q4ZA 1ZB8A 3HKZA 4DGLA 3KIFA 3FQMA 4NBGA 2R92I 1K9M2 4XX2A 1K8A2 3FKII 2V8KA 2OTLZ 3LUSA 2OOYB 4E2YA 2OTJ1 1YI2Z 1Q812 2JA8I 5T6BA 3H3VJ 2QEXZ 1NJI1 2M48A 2JNYA 1I50I 3I561 2KI7B 1YUAA 5CM2M 5C3EI 1YUKA 1VQKZ 1YJ9Z 2IZ3A 1VQ61 1VQ51 1R9TI 1VQPZ 3CQZI 3HOWI 3NDIA 3M4OI 3NDJA 1YJNZ 5C44I 3NFZA 3CMEZ 2RBLA 4A3II 1N8R1 2RHBA 4E2XA 4NBHA 3GTPI 4DK1A 1VQO1 3IF8A 5IP9I 4A3MI 1VQ4Z 1VQ91 5IP7I 3FQQA 1M1K2 3CCJZ 4BY1I 3TDHB 3D9XA 5LL6f 4RS4A 3S17I 4E2ZA 4NB9A 3MZLB 3T4NB 3HOXI 3CCLZ 3NH8A 3GTOI 4MH4A 3U50C 1Q7Y1 2LFUA 4RVDA 1Q821 4NBBA 2DE7A 1X3WA 3S1QI 1RO4A 4E2WA 1QVGY 4E30A 1Q822 2O4HA 3I07A 3HOZI 1Z02A 3S14I 1VQLZ 3CCE1 1WCMI 2KPIA 3BG1B 2E9HA 2NVYI 4BY7I 1KQSZ 4HGZA 5C4XI 3CCUZ 4RVGA 2JA5I 3CC2Z 1W2BZ 2OTL1 2AKLA 5IT9f 3P5JB 4NBEA 1KC82 4HGYA 4MD8A 2OOXB 4RVHA 4NBFA 1YI21 4EWCA 2M6NA 5A2Qb 2QEX1 3NH5A 5FLXf 3OW2Z 1I3QI 4RVFA 1RO2A 3VMGA 4A3JI 2JA7I 5T64A 1X3ZA 1LQLA 4BBSI 1M902 1VQK1 3CC7Z 3JAMf 2V8IA 1YJ91 3CCVZ 4NOZA 3CCMZ 1VQP1 2ZAEB 4MRIA 3VB9A 1QVFZ 2VUGA 1YJN1 3CCRZ 4DQYB 2QKDA 3CME1 4NFRA 2F4OA 5C4JI 1VQ8Z 1K731 1VQM1 1YIJZ 3ESWA 1DL6A 4NB8A 3EEDA 2Q51A 3EERA 4Y7NI 1K732 1VQ41 1ML8A 4A3BI 2IZ4A 3GTMS 5AN9F 2W04A 3NH4A 2R6MA 3CPWZ 2H85A 3CCJ1 3MONA 1NJI2 5T67A 2YU9I 2JS4A 3J81b 5D1OB 1L1OC 3CCL1 3F3PC 4BBRI 1Z01A 1TWHI 2RPRA 1VQMZ 3CCSZ 3VMHA 4S1TA 4X6AI 3G71Z 4A3LI 3CXCZ 4A93I 1JJ2Y 4NBDA 1N8R2 4MD9A 1VQL1 1Z03A 4E33A 2K3RA 2OZKA 4MONA 5D1PA 2QREB 1RNIA 1X0TA 3CCU1 3CC21 3BG0B 3J80b 1S72Z 4A3GI 3CCQZ 3K7AI 3CC4Z 4E31A 2QR1B 3GKQA 2WAQA 1P9NA 5IT9b 2E2HI 1Q7Y2 3G6EZ 2Y0SA 3I4MI 3G4SZ 2HF1A 3CC71 3OW2Y 2DE5A 3CCV1 3CCM1 3J7A4 1NP6A 2JR6A 4RV9A 1SFOI 2PK7A 3CCR1 3GTKI 1QYPA 1RQFA 1WW9A 3I55Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  1KD1 1;  1VQ8 1;  3CCR Z;  1VQ6 1;  1VQ5 1;  3I56 Z;  3CME 1;  1VQP Z;  1YIJ 1;  1YJN Z;  3CD6 1;  1VQ8 Z;  1K73 1;  1VQ6 Z;  1VQ5 Z;  3CME Z;  1VQM 1;  1YIJ Z;  1KD1 2;  1N8R 1;  3CD6 Z;  3CMA 1;  1Q86 1;  