2K5RA

Solution nmr structure of xf2673 from xylella fastidiosa. northeast structural genomics consortium target xfr39
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIATIQIANFPDKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39
rcsb
source organism Xylella fastidiosa temecula1
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein XF2673
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k5rA01
3GTJI 4X6AI 4A3BI 4BBRI 1TWFI 4BY7I 4NB9A 1I50I 3S1RI 4MH4A 4A3FI 1N2FA 3PO2I 3S16I 4A3II 3S2HI 1WCMI 2JNYA 3PO3S 3S2DI 3HOWI 3PO3I 4NBDA 3GTMI 3H3VJ 2F4MA 5IP9I 1RO4A 1TWGI 2PK7A 4A3LI 1Y1VI 3I4NI 2P3YA 2E2JI 4BY1I 1R9TI 1USPB 3VMIA 3VMHA 3GTMS 3VB9A 4A3MI 1USPA 4A93I 4QTTA 3M4OI 1WW9A 4NBFA 4NB8A 1Y1VS 2JA7I 3VMGA 4NBBA 2K5RA 3GKQA 2BJOA 3M3YI 3GTKI 3HOXI 3I4MI 4NBEA 5FLMI 1QYPA 2DE5A 5C4XI 4Y52I 3S17I 1LQLA 3GTPI 1YUAA 2J6AA 3D6WA 2DE6A 3S1NI 4BBSI 4NBGA 2DE7A 1ZB8A 4NBHA 2R7ZI 3ESWA 4NOZA 2R93I 1I3QI 1I6HI 2YU9I 3HOVI 3GTGI 1PFTA 2B63I 3S1MI 1L1OC 3HOZI 3S14I 2JA8I 1ZB9A 2AKLA 4A3DI 3GTLI 2F4OA 4A3KI 3H0GI 3GTOI 2E2HI 2JR6A 2E2II 4NBCA 2RBLA 3GTQI 1RLYA 3Q87A 4A3CI 3RZOI 2JA6I 2KPIA 3HOYI 1DL6A 4QTUA 3FKII 3GCFA 1NUIA 2JA5I 2JS4A 2NVXI 4A3JI 3HOUI 3U50C 4Y7NI 2VUMI 1ML8A 1TWAI 4NBAA 2R92I 2NVQI 3S15I 1SFOI 3RZDI 1TFIA 5IP7I 5C4JI 1X3ZA 3CQZI 1TWCI 1TWHI 5CM2M 4A3GI 3LUSA 1K83I 2HF1A 3EERA 5C44I 3S1QI 5C3EI 1X3WA 2NVTI 3K7AI 1VLAA 4XX2A 4A3EI 4BXXI 2NVYI 1Y1WI 3I07A
chains in the Genus database with same CATH superfamily
3CCLZ 2Q51A 1Q812 1VQ71 1I50I 3S1RI 1N2FA 3PO2I 3NH8A 1WCMI 1NJI1 4NBDA 1YUKA 2G2KA 3GTMI 1Z02A 1QXFA 3J80b 2QEXZ 1KRLA 2E2JI 3CCR1 5T67A 3KIFA 3IFUA 3GTMS 5D1OB 4A3MI 1VQKZ 3CCJZ 1YJWZ 2VPWA 1VQL1 3GTKI 1K8A1 2IZ3A 2VPYA 1VQ6Z 3I4MI 3CCM1 1RNIA 2E9HA 1S72Z 3I56Z 2QRCB 3QWUA 1LQLA 2NAPA 2J6AA 4RVFA 1KQSZ 3G711 2DE6A 3D6WA 3CCJ1 1YJW1 2DE7A 2O4HA 1YI2Z 4NOZA 2R93I 1M1K1 3GTGI 2WB1A 3IF8A 3D9XA 2AKLA 3CCEZ 3CME1 2QLVB 3GTLI 4A3KI 1KQSY 2E2HI 4MRIA 3CC4Z 2JMOA 2IZ4A 4RVGA 4DQYB 2JA6I 3HOYI 2QA41 3CCQ1 1WJ2A 2VUMI 3CCV1 1VQK1 2NVQI 1QF8A 4HGYA 3D2LA 5IP7I 5D1OA 1QVGY 3CMEZ 2JIOA 1TWHI 3CCRZ 3S1QI 1Y8CA 2NVTI 1VLAA 5T64A 4BXXI 1VQLZ 4X6AI 4AYBA 2RPRA 2GTHA 3J81b 