2K5RA

Solution nmr structure of xf2673 from xylella fastidiosa. northeast structural genomics consortium target xfr39
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIATIQIANFPDKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein XF2673
publication title Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39
rcsb
source organism Xylella fastidiosa temecula1
molecule tags Structural genomics, unknown function
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k5rA01
5IP7I 4NBBA 3HOVI 3HOUI 3S2HI 2DE7A 3GTMS 2F4MA 4Y7NI 2NVQI 1Y1VS 1TWGI 1PFTA 1TWFI 2DE6A 3U50C 3RZDI 4QTTA 1YUAA 1WCMI 2E2II 3H3VJ 1TWCI 1SFOI 2JA6I 4NBDA 5C4JI 3EERA 4MH4A 5C44I 3VMIA 3S1RI 4A3BI 4A3EI 4BY1I 1QYPA 1X3ZA 3GKQA 3Q87A 4A3GI 4BY7I 4NBCA 2JA8I 3PO3S 3GTGI 2AKLA 1RLYA 3S1QI 1DL6A 3I4NI 4A3II 4BBSI 4NB8A 2JNYA 1ZB8A 2R93I 1WW9A 2B63I 2E2JI 5C3EI 3GTLI 3RZOI 3HOYI 3S1NI 3M3YI 4NBGA 5IP9I 1VLAA 1R9TI 3GTOI 3GTPI 3S15I 3M4OI 5CM2M 2R7ZI 3S17I 3ESWA 3S2DI 4A93I 1I3QI 4NBAA 2J6AA 3CQZI 1LQLA 4QTUA 1I6HI 4NBEA 2YU9I 3S1MI 4A3CI 1TWAI 2F4OA 2P3YA 3D6WA 3H0GI 4A3KI 2HF1A 5FLMI 1Y1WI 3I4MI 2NVXI 3GCFA 3GTMI 4A3FI 2R92I 1Y1VI 3K7AI 3VMHA 2BJOA 2JR6A 1NUIA 1K83I 2K5RA 2PK7A 2RBLA 3GTJI 3HOZI 1N2FA 4NBFA 4BBRI 1TWHI 1ZB9A 3VB9A 2E2HI 3S16I 1USPA 1I50I 1L1OC 3GTKI 2DE5A 3VMGA 3PO3I 5C4XI 3I07A 4A3LI 2JA5I 2NVYI 3S14I 1USPB 4Y52I 4XX2A 2JS4A 4A3MI 4X6AI 1RO4A 1X3WA 4BXXI 3LUSA 2NVTI 1TFIA 4NBHA 4A3JI 2JA7I 3HOWI 2VUMI 3HOXI 4A3DI 3GTQI 3PO2I 4NB9A 3FKII 1ML8A 4NOZA 2KPIA
chains in the Genus database with same CATH superfamily
4NBBA 3IF8A 3HOVI 1VQ5Z 1YI21 2V8JA 4Y7NI 3CC21 5IT9f 5T67A 1PFTA 2OOYB 2V3VA 4RVHA 2DE6A 2Q4ZA 3RZDI 2P28A 1YUAA 3CC7Z 1WCMI 3H3VJ 2JA6I 4NBDA 3EERA 3J80f 4MH4A 5C44I 1YJW1 3CC41 3S1RI 2OTJ1 1KD12 3CCL1 2VF1A 3CCM1 2JIQA 3CCUZ 5D1PA 1VQL1 4BY7I 1Q7Y1 1N8R2 2W03A 2QEX1 1VQOZ 2RT9A 