1K73 2;  1VQ4 1;  1VQO 1;  1VQ7 1;  1QVF Y;  3CPW Z;  1JJ2 Z;  1VQ4 Z;  1VQO Z;  1VQ9 1;  3CCJ 1;  1YHQ 1;  1Q86 2;  1NJI 2;  1QVG Z;  1M1K 2;  1YJW 1;  1VQ9 Z;  3CCJ Z;  1YHQ Z;  3I55 Z;  3CCL 1;  3CCS 1;  1YJW Z;  3G71 1;  1K8A 1;  1KC8 1;  1VQN 1;  1VQM Z;  3CCS Z;  3CCL Z;  1Q7Y 1;  3G71 Z;  1Q82 1;  3CXC Y;  1YIT 1;  3CXC Z;  3CMA Z;  1VQN Z;  1JJ2 Y;  3CPW Y;  1N8R 2;  1YIT Z;  1VQ7 Z;  1Q81 1;  2QA4 1;  1QVG Y;  1VQL 1;  1Q82 2;  1M90 1;  2QA4 Z;  1VQL Z;  3CCE 1;  1S72 1;  3CCU 1;  3CCQ 1;  3CC4 1;  1K9M 1;  3CC2 1;  3CCE Z;  1S72 Z;  1KQS Z;  3CCU Z;  3CCQ Z;  3CC4 Z;  3CC2 Z;  1W2B Z;  2OTL 1;  1K9M 2;  1K8A 2;  1KC8 2;  3G6E 1;  3G4S 1;  2OTL Z;  1YI2 1;  1Q7Y 2;  3G6E Z;  2QEX 1;  3G4S Z;  2OTJ 1;  1YI2 Z;  3CC7 1;  3OW2 Y;  3CCV 1;  3OW2 Z;  3CCM 1;  1Q81 2;  2QEX Z;  1NJI 1;  1KQS Y;  1M90 2;  2OTJ Z;  1VQK 1;  3I55 1;  3CC7 Z;  1M1K 1;  1YJ9 1;  3CCV Z;  3CCR 1;  3I56 1;  3CCM Z;  1W2B Y;  1VQP 1;  1QVF Z;  1VQK Z;  1YJN 1; 
#chains in the Genus database with same CATH topology
 3RZD I;  4A3D I;  1VQ8 1;  2JIP A;  3KIH A;  2QRD B;  1YIJ 1;  4A3C I;  2E2I I;  3Q87 A;  3S15 I;  2JA6 I;  2V8J A;  3CD6 Z;  1Q16 A;  1TWA I;  2JIR A;  2NVQ I;  3S1N I;  2F4M A;  2PM9 A;  3S16 I;  1NUI A;  3HOU I;  2LEX A;  3S1M I;  3H0G I;  2RIQ A;  2VUM I;  4MXU A;  1ZH1 A;  2P3Y A;  1QVG Z;  3GTQ I;  2VF1 A;  2GTH A;  2HU9 A;  4NH1 C;  1YHQ Z;  2DE6 A;  1TWC I;  2PMZ A;  4A3F I;  3CCS 1;  1TWG I;  1YJW Z;  3G71 1;  2BJO A;  1K8A 1;  2NVT I;  4TNU A;  3CXC Y;  3GTM I;  2B63 I;  1VQN Z;  1KRL A;  3GCF A;  1USP A;  5A2Q f;  1YIT Z;  1Q81 1;  2JUB A;  1S7M A;  4Y52 I;  3GTL I;  2QA4 Z;  2R93 I;  1S72 1;  3RZO I;  3CCQ 1;  3MZK B;  2QLV B;  3CC4 1;  3I4N I;  4QTU A;  3IFU A;  3PO3 I;  1ZB9 A;  3PO3 S;  1WII A;  5FLM I;  1JWH C;  2LIY A;  4E32 A;  3G6E 1;  4BXX I;  3G4S 1;  3M3Y I;  1K83 I;  2JIO A;  3GTG I;  3S1R I;  2R7Z I;  4A3K I;  2E2J I;  3S2H I;  2W03 