1QVFZ 2P28A 4MH4A 1W2BY 4HGZA 3VTNA 4A3II 3J7A4 4RS4A 3FQQA 3S2DI 1KD11 2VUGA 3PO3I 1K9M1 3H3VJ 1RQFA 2W04A 3CCS1 4CL1A 5IP9I 3CCVZ 1RO4A 2P3YA 2RIQA 1K731 4BY1I 1R9TI 3CCQZ 2QA4Z 3NDJA 3I551 1KC82 5A2Qf 1YJN1 1JWHC 2Q4ZA 1YITZ 1USPA 1WW9A 3VMGA 1VQ41 2K5RA 2OOYB 3CD6Z 1QVGZ 1QYPA 1YUAA 4E33A 3S1NI 4E2WA 1VQ51 3CCU1 4DGLA 3G4S1 3ESWA 1QVFY 1K732 1SIWA 3CD61 2YU9I 2O53A 2M6NA 2ZAEB 3I561 1VQN1 4E2YA 1VQ4Z 2VPXA 1Q7Y1 1JJ2Y 2OTLZ 3CCMZ 3J80f 1VQOZ 1WZNA 1Q822 2RT9A 2OTJ1 2RBLA 4NBCA 3MZLB 3J81f 3CCUZ 3RZOI 1N8R2 3GCFA 2JA5I 2JS4A 4HH4A 2NVXI 4A3JI 2OOXB 3HOUI 5LL6f 3CMAZ 4NBAA 1W2BZ 2E7ZA 3RZDI 5C4JI 1X3ZA 3CQZI 3NH4A 2JUBA 2Y0SA 1S721 3MONA 1YJNZ 3BG1B 1Q7Y2 4A3EI 2NVYI 3I07A 5FLXb 3EEDA 3CCE1 2JIRA 1YJ9Z 1TWFI 2PM9A 4NB9A 4BY7I 3CXCZ 1VQ81 4A3FI 1YHQ1 4MD8A 1Q16A 1YI21 3IR7A 2JIPA 1YIJZ 1TWGI 2PK7A 3MZKB 4A3LI 1Y1VI 2OTJZ 3OW2Z 3I4NI 3KIHA 2I3CA 4MD7A 1USPB 3P5JB 1VQ7Z 3VMHA 4DK1A 2JIQA 4A93I 4QTTA 4NBFA 2V3VA 3IX0A 4NBBA 1VQ8Z 5A2Qb 4RVHA 3M3YI 1M902 3HOXI 4NBEA 2YADA 4Y52I 2QEX1 3GTPI 1VQ91 3NH5A 4BBSI 4NBGA 1KC81 2R7ZI 2AYDA 1RO0A 1I6HI 1VQ61 1YIT1 1PFTA 1YIJ1 1RO2A 2B63I 3S1MI 3HOZI 2HU9A 2JA8I 1NP6A 4A3DI 1VQM1 2F4OA 2V8KA 1VQ9Z 3H0GI 1WIIA 3F3PC 3GTOI 1VQP1 2JR6A 2W03A 3CPWZ 4MXUA 1YHQZ 2VF1A 1M901 2E2II 3GTQI 1RLYA 4A3CI 2QKDA 1DL6A 2H85A 4S1TA 3FKII 1VQMZ 3NFZA 3HKZA 3U50C 4Y7NI 4RV9A 3JAMf 4TNUA 1YJ91 1TWAI 2PMZA 3S15I 1TFIA 1Q811 1AA6A 3BG0B 2OTL1 4A3GI 3LUSA 1Q821 2HF1A 2JIMA 2GU2A 2M48A 4EWCA 5IT9f 1N8R1 4XX2A 3CCSZ 1Y1WI 2V8IA 4E32A 3GTJI 2LEXA 4A3BI 4MD9A 2R6MA 4BBRI 2VPZA 1Z01A 3G6EZ 3G71Z 3NDIA 2KI7B 3S16I 3S2HI 2JNYA 2LFUA 3JAMb 3TDHB 3PO3S 3HOWI 1JJ2Z 2F4MA 4RVDA 3CC21 3CC71 1K8A2 4E31A 3CCL1 2QRDB 5IT9b 2QREB 2LIYA 3FQMA 1ZH1A 4MONA 1S7MA 2OZKA 2QR1B 5FLXf 3G4SZ 3VMIA 2IV2X 3VB9A 1Q862 5D1PA 4NB8A 3CXCY 3M4OI 1Y1VS 2JA7I 1VQ5Z 3CPWY 1M1K2 3GKQA 2BJOA 5FLMI 1VQPZ 3CC2Z 3CC7Z 2DE5A 5C4XI 2K3RA 3OW2Y 1VQO1 3S17I 1FDOA 5T6BA 2RHBA 1Z03A 1ZB8A 4NBHA 4E30A 1I3QI 5AN9F 4NFRA 3HOVI 3G6E1 1L1OC 3S14I 1ZB9A 1P9NA 4E2ZA 1Q861 3CMA1 2V8JA 1FDIA 2EGTA 3Q87A 2KPIA 2V45A 4QTUA 1X0TA 3T4NB 1NUIA 1ML8A 2R92I 3I55Z 3CC41 1SFOI 1VQNZ 3F3FC 1TWCI 1NJI2 2GTIA 5CM2M 3TE5B 1K83I 3EERA 5C44I 5C3EI 1X3WA 4NH1C 3K7AI 1KD12 1K9M2 4E2XA 2WAQA