1Y8CA 1VQP1 4DQYB 4RVGA 1VQ7Z 2V45A 3HOYI 1VQ91 2OTLZ 3KIFA 3GTPI 1S721 3MONA 2R7ZI 1Q821 1I3QI 1LQLA 1VQ41 3BG1B 4E2ZA 3S1MI 1KQSZ 4NH1C 3CCSZ 3D6WA 4A3KI 1YIT1 2VPXA 3GCFA 3CXCY 2RHBA 3JAMb 1NJI2 2QR1B 1Y1VI 2RPRA 1VQ51 2JR6A 3I55Z 4S1TA 3HOZI 1N2FA 1RO2A 2K3RA 2QA4Z 1K731 1ZB9A 3CC2Z 3VB9A 3CC71 2E2HI 3CPWY 1USPA 2KI7B 3VTNA 3PO3I 3CC4Z 3I07A 2JA5I 1P9NA 3J7A4 3CCLZ 2GTIA 4XX2A 1ZH1A 1M902 1RO4A 1X3WA 1Q812 2VPWA 4NBHA 1VQ81 1WJ2A 4E30A 4A3JI 3KIHA 1VQ71 1VQPZ 3IFUA 3FKII 2JIMA 4DK1A 3IR7A 2KPIA 1W2BZ 1VQ9Z 2DE7A 2F4MA 1X0TA 1Y1VS 3J81f 1WIIA 1VQ4Z 3CME1 1Q862 2E2II 1SFOI 2LEXA 3VMIA 2O53A 3D9XA 2ZAEB 4A3EI 4BY1I 1QYPA 1X3ZA 3GKQA 1YITZ 3J81b 2QKDA 3PO3S 3NH8A 2AKLA 3NFZA 4NB8A 5A2Qf 4AYBA 1ZB8A 2R93I 1N8R1 3CCVZ 4MD9A 3G4SZ 2AYDA 1JJ2Y 1VQM1 3M4OI 3ESWA 3G71Z 3S2DI 2PMZA 4NBAA 2I3CA 5A2Qb 2QREB 3CCQ1 4NBEA 3F3PC 1M1K2 3OW2Z 1K9M1 2HF1A 4MXUA 1Y1WI 3CD6Z 2JIOA 4E2YA 2NVXI 2V8KA 1VQ8Z 2Q51A 4A3FI 3CMAZ 2K5RA 2RBLA 2E9HA 1NJI1 4E33A 1QVFY 2LIYA 3JAMf 3S16I 2IZ4A 4TNUA 4HGZA 2E7ZA 3CMEZ 4E2WA 3CCRZ 3MZKB 3P5JB 2M48A 4A3LI 3FQQA 1YIJZ 1RNIA 4Y52I 2IZ3A 3T4NB 4A3MI 1VQNZ 1YHQ1 1Z03A 2NVTI 4A3DI 3HOXI 3CCV1 1M901 3G4S1 1YUKA 3PO2I 4NB9A 1Q811 1ML8A 4NOZA 5D1OB 4RV9A 3G711 1VQMZ 1NP6A 1TWFI 4QTTA 3CCQZ 1KC81 1Z01A 1QVGZ 3CD61 1Q861 1QF8A 2JMOA 3Q87A 4A3GI 3CMA1 4MD7A 2WB1A 4NBCA 4MONA 2VPZA 3GTGI 1RLYA 1Z02A 3S1QI 3I4NI 3G6E1 2M6NA 2JNYA 1WW9A 2E2JI 5C3EI 3RZOI 1Q16A 3S1NI 3M3YI 4NBGA 4NFRA 2QRDB 1R9TI 3GTOI 3CCR1 5CM2M 2NAPA 1KQSY 3IX0A 2VUGA 1YIJ1 1KRLA 1I6HI 1VQ6Z 1VQN1 4MD8A 4A3CI 3NH4A 2P3YA 1KD11 3H0GI 1YHQZ 3I4MI 4E32A 2WAQA 1RQFA 3TDHB 3GTMI 1SIWA 2R92I 2VPYA 3CXCZ 4E31A 2W04A 1FDOA 2OOXB 3NDIA 3D2LA 2LFUA 1JWHC 1L1OC 2DE5A 5LL6f 3VMGA 4RVDA 3CCJ1 5C4XI 3CPWZ 1K8A2 1QVGY 5AN9F 1VQKZ 2G2KA 1USPB 2H85A 4MRIA 3NH5A 3I561 3TE5B 5FLXf 1YJ91 1WZNA 4CL1A 3G6EZ 1W2BY 5IT9b 1YJNZ 