A;  1Y1W I;  1VLA A;  1KQS Y;  2OTJ Z;  3I55 1;  1M1K 1;  3QWU A;  2EGT A;  1QF8 A;  1W2B Y;  3PO2 I;  5D1O A;  4MD7 A;  3J81 f;  2G2K A;  3GTJ I;  1KD1 1;  3I56 Z;  1Y1V I;  3HOV I;  1Y1V S;  1I6H I;  2P28 A;  3CD6 1;  1VQ6 Z;  1VQ5 Z;  2NVX I;  1KD1 2;  4NBC A;  3F3F C;  3VMI A;  3D6W A;  3CMA 1;  1Q86 1;  5FLX b;  1PFT A;  1VQ7 1;  1RO0 A;  2O53 A;  2YAD A;  1QVF Y;  1JJ2 Z;  1VQO Z;  3JAM b;  1YHQ 1;  4QTT A;  1Q86 2;  4NBA A;  1YJW 1;  1VQ9 Z;  4HH4 A;  4AYB A;  3VTN A;  2WB1 A;  2E7Z A;  3IX0 A;  3J80 f;  2JMO A;  1RLY A;  1KC8 1;  2QRC B;  1VQN 1;  2K5R A;  2IV2 X;  3HOY I;  1YIT 1;  3S2D I;  2GU2 A;  3CMA Z;  3CPW Y;  1Y8C A;  2RT9 A;  1N2F A;  1VQ7 Z;  2QA4 1;  1M90 1;  1TWF I;  2J6A A;  4CL1 A;  4A3E I;  1K9M 1;  1USP B;  2GTI A;  1TFI A;  3TE5 B;  2JIQ A;  2I3C A;  3CCE Z;  2Q4Z A;  1ZB8 A;  3HKZ A;  4DGL A;  3KIF A;  3FQM A;  4NBG A;  2R92 I;  1K9M 2;  4XX2 A;  1K8A 2;  2JIM A;  3FKI I;  2V8K A;  2OTL Z;  3LUS A;  2OOY B;  4E2Y A;  2OTJ 1;  1YI2 Z;  1Q81 2;  2JA8 I;  5T6B A;  3H3V J;  2QEX Z;  1NJI 1;  2M48 A;  2JNY A;  1I50 I;  2AYD A;  3I56 1;  2KI7 B;  2VPX A;  1YUA A;  5CM2 M;  5C3E I;  1YUK A;  1VQK Z;  1YJ9 Z;  2IZ3 A;  1VQ6 1;  1VQ5 1;  1R9T I;  1VQP Z;  3CQZ I;  3HOW I;  3NDI A;  3M4O I;  3NDJ A;  1YJN Z;  3D2L A;  5C44 I;  3NFZ A;  3CME Z;  2RBL A;  1QXF A;  4A3I I;  1N8R 1;  2RHB A;  4E2X A;  4NBH A;  3GTP I;  4DK1 A;  1VQO 1;  2VPZ A;  3IF8 A;  5IP9 I;  4A3M I;  1VQ4 Z;  1VQ9 1;  5IP7 I;  3FQQ A;  1M1K 2;  3CCJ Z;  4BY1 I;  1WZN A;  3TDH B;  3D9X A;  5LL6 f;  4RS4 A;  3S17 I;  4E2Z A;  4NB9 A;  3MZL B;  3T4N B;  3HOX I;  3CCL Z;  3NH8 A;  3GTO I;  4MH4 A;  3U50 C;  1Q7Y 1;  2LFU A;  4RVD A;  1Q82 1;  4NBB A;  2DE7 A;  1X3W A;  3S1Q I;  1RO4 A;  4E2W A;  1QVG Y;  4E30 A;  1Q82 2;  2O4H A;  3I07 A;  3HOZ I;  1Z02 A;  3S14 I;  1VQL Z;  3CCE 1;  2VPW A;  1WCM I;  2KPI A;  3BG1 B;  2E9H A;  2NVY I;  4BY7 I;  1KQS Z;  4HGZ A;  