chains in the Genus database with same CATH topology
3CCLZ 2Q51A 1Q812 1VQ71 1I50I 3S1RI 1N2FA 3PO2I 3NH8A 1WCMI 1NJI1 4NBDA 1YUKA 2G2KA 3GTMI 1Z02A 3J80b 2QEXZ 1KRLA 2E2JI 3CCR1 5T67A 3KIFA 3IFUA 3GTMS 5D1OB 4A3MI 1VQKZ 3CCJZ 1YJWZ 1VQL1 3GTKI 1K8A1 2IZ3A 1VQ6Z 3I4MI 3CCM1 1RNIA 2E9HA 1S72Z 3I56Z 2QRCB 3QWUA 1LQLA 2J6AA 4RVFA 1KQSZ 3G711 2DE6A 3D6WA 3CCJ1 1YJW1 2DE7A 2O4HA 1YI2Z 4NOZA 2R93I 1M1K1 3GTGI 2WB1A 3IF8A 3D9XA 2AKLA 3CCEZ 3CME1 2QLVB 3GTLI 4A3KI 1KQSY 2E2HI 4MRIA 3CC4Z 2JMOA 2IZ4A 4RVGA 4DQYB 2JA6I 3HOYI 3CCQ1 2QA41 2VUMI 3CCV1 1VQK1 2NVQI 1QF8A 4HGYA 5IP7I 1QVGY 5D1OA 3CMEZ 1TWHI 3CCRZ 3S1QI 2NVTI 1VLAA 5T64A 4BXXI 1VQLZ 4X6AI 4AYBA 2RPRA 2GTHA 3J81b 1QVFZ 2P28A 4MH4A 1W2BY 4HGZA 3VTNA 4A3II 3J7A4 4RS4A 3FQQA 3S2DI 1KD11 2VUGA 3PO3I 1K9M1 3H3VJ 1RQFA 2W04A 3CCS1 4CL1A 5IP9I 3CCVZ 1RO4A 2P3YA 2RIQA 1K731 4BY1I 1R9TI 3CCQZ 2QA4Z 3NDJA 3I551 1KC82 5A2Qf 1YJN1 1JWHC 2Q4ZA 1YITZ 1USPA 1WW9A 3VMGA 1VQ41 2K5RA 2OOYB 3CD6Z 1QVGZ 1QYPA 1YUAA 4E33A 3S1NI 4E2WA 1VQ51 3CCU1 4DGLA 3G4S1 3ESWA 1QVFY 1K732 3CD61 2YU9I 2O53A 2M6NA 2ZAEB 3I561 1VQN1 4E2YA 1VQ4Z 1Q7Y1 1JJ2Y 2OTLZ 3CCMZ 3J80f 1VQOZ 1Q822 2RT9A 2OTJ1 2RBLA 4NBCA 3MZLB 3J81f 3CCUZ 3RZOI 1N8R2 3GCFA 2JA5I 2JS4A 4HH4A 2NVXI 4A3JI 2OOXB 3HOUI 5LL6f 3CMAZ 4NBAA 1W2BZ 3RZDI 5C4JI 1X3ZA 3CQZI 3NH4A 2JUBA 2Y0SA 1S721 3MONA 1YJNZ 3BG1B 1Q7Y2 4A3EI 2NVYI 3I07A 5FLXb 3EEDA 3CCE1 1YJ9Z 1TWFI 2PM9A 4NB9A 4BY7I 3CXCZ 1VQ81 4A3FI 1YHQ1 4MD8A 1YI21 1YIJZ 1TWGI 2PK7A 3MZKB 4A3LI 1Y1VI 2OTJZ 3OW2Z 3I4NI 3KIHA 2I3CA 4MD7A 1USPB 3P5JB 1VQ7Z 3VMHA 4DK1A 4A93I 4QTTA 4NBFA 4NBBA 3IX0A 1VQ8Z 5A2Qb 4RVHA 3M3YI 1M902 3HOXI 4NBEA 2YADA 4Y52I 2QEX1 3GTPI 1VQ91 3NH5A 4BBSI 4NBGA 1KC81 2R7ZI 1RO0A 1I6HI 1VQ61 1YIT1 1PFTA 1YIJ1 1RO2A 2B63I 3S1MI 3HOZI 2HU9A 2JA8I 1NP6A 4A3DI 1VQM1 2F4OA 2V8KA 1VQ9Z 3H0GI 1WIIA 3F3PC 3GTOI 1VQP1 2JR6A 2W03A 3CPWZ 4MXUA 1YHQZ 2VF1A 1M901 2E2II 3GTQI 1RLYA 4A3CI 2QKDA 1DL6A 2H85A 4S1TA 3FKII 1VQMZ 3NFZA 3HKZA 3U50C 4Y7NI 4RV9A 3JAMf 4TNUA 1YJ91 1TWAI 2PMZA 3S15I 1TFIA 1Q811 3BG0B 2OTL1 4A3GI 3LUSA 1Q821 2HF1A 2GU2A 2M48A 4EWCA 5IT9f 1N8R1 4XX2A 3CCSZ 1Y1WI 2V8IA 4E32A 3GTJI 4A3BI 