2VUMI 2GU2A 2RIQA 5IP7I 3BG0B 3HOUI 3NDJA 3S2HI 3GTMS 3J80b 2NVQI 2EGTA 1TWGI 5FLXb 3U50C 1VQ61 3QWUA 1TWCI 2PM9A 5C4JI 4E2XA 1Q7Y2 4EWCA 4A3BI 2R6MA 2GTHA 1K9M2 5T64A 2JA8I 2JIPA 1DL6A 4A3II 4BBSI 2QA41 2B63I 3EEDA 3GTLI 1Q822 3F3FC 5IP9I 1VLAA 4HGYA 3CCEZ 3S15I 1FDIA 2HU9A 1YI2Z 4RS4A 4A93I 1JJ2Z 2J6AA 1VQK1 3CQZI 4QTUA 3CCJZ 3OW2Y 2YU9I 5T6BA 2OZKA 1TWAI 2F4OA 4RVFA 1YJWZ 1RO0A 1YJN1 5FLMI 3I56Z 3CCU1 1YJ9Z 2OTJZ 3CCMZ 1K732 3K7AI 1AA6A 1VQO1 3VMHA 1VQLZ 2BJOA 1NUIA 1K83I 2PK7A 2QEXZ 3GTJI 4HH4A 4NBFA 4BBRI 2V8IA 1TWHI 3HKZA 1QXFA 2OTL1 1QVFZ 1I50I 3GTKI 2JIRA 1S72Z 2Y0SA 1KC82 1S7MA 2YADA 2NVYI 3S14I 2IV2X 3CCS1 2JS4A 4X6AI 1M1K1 3FQMA 1K8A1 4BXXI 3LUSA 5D1OA 1TFIA 2QLVB 3MZLB 4DGLA 2O4HA 2JA7I 2JUBA 3HOWI 3GTQI 3S17I 2QRCB 3I551 3CCE1
chains in the Genus database with same CATH topology
4NBBA 3IF8A 3HOVI 1VQ5Z 1YI21 2V8JA 4Y7NI 3CC21 5IT9f 5T67A 1PFTA 2OOYB 4RVHA 2DE6A 2Q4ZA 3RZDI 2P28A 1YUAA 3CC7Z 1WCMI 3H3VJ 2JA6I 4NBDA 3EERA 3J80f 4MH4A 5C44I 1YJW1 3CC41 3S1RI 2OTJ1 1KD12 3CCL1 2VF1A 3CCM1 3CCUZ 5D1PA 1VQL1 4BY7I 1Q7Y1 1N8R2 2W03A 2QEX1 1VQOZ 2RT9A 1VQP1 4DQYB 4RVGA 1VQ7Z 3HOYI 1VQ91 2OTLZ 3KIFA 3GTPI 1S721 3MONA 2R7ZI 1Q821 1I3QI 1LQLA 1VQ41 3BG1B 4E2ZA 3S1MI 1KQSZ 4NH1C 3CCSZ 3D6WA 4A3KI 1YIT1 3GCFA 3CXCY 2RHBA 3JAMb 1NJI2 2QR1B 1Y1VI 2RPRA 1VQ51 2JR6A 3I55Z 4S1TA 3HOZI 1N2FA 1RO2A 2K3RA 1K731 1ZB9A 3CC2Z 3VB9A 3CC71 2E2HI 3CPWY 1USPA 2KI7B 3VTNA 3PO3I 3CC4Z 3I07A 2JA5I 1P9NA 3J7A4 3CCLZ 2GTIA 4XX2A 1ZH1A 1M902 1RO4A 1X3WA 1Q812 4NBHA 1VQ81 4E30A 4A3JI 3KIHA 1VQ71 1VQPZ 3IFUA 3FKII 4DK1A 2KPIA 1W2BZ 1VQ9Z 2DE7A 2F4MA 1X0TA 1Y1VS 3J81f 1WIIA 1VQ4Z 3CME1 1Q862 2E2II 1SFOI 3VMIA 2O53A 3D9XA 2QRCB 2ZAEB 4A3EI 4BY1I 1QYPA 1X3ZA 3GKQA 1YITZ 3J81b 2QKDA 3PO3S 3NH8A 2AKLA 3NFZA 4NB8A 5A2Qf 4AYBA 1ZB8A 2R93I 1N8R1 3CCVZ 4MD9A 3G4SZ 1JJ2Y 1VQM1 3M4OI 3ESWA 3G71Z 3S2DI 2PMZA 4NBAA 2I3CA 5A2Qb 2QREB 3CCQ1 4NBEA 3F3PC 1M1K2 3OW2Z 1K9M1 2HF1A 4MXUA 1Y1WI 3CD6Z 4E2YA 2NVXI 2V8KA 1VQ8Z 2Q51A 4A3FI 3CMAZ 2K5RA 2RBLA 2E9HA 1NJI1 4E33A 1QVFY 2LIYA 3JAMf 3S16I 2IZ4A 4TNUA 4HGZA 3CMEZ 4E2WA 3CCRZ 3MZKB 3P5JB 2M48A 4A3LI 3FQQA 1YIJZ 1RNIA 4Y52I 2IZ3A 3T4NB 4A3MI 1VQNZ 1YHQ1 1Z03A 2NVTI 4A3DI 3HOXI 3CCV1 1M901 3G4S1 1YUKA 3PO2I 4NB9A 1Q811 1ML8A 4NOZA 5D1OB 4RV9A 3G711 1VQMZ 1NP6A 1TWFI 4QTTA 3CCQZ 1KC81 1Z01A 1QVGZ 3CD61 1Q861 1QF8A 2JMOA 3Q87A 4A3GI 3CMA1 4MD7A 2WB1A 4NBCA 4MONA 3GTGI 1RLYA 1Z02A 3S1QI 3I4NI 3G6E1 2M6NA 2JNYA 1WW9A 2E2JI 5C3EI 3RZOI 3S1NI 3M3YI 4NBGA 4NFRA 2QRDB 1R9TI 3GTOI 3CCR1 5CM2M 1KQSY 3IX0A 2VUGA 1YIJ1 1KRLA 1I6HI 1VQ6Z 1VQN1 4MD8A 4A3CI 3NH4A 2P3YA 1KD11 3H0GI 1YHQZ 3I4MI 4E32A 2WAQA 1RQFA 3TDHB 3GTMI 2R92I 3CXCZ 4E31A 2W04A 2OOXB 3NDIA 2LFUA 1JWHC 1L1OC 2DE5A 5LL6f 3VMGA 4RVDA 3CCJ1 5C4XI 3CPWZ 1K8A2 1QVGY 5AN9F 1VQKZ 2G2KA 1USPB 2H85A 4MRIA 3NH5A 3I561 3TE5B 5FLXf 1YJ91 4CL1A 3G6EZ 1W2BY 5IT9b 1YJNZ 2VUMI 2GU2A 2RIQA 5IP7I 3BG0B 3HOUI 3NDJA 3S2HI 3GTMS 3J80b 2NVQI 2EGTA 1TWGI 5FLXb 3U50C 1VQ61 3QWUA 1TWCI 2PM9A 5C4JI 4E2XA 1Q7Y2 4EWCA 4A3BI 2R6MA 2GTHA 1K9M2 5T64A 2JA8I 1DL6A 4A3II 4BBSI 2QA41 2B63I 3EEDA 3GTLI 1Q822 3F3FC 5IP9I 1VLAA 4HGYA 3CCEZ 3S15I 2HU9A 1YI2Z 4RS4A 4A93I 1JJ2Z 2J6AA 1VQK1 3CQZI 4QTUA 3CCJZ 3OW2Y 2YU9I 5T6BA 2OZKA 1TWAI 2F4OA 4RVFA 1YJWZ 1RO0A 1YJN1 5FLMI 3I56Z 3CCU1 1YJ9Z 2OTJZ 3CCMZ 1K732 3K7AI 1VQO1 3VMHA 1VQLZ 2BJOA 1NUIA 1K83I 2PK7A 2QEXZ 3GTJI 4HH4A 4NBFA 4BBRI 2V8IA 1TWHI 3HKZA 2OTL1 1QVFZ 1I50I 3GTKI 1S72Z 2Y0SA 1KC82 1S7MA 2YADA 2NVYI 3S14I 3CCS1 2JS4A 4X6AI 1M1K1 3FQMA 1K8A1 4BXXI 3LUSA 5D1OA 1TFIA 2QLVB 3MZLB 4DGLA 2O4HA 2JA7I 2JUBA 3HOWI 3GTQI 3S17I 2QA4Z 3I551 3CCE1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 I;  4NBB A;  3HOV I;  3HOU I;  3S2H I;  2DE7 A;  3GTM S;  2F4M A;  4Y7N I;  