5C4X I;  3CCU Z;  4RVG A;  2JA5 I;  3CC2 Z;  1W2B Z;  2OTL 1;  2AKL A;  5IT9 f;  1FDO A;  3P5J B;  4NBE A;  1KC8 2;  4HGY A;  4MD8 A;  2OOX B;  4RVH A;  4NBF A;  1YI2 1;  4EWC A;  2V45 A;  2M6N A;  5A2Q b;  2QEX 1;  3NH5 A;  5FLX f;  3OW2 Z;  1I3Q I;  4RVF A;  1RO2 A;  3VMG A;  4A3J I;  2V3V A;  2JA7 I;  5T64 A;  1X3Z A;  1LQL A;  4BBS I;  1M90 2;  1VQK 1;  3JAM f;  3CC7 Z;  2V8I A;  1YJ9 1;  3CCV Z;  4NOZ A;  3CCM Z;  1WJ2 A;  1VQP 1;  2ZAE B;  4MRI A;  3VB9 A;  1QVF Z;  2VUG A;  1YJN 1;  3CCR Z;  4DQY B;  2QKD A;  3CME 1;  4NFR A;  2F4O A;  5C4J I;  1VQ8 Z;  1K73 1;  1VQM 1;  1YIJ Z;  3ESW A;  2NAP A;  1DL6 A;  4NB8 A;  3EED A;  2Q51 A;  3EER A;  4Y7N I;  1K73 2;  1VQ4 1;  1ML8 A;  4A3B I;  2IZ4 A;  3GTM S;  5AN9 F;  2W04 A;  3NH4 A;  2R6M A;  3CPW Z;  2H85 A;  3CCJ 1;  3MON A;  1NJI 2;  5T67 A;  2YU9 I;  2JS4 A;  3J81 b;  5D1O B;  1L1O C;  3CCL 1;  3F3P C;  4BBR I;  2VPY A;  1Z01 A;  1TWH I;  2RPR A;  1VQM Z;  3CCS Z;  3VMH A;  4S1T A;  4X6A I;  3G71 Z;  1SIW A;  4A3L I;  3CXC Z;  4A93 I;  1JJ2 Y;  4NBD A;  1AA6 A;  1N8R 2;  4MD9 A;  1VQL 1;  1FDI A;  1Z03 A;  4E33 A;  2K3R A;  2OZK A;  4MON A;  5D1P A;  2QRE B;  1RNI A;  1X0T A;  3CCU 1;  3CC2 1;  3BG0 B;  3J80 b;  1S72 Z;  4A3G I;  3CCQ Z;  3K7A I;  3CC4 Z;  4E31 A;  2QR1 B;  3GKQ A;  2WAQ A;  3IR7 A;  1P9N A;  5IT9 b;  2E2H I;  1Q7Y 2;  3G6E Z;  2Y0S A;  3I4M I;  3G4S Z;  2HF1 A;  3CC7 1;  3OW2 Y;  2DE5 A;  3CCV 1;  3CCM 1;  3J7A 4;  1NP6 A;  2JR6 A;  4RV9 A;  1SFO I;  2PK7 A;  3CCR 1;  3GTK I;  1QYP A;  1RQF A;  1WW9 A;  3I55 Z; 
#chains in the Genus database with same CATH homology
 3RZD I;  4A3D I;  1VQ8 1;  3KIH A;  2QRD B;  1YIJ 1;  4A3C I;  2E2I I;  3Q87 A;  3S15 I;  2JA6 I;  2V8J A;  3CD6 Z;  1TWA I;  2NVQ I;  3S1N I;  2F4M A;  2PM9 A;  3S16 I;  1NUI A;  3HOU I;  3S1M I;  3H0G I;  2RIQ A;  2VUM I;  4MXU A;  1ZH1 A;  2P3Y A;  1QVG Z;  3GTQ I;  2VF1 A;  2GTH A;  2HU9 A;  4NH1 C;  1YHQ Z;  2DE6 A;  1TWC I;  2PMZ A;  4A3F I;  3CCS 1;  1TWG I;  1YJW Z;  3G71 1;  2BJO A;  1K8A 1;  2NVT I;  4TNU A;  3CXC Y;  3GTM I;  2B63 I;  1VQN Z;  1KRL A;  3GCF A;  1USP A;  5A2Q f;  1YIT Z;  1Q81 1;  2JUB A;  1S7M A;  4Y52 I;  3GTL I;  2QA4 Z;  2R93 I;  1S72 1;  3RZO I;  3CCQ 1;  3MZK B;  2QLV B;  3CC4 1;  3I4N I;  4QTU A;  3IFU A;  3PO3 I;  1ZB9 A;  3PO3 S;  1WII A;  5FLM I;  1JWH C;  2LIY A;  4E32 A;  3G6E 1;  4BXX I;  3G4S 1;  3M3Y I;  1K83 I;  3GTG I;  3S1R I;  2R7Z I;  4A3K I;  2E2J I;  3S2H I;  2W03 A;  1Y1W I;  1VLA A;  1KQS Y;  2OTJ Z;  3I55 1;  1M1K 1;  3QWU A;  2EGT A;  1QF8 A;  1W2B Y;  3PO2 I;  5D1O A;  4MD7 A;  3J81 f;  2G2K A;  3GTJ I;  1KD1 1;  3I56 Z;  1Y1V I;  3HOV I;  1Y1V S;  1I6H I;  2P28 A;  3CD6 1;  1VQ6 Z;  1VQ5 Z;  2NVX I;  1KD1 2;  4NBC A;  3F3F C;  3VMI A;  3D6W A;  3CMA 1;  1Q86 1;  5FLX b;  1PFT A;  1VQ7 1;  1RO0 A;  2O53 A;  2YAD A;  1QVF Y;  1JJ2 Z;  1VQO Z;  3JAM b;  1YHQ 1;  4QTT A;  1Q86 2;  4NBA A;  1YJW 1;  1VQ9 Z;  4HH4 A;  4AYB A;  3VTN A;  2WB1 A;  3IX0 A;  3J80 f;  2JMO A;  1RLY A;  1KC8 1;  2QRC B;  1VQN 1;  2K5R A;  3HOY I;  1YIT 1;  3S2D I;  2GU2 A;  3CMA Z;  3CPW Y;  2RT9 A;  1N2F A;  1VQ7 Z;  2QA4 1;  1M90 1;  1TWF I;  2J6A A;  4CL1 A;  4A3E I;  1K9M 1;  1USP B;  2GTI A;  1TFI A;  3TE5 B;  2I3C A;  3CCE Z;  2Q4Z A;  1ZB8 A;  3HKZ A;  4DGL A;  3KIF A;  3FQM A;  4NBG A;  2R92 I;  1K9M 2;  4XX2 A;  1K8A 2;  3FKI I;  2V8K A;  2OTL Z;  3LUS A;  2OOY B;  4E2Y A;  2OTJ 1;  1YI2 Z;  1Q81 2;  2JA8 I;  5T6B A;  3H3V J;  2QEX Z;  1NJI 1;  2M48 A;  2JNY A;  1I50 I;  3I56 1;  2KI7 B;  1YUA A;  5CM2 M;  5C3E I;  1YUK A;  1VQK Z;  1YJ9 Z;  2IZ3 A;  1VQ6 1;  1VQ5 1;  1R9T I;  1VQP Z;  3CQZ I;  3HOW I;  3NDI A;  3M4O I;  3NDJ A;  1YJN Z;  5C44 I;  3NFZ A;  3CME Z;  2RBL A;  4A3I I;  1N8R 1;  2RHB A;  4E2X A;  4NBH A;  3GTP I;  4DK1 A;  1VQO 1;  3IF8 A;  5IP9 I;  4A3M I;  1VQ4 Z;  1VQ9 1;  5IP7 I;  3FQQ A;  1M1K 2;  