4MD9A 2R6MA 4BBRI 1Z01A 3G6EZ 3G71Z 3NDIA 2KI7B 3S16I 3S2HI 2JNYA 2LFUA 3JAMb 3TDHB 3PO3S 3HOWI 1JJ2Z 2F4MA 4RVDA 3CC21 3CC71 1K8A2 4E31A 3CCL1 2QRDB 5IT9b 2QREB 2LIYA 3FQMA 1ZH1A 4MONA 1S7MA 2OZKA 2QR1B 5FLXf 3G4SZ 3VMIA 3VB9A 1Q862 5D1PA 4NB8A 3CXCY 3M4OI 1Y1VS 2JA7I 1VQ5Z 3CPWY 1M1K2 3GKQA 2BJOA 5FLMI 1VQPZ 3CC2Z 3CC7Z 2DE5A 5C4XI 2K3RA 3OW2Y 1VQO1 3S17I 5T6BA 2RHBA 1Z03A 1ZB8A 4NBHA 4E30A 1I3QI 5AN9F 4NFRA 3HOVI 3G6E1 1L1OC 3S14I 1ZB9A 1P9NA 4E2ZA 1Q861 3CMA1 2V8JA 2EGTA 3Q87A 2KPIA 4QTUA 1X0TA 3T4NB 1NUIA 1ML8A 2R92I 3I55Z 3CC41 1SFOI 1VQNZ 3F3FC 1TWCI 1NJI2 2GTIA 5CM2M 3TE5B 1K83I 3EERA 5C44I 5C3EI 1X3WA 4NH1C 3K7AI 1KD12 1K9M2 4E2XA 2WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ I;  4X6A I;  4A3B I;  4BBR I;  1TWF I;  4BY7 I;  4NB9 A;  1I50 I;  3S1R I;  4MH4 A;  4A3F I;  1N2F A;  3PO2 I;  3S16 I;  4A3I I;  3S2H I;  1WCM I;  2JNY A;  3PO3 S;  3S2D I;  3HOW I;  3PO3 I;  4NBD A;  3GTM I;  3H3V J;  2F4M A;  5IP9 I;  1RO4 A;  1TWG I;  2PK7 A;  4A3L I;  1Y1V I;  3I4N I;  2P3Y A;  2E2J I;  4BY1 I;  1R9T I;  1USP B;  3VMI A;  3VMH A;  3GTM S;  3VB9 A;  4A3M I;  1USP A;  4A93 I;  4QTT A;  3M4O I;  1WW9 A;  4NBF A;  4NB8 A;  1Y1V S;  2JA7 I;  3VMG A;  4NBB A;  2K5R A;  3GKQ A;  2BJO A;  3M3Y I;  3GTK I;  3HOX I;  3I4M I;  4NBE A;  5FLM I;  1QYP A;  2DE5 A;  5C4X I;  4Y52 I;  3S17 I;  1LQL A;  3GTP I;  1YUA A;  2J6A A;  3D6W A;  2DE6 A;  3S1N I;  4BBS I;  4NBG A;  2DE7 A;  1ZB8 A;  4NBH A;  2R7Z I;  3ESW A;  4NOZ A;  2R93 I;  1I3Q I;  1I6H I;  2YU9 I;  3HOV I;  3GTG I;  1PFT A;  2B63 I;  3S1M I;  1L1O C;  3HOZ I;  3S14 I;  2JA8 I;  1ZB9 A;  2AKL A;  4A3D I;  3GTL I;  2F4O A;  4A3K I;  3H0G I;  3GTO I;  2E2H I;  2JR6 A;  2E2I I;  4NBC A;  2RBL A;  3GTQ I;  1RLY A;  3Q87 A;  4A3C I;  3RZO I;  2JA6 I;  2KPI A;  3HOY I;  1DL6 A;  4QTU A;  3FKI I;  3GCF A;  1NUI A;  2JA5 I;  2JS4 A;  2NVX I;  4A3J I;  3HOU I;  3U50 C;  4Y7N I;  2VUM I;  1ML8 A;  1TWA I;  4NBA A;  2R92 I;  2NVQ I;  3S15 I;  1SFO I;  3RZD I;  1TFI A;  5IP7 I;  5C4J I;  1X3Z A;  3CQZ I;  1TWC I;  1TWH I;  5CM2 M;  4A3G I;  3LUS A;  1K83 I;  2HF1 A;  3EER A;  5C44 I;  3S1Q I;  5C3E I;  1X3W A;  2NVT I;  3K7A I;  1VLA A;  4XX2 A;  4A3E I;  4BXX I;  2NVY I;  1Y1W I;  3I07 A; 
#chains in the Genus database with same CATH topology
 3CCL Z;  2Q51 A;  1Q81 2;  1VQ7 1;  1I50 I;  3S1R I;  1N2F A;  3PO2 I;  3NH8 A;  1WCM I;  1NJI 1;  4NBD A;  1YUK A;  2G2K A;  3GTM I;  1Z02 A;  1QXF A;  3J80 b;  2QEX Z;  1KRL A;  2E2J I;  3CCR 1;  5T67 A;  3KIF A;  3IFU A;  3GTM S;  5D1O B;  4A3M I;  1VQK Z;  3CCJ Z;  1YJW Z;  2VPW A;  1VQL 1;  3GTK I;  1K8A 1;  2IZ3 A;  2VPY A;  1VQ6 Z;  3I4M I;  3CCM 1;  1RNI A;  2E9H A;  1S72 Z;  3I56 Z;  2QRC B;  3QWU A;  1LQL A;  2NAP A;  2J6A A;  4RVF A;  1KQS Z;  3G71 1;  2DE6 A;  3D6W A;  3CCJ 1;  1YJW 1;  2DE7 A;  2O4H A;  1YI2 Z;  4NOZ A;  2R93 I;  1M1K 1;  3GTG I;  2WB1 A;  3IF8 A;  3D9X A;  2AKL A;  3CCE Z;  3CME 1;  2QLV B;  3GTL I;  4A3K I;  1KQS Y;  2E2H I;  4MRI A;  3CC4 Z;  2JMO A;  2IZ4 A;  4RVG A;  4DQY B;  2JA6 I;  3HOY I;  2QA4 1;  3CCQ 1;  1WJ2 A;  2VUM I;  3CCV 1;  1VQK 1;  2NVQ I;  1QF8 A;  4HGY A;  3D2L A;  5IP7 I;  5D1O A;  1QVG Y;  3CME Z;  2JIO A;  1TWH I;  3CCR Z;  3S1Q I;  1Y8C A;  2NVT I;  1VLA A;  5T64 A;  4BXX I;  1VQL Z;  4X6A I;  4AYB A;  2RPR A;  2GTH A;  3J81 b;  1QVF Z;  2P28 A;  4MH4 A;  1W2B Y;  4HGZ A;  3VTN A;  4A3I I;  3J7A 4;  4RS4 A;  3FQQ A;  3S2D I;  1KD1 1;  2VUG A;  3PO3 I;  1K9M 1;  3H3V J;  1RQF A;  2W04 A;  3CCS 1;  4CL1 A;  5IP9 I;  3CCV Z;  1RO4 A;  2P3Y A;  2RIQ A;  1K73 1;  4BY1 I;  1R9T I;  3CCQ Z;  2QA4 Z;  3NDJ A;  3I55 1;  1KC8 2;  5A2Q f;  1YJN 1;  1JWH C;  2Q4Z A;  1YIT Z;  1USP A;  1WW9 A;  3VMG A;  1VQ4 1;  2K5R A;  2OOY B;  3CD6 Z;  1QVG Z;  1QYP A;  1YUA A;  4E33 A;  3S1N I;  4E2W A;  1VQ5 1;  3CCU 1;  4DGL A;  3G4S 1;  3ESW A;  1QVF Y;  1K73 2;  1SIW A;  3CD6 1;  2YU9 I;  2O53 A;  2M6N A;  2ZAE B;  3I56 1;  1VQN 1;  4E2Y A;  1VQ4 Z;  2VPX A;  1Q7Y 1;  1JJ2 Y;  2OTL Z;  3CCM Z;  3J80 f;  1VQO Z;  1WZN A;  1Q82 2;  2RT9 A;  2OTJ 1;  2RBL A;  4NBC A;  3MZL B;  3J81 f;  3CCU Z;  3RZO I;  1N8R 2;  3GCF A;  2JA5 I;  2JS4 A;  4HH4 A;  2NVX I;  4A3J I;  2OOX B;  3HOU I;  5LL6 f;  3CMA Z;  4NBA A;  1W2B Z;  2E7Z A;  3RZD I;  5C4J I;  1X3Z A;  3CQZ I;  3NH4 A;  2JUB A;  2Y0S A;  1S72 1;  3MON A;  1YJN Z;  3BG1 B;  1Q7Y 2;  4A3E I;  2NVY