3CCJ Z;  4BY1 I;  3TDH B;  3D9X A;  5LL6 f;  4RS4 A;  3S17 I;  4E2Z A;  4NB9 A;  3MZL B;  3T4N B;  3HOX I;  3CCL Z;  3NH8 A;  3GTO I;  4MH4 A;  3U50 C;  1Q7Y 1;  2LFU A;  4RVD A;  1Q82 1;  4NBB A;  2DE7 A;  1X3W A;  3S1Q I;  1RO4 A;  4E2W A;  1QVG Y;  4E30 A;  1Q82 2;  2O4H A;  3I07 A;  3HOZ I;  1Z02 A;  3S14 I;  1VQL Z;  3CCE 1;  1WCM I;  2KPI A;  3BG1 B;  2E9H A;  2NVY I;  4BY7 I;  1KQS Z;  4HGZ A;  5C4X I;  3CCU Z;  4RVG A;  2JA5 I;  3CC2 Z;  1W2B Z;  2OTL 1;  2AKL A;  5IT9 f;  3P5J B;  4NBE A;  1KC8 2;  4HGY A;  4MD8 A;  2OOX B;  4RVH A;  4NBF A;  1YI2 1;  4EWC A;  2M6N A;  5A2Q b;  2QEX 1;  3NH5 A;  5FLX f;  3OW2 Z;  1I3Q I;  4RVF A;  1RO2 A;  3VMG A;  4A3J I;  2JA7 I;  5T64 A;  1X3Z A;  1LQL A;  4BBS I;  1M90 2;  1VQK 1;  3CC7 Z;  3JAM f;  2V8I A;  1YJ9 1;  3CCV Z;  4NOZ A;  3CCM Z;  1VQP 1;  2ZAE B;  4MRI A;  3VB9 A;  1QVF Z;  2VUG A;  1YJN 1;  3CCR Z;  4DQY B;  2QKD A;  3CME 1;  4NFR A;  2F4O A;  5C4J I;  1VQ8 Z;  1K73 1;  1VQM 1;  1YIJ Z;  3ESW A;  1DL6 A;  4NB8 A;  3EED A;  2Q51 A;  3EER A;  4Y7N I;  1K73 2;  1VQ4 1;  1ML8 A;  4A3B I;  2IZ4 A;  3GTM S;  5AN9 F;  2W04 A;  3NH4 A;  2R6M A;  3CPW Z;  2H85 A;  3CCJ 1;  3MON A;  1NJI 2;  5T67 A;  2YU9 I;  2JS4 A;  3J81 b;  5D1O B;  1L1O C;  3CCL 1;  3F3P C;  4BBR I;  1Z01 A;  1TWH I;  2RPR A;  1VQM Z;  3CCS Z;  3VMH A;  4S1T A;  4X6A I;  3G71 Z;  4A3L I;  3CXC Z;  4A93 I;  1JJ2 Y;  4NBD A;  1N8R 2;  4MD9 A;  1VQL 1;  1Z03 A;  4E33 A;  2K3R A;  2OZK A;  4MON A;  5D1P A;  2QRE B;  1RNI A;  1X0T A;  3CCU 1;  3CC2 1;  3BG0 B;  3J80 b;  1S72 Z;  4A3G I;  3CCQ Z;  3K7A I;  3CC4 Z;  4E31 A;  2QR1 B;  3GKQ A;  2WAQ A;  1P9N A;  5IT9 b;  2E2H I;  1Q7Y 2;  3G6E Z;  2Y0S A;  3I4M I;  3G4S Z;  2HF1 A;  3CC7 1;  3OW2 Y;  2DE5 A;  3CCV 1;  3CCM 1;  3J7A 4;  1NP6 A;  2JR6 A;  4RV9 A;  1SFO I;  2PK7 A;  3CCR 1;  3GTK I;  1QYP A;  1RQF A;  1WW9 A;  3I55 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...