I;  3I07 A;  5FLX b;  3EED A;  3CCE 1;  2JIR A;  1YJ9 Z;  1TWF I;  2PM9 A;  4NB9 A;  4BY7 I;  3CXC Z;  1VQ8 1;  4A3F I;  1YHQ 1;  4MD8 A;  1Q16 A;  1YI2 1;  3IR7 A;  2JIP A;  1YIJ Z;  1TWG I;  2PK7 A;  3MZK B;  4A3L I;  1Y1V I;  2OTJ Z;  3OW2 Z;  3I4N I;  3KIH A;  2I3C A;  4MD7 A;  1USP B;  3P5J B;  1VQ7 Z;  3VMH A;  4DK1 A;  2JIQ A;  4A93 I;  4QTT A;  4NBF A;  2V3V A;  3IX0 A;  4NBB A;  1VQ8 Z;  5A2Q b;  4RVH A;  3M3Y I;  1M90 2;  3HOX I;  4NBE A;  2YAD A;  4Y52 I;  2QEX 1;  3GTP I;  1VQ9 1;  3NH5 A;  4BBS I;  4NBG A;  1KC8 1;  2R7Z I;  2AYD A;  1RO0 A;  1I6H I;  1VQ6 1;  1YIT 1;  1PFT A;  1YIJ 1;  1RO2 A;  2B63 I;  3S1M I;  3HOZ I;  2HU9 A;  2JA8 I;  1NP6 A;  4A3D I;  1VQM 1;  2F4O A;  2V8K A;  1VQ9 Z;  3H0G I;  1WII A;  3F3P C;  3GTO I;  1VQP 1;  2JR6 A;  2W03 A;  3CPW Z;  4MXU A;  1YHQ Z;  2VF1 A;  1M90 1;  2E2I I;  3GTQ I;  1RLY A;  4A3C I;  2QKD A;  1DL6 A;  2H85 A;  4S1T A;  3FKI I;  1VQM Z;  3NFZ A;  3HKZ A;  3U50 C;  4Y7N I;  4RV9 A;  3JAM f;  4TNU A;  1YJ9 1;  1TWA I;  2PMZ A;  3S15 I;  1TFI A;  1Q81 1;  1AA6 A;  3BG0 B;  2OTL 1;  4A3G I;  3LUS A;  1Q82 1;  2HF1 A;  2JIM A;  2GU2 A;  2M48 A;  4EWC A;  5IT9 f;  1N8R 1;  4XX2 A;  3CCS Z;  1Y1W I;  2V8I A;  4E32 A;  3GTJ I;  2LEX A;  4A3B I;  4MD9 A;  2R6M A;  4BBR I;  2VPZ A;  1Z01 A;  3G6E Z;  3G71 Z;  3NDI A;  2KI7 B;  3S16 I;  3S2H I;  2JNY A;  2LFU A;  3JAM b;  3TDH B;  3PO3 S;  3HOW I;  1JJ2 Z;  2F4M A;  4RVD A;  3CC2 1;  3CC7 1;  1K8A 2;  4E31 A;  3CCL 1;  2QRD B;  5IT9 b;  2QRE B;  2LIY A;  3FQM A;  1ZH1 A;  4MON A;  1S7M A;  2OZK A;  2QR1 B;  5FLX f;  3G4S Z;  3VMI A;  2IV2 X;  3VB9 A;  1Q86 2;  5D1P A;  4NB8 A;  3CXC Y;  3M4O I;  1Y1V S;  2JA7 I;  1VQ5 Z;  3CPW Y;  1M1K 2;  3GKQ A;  2BJO A;  5FLM I;  1VQP Z;  3CC2 Z;  3CC7 Z;  2DE5 A;  5C4X I;  2K3R A;  3OW2 Y;  1VQO 1;  3S17 I;  1FDO A;  5T6B A;  2RHB A;  1Z03 A;  1ZB8 A;  4NBH A;  4E30 A;  1I3Q I;  5AN9 F;  4NFR A;  3HOV I;  3G6E 1;  1L1O C;  3S14 I;  1ZB9 A;  1P9N A;  4E2Z A;  1Q86 1;  3CMA 1;  2V8J A;  1FDI A;  2EGT A;  3Q87 A;  2KPI A;  2V45 A;  4QTU A;  1X0T A;  3T4N B;  1NUI A;  1ML8 A;  2R92 I;  3I55 Z;  3CC4 1;  1SFO I;  1VQN Z;  3F3F C;  1TWC I;  1NJI 2;  2GTI A;  5CM2 M;  3TE5 B;  1K83 I;  3EER A;  5C44 I;  5C3E I;  1X3W A;  4NH1 C;  3K7A I;  1KD1 2;  1K9M 2;  4E2X A;  2WAQ A; 
#chains in the Genus database with same CATH homology
 3CCL Z;  2Q51 A;  1Q81 2;  1VQ7 1;  1I50 I;  3S1R I;  1N2F A;  3PO2 I;  3NH8 A;  1WCM I;  1NJI 1;  4NBD A;  1YUK A;  2G2K A;  3GTM I;  1Z02 A;  3J80 b;  2QEX Z;  1KRL A;  2E2J I;  3CCR 1;  5T67 A;  3KIF A;  3IFU A;  3GTM S;  5D1O B;  4A3M I;  1VQK Z;  3CCJ Z;  1YJW Z;  1VQL 1;  3GTK I;  1K8A 1;  2IZ3 A;  1VQ6 Z;  3I4M I;  3CCM 1;  1RNI A;  2E9H A;  1S72 Z;  3I56 Z;  2QRC B;  3QWU A;  1LQL A;  2J6A A;  4RVF A;  1KQS Z;  3G71 1;  2DE6 A;  3D6W A;  3CCJ 1;  1YJW 1;  2DE7 A;  2O4H A;  1YI2 Z;  4NOZ A;  2R93 I;  1M1K 1;  3GTG I;  2WB1 A;  3IF8 A;  3D9X A;  2AKL A;  3CCE Z;  3CME 1;  2QLV B;  3GTL I;  4A3K I;  1KQS Y;  2E2H I;  4MRI A;  3CC4 Z;  2JMO A;  2IZ4 A;  4RVG A;  4DQY B;  2JA6 I;  3HOY I;  3CCQ 1;  2QA4 1;  2VUM I;  3CCV 1;  1VQK 1;  2NVQ I;  1QF8 A;  4HGY A;  5IP7 I;  1QVG Y;  5D1O A;  3CME Z;  1TWH I;  3CCR Z;  3S1Q I;  2NVT I;  1VLA A;  5T64 A;  4BXX I;  1VQL Z;  4X6A I;  4AYB A;  2RPR A;  2GTH A;  3J81 b;  1QVF Z;  2P28 A;  4MH4 A;  1W2B Y;  4HGZ A;  3VTN A;  4A3I I;  3J7A 4;  4RS4 A;  3FQQ A;  3S2D I;  1KD1 1;  2VUG A;  3PO3 I;  1K9M 1;  3H3V J;  1RQF A;  2W04 A;  3CCS 1;  4CL1 A;  5IP9 I;  3CCV Z;  1RO4 A;  2P3Y A;  2RIQ A;  1K73 1;  4BY1 I;  1R9T I;  3CCQ Z;  2QA4 Z;  3NDJ A;  3I55 1;  1KC8 2;  5A2Q f;  1YJN 1;  1JWH C;  2Q4Z A;  1YIT Z;  1USP A;  1WW9 A;  3VMG A;  1VQ4 1;  2K5R A;  2OOY B;  3CD6 Z;  1QVG Z;  1QYP A;  1YUA A;  4E33 A;  3S1N I;  4E2W A;  1VQ5 1;  3CCU 1;  4DGL A;  3G4S 1;  3ESW A;  1QVF Y;  1K73 2;  3CD6 1;  2YU9 I;  2O53 A;  2M6N A;  2ZAE B;  3I56 1;  1VQN 1;  4E2Y A;  1VQ4 Z;  1Q7Y 1;  1JJ2 Y;  2OTL Z;  3CCM Z;  3J80 f;  1VQO Z;  1Q82 2;  2RT9 A;  2OTJ 1;  2RBL A;  4NBC A;  3MZL B;  3J81 f;  3CCU Z;  3RZO I;  1N8R 2;  3GCF A;  2JA5 I;  2JS4 A;  4HH4 A;  2NVX I;  4A3J I;  2OOX B;  3HOU I;  5LL6 f;  3CMA Z;  4NBA A;  1W2B Z;  3RZD I;  5C4J I;  1X3Z A;  3CQZ I;  3NH4 A;  2JUB A;  2Y0S A;  1S72 1;  3MON A;  1YJN Z;  3BG1 B;  1Q7Y 2;  4A3E I;  2NVY I;  3I07 A;  5FLX b;  3EED A;  3CCE 1;  1YJ9 Z;  1TWF I;  2PM9 A;  4NB9 A;  4BY7 I;  3CXC Z;  1VQ8 1;  4A3F I;  1YHQ 1;  4MD8 A;  1YI2 1;  1YIJ Z;  1TWG I;  2PK7 A;  3MZK B;  4A3L I;  1Y1V I;  2OTJ Z;  3OW2 Z;  3I4N I;  3KIH A;  2I3C A;  4MD7 A;  1USP B;  3P5J B;  1VQ7 Z;  3VMH A;  4DK1 A;  4A93 I;  4QTT A;  4NBF A;  4NBB A;  3IX0 A;  1VQ8 Z;  5A2Q b;  4RVH A;  3M3Y I;  1M90 2;  3HOX I;  4NBE A;  2YAD A;  4Y52 I;  2QEX 1;  3GTP I;  1VQ9 1;  3NH5 A;  4BBS I;  4NBG A;  1KC8 1;  2R7Z I;  1RO0 A;  1I6H I;  1VQ6 1;  1YIT 1;  1PFT A;  1YIJ 1;  1RO2 A;  2B63 I;  3S1M I;  3HOZ I;  2HU9 A;  2JA8 I;  1NP6 A;  4A3D I;  1VQM 1;  2F4O A;  2V8K A;  1VQ9 Z;  3H0G I;  1WII A;  3F3P C;  3GTO I;  1VQP 1;  2JR6 A;  2W03 A;  3CPW Z;  4MXU A;  1YHQ Z;  2VF1 A;  1M90 1;  2E2I I;  3GTQ I;  1RLY A;  4A3C I;  2QKD A;  1DL6 A;  2H85 A;  4S1T A;  3FKI I;  1VQM Z;  3NFZ A;  3HKZ A;  3U50 C;  4Y7N I;  4RV9 A;  3JAM f;  4TNU A;  1YJ9 1;  1TWA I;  2PMZ A;  3S15 I;  1TFI A;  1Q81 1;  3BG0 B;  2OTL 1;  4A3G I;  3LUS A;  1Q82 1;  2HF1 A;  2GU2 A;  2M48 A;  4EWC A;  5IT9 f;  1N8R 1;  4XX2 A;  3CCS Z;  1Y1W I;  2V8I A;  4E32 A;  3GTJ I;  4A3B I;  4MD9 A;  2R6M A;  4BBR I;  1Z01 A;  3G6E Z;  3G71 Z;  3NDI A;  2KI7 B;  3S16 I;  3S2H I;  2JNY A;  2LFU A;  3JAM b;  3TDH B;  3PO3 S;  3HOW I;  1JJ2 Z;  2F4M A;  4RVD A;  3CC2 1;  3CC7 1;  1K8A 2;  4E31 A;  3CCL 1;  2QRD B;  5IT9 b;  2QRE B;  2LIY A;  3FQM A;  1ZH1 A;  4MON A;  1S7M A;  2OZK A;  2QR1 B;  5FLX f;  3G4S Z;  3VMI A;  3VB9 A;  1Q86 2;  5D1P A;  4NB8 A;  3CXC Y;  3M4O I;  1Y1V S;  2JA7 I;  1VQ5 Z;  3CPW Y;  1M1K 2;  3GKQ A;  2BJO A;  5FLM I;  1VQP Z;  3CC2 Z;  3CC7 Z;  2DE5 A;  5C4X I;  2K3R A;  3OW2 Y;  1VQO 1;  3S17 I;  5T6B A;  2RHB A;  1Z03 A;  1ZB8 A;  4NBH A;  4E30 A;  1I3Q I;  5AN9 F;  4NFR A;  3HOV I;  3G6E 1;  1L1O C;  3S14 I;  1ZB9 A;  1P9N A;  4E2Z A;  1Q86 1;  3CMA 1;  2V8J A;  2EGT A;  3Q87 A;  2KPI A;  4QTU A;  1X0T A;  3T4N B;  1NUI A;  1ML8 A;  2R92 I;  3I55 Z;  3CC4 1;  1SFO I;  1VQN Z;  3F3F C;  1TWC I;  1NJI 2;  2GTI A;  5CM2 M;  3TE5 B;  1K83 I;  3EER A;  5C44 I;  5C3E I;  1X3W A;  4NH1 C;  3K7A I;  1KD1 2;  1K9M 2;  4E2X A;  2WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...