2NVQ I;  1Y1V S;  1TWG I;  1PFT A;  1TWF I;  2DE6 A;  3U50 C;  3RZD I;  4QTT A;  1YUA A;  1WCM I;  2E2I I;  3H3V J;  1TWC I;  1SFO I;  2JA6 I;  4NBD A;  5C4J I;  3EER A;  4MH4 A;  5C44 I;  3VMI A;  3S1R I;  4A3B I;  4A3E I;  4BY1 I;  1QYP A;  1X3Z A;  3GKQ A;  3Q87 A;  4A3G I;  4BY7 I;  4NBC A;  2JA8 I;  3PO3 S;  3GTG I;  2AKL A;  1RLY A;  3S1Q I;  1DL6 A;  3I4N I;  4A3I I;  4BBS I;  4NB8 A;  2JNY A;  1ZB8 A;  2R93 I;  1WW9 A;  2B63 I;  2E2J I;  5C3E I;  3GTL I;  3RZO I;  3HOY I;  3S1N I;  3M3Y I;  4NBG A;  5IP9 I;  1VLA A;  1R9T I;  3GTO I;  3GTP I;  3S15 I;  3M4O I;  5CM2 M;  2R7Z I;  3S17 I;  3ESW A;  3S2D I;  4A93 I;  1I3Q I;  4NBA A;  2J6A A;  3CQZ I;  1LQL A;  4QTU A;  1I6H I;  4NBE A;  2YU9 I;  3S1M I;  4A3C I;  1TWA I;  2F4O A;  2P3Y A;  3D6W A;  3H0G I;  4A3K I;  2HF1 A;  5FLM I;  1Y1W I;  3I4M I;  2NVX I;  3GCF A;  3GTM I;  4A3F I;  2R92 I;  1Y1V I;  3K7A I;  3VMH A;  2BJO A;  2JR6 A;  1NUI A;  1K83 I;  2K5R A;  2PK7 A;  2RBL A;  3GTJ I;  3HOZ I;  1N2F A;  4NBF A;  4BBR I;  1TWH I;  1ZB9 A;  3VB9 A;  2E2H I;  3S16 I;  1USP A;  1I50 I;  1L1O C;  3GTK I;  2DE5 A;  3VMG A;  3PO3 I;  5C4X I;  3I07 A;  4A3L I;  2JA5 I;  2NVY I;  3S14 I;  1USP B;  4Y52 I;  4XX2 A;  2JS4 A;  4A3M I;  4X6A I;  1RO4 A;  1X3W A;  4BXX I;  3LUS A;  2NVT I;  1TFI A;  4NBH A;  4A3J I;  2JA7 I;  3HOW I;  2VUM I;  3HOX I;  4A3D I;  3GTQ I;  3PO2 I;  4NB9 A;  3FKI I;  1ML8 A;  4NOZ A;  2KPI A; 
#chains in the Genus database with same CATH topology
 4NBB A;  3IF8 A;  3HOV I;  1VQ5 Z;  1YI2 1;  2V8J A;  4Y7N I;  3CC2 1;  5IT9 f;  5T67 A;  1PFT A;  2OOY B;  2V3V A;  4RVH A;  2DE6 A;  2Q4Z A;  3RZD I;  2P28 A;  1YUA A;  3CC7 Z;  1WCM I;  3H3V J;  2JA6 I;  4NBD A;  3EER A;  3J80 f;  4MH4 A;  5C44 I;  1YJW 1;  3CC4 1;  3S1R I;  2OTJ 1;  1KD1 2;  3CCL 1;  2VF1 A;  3CCM 1;  2JIQ A;  3CCU Z;  5D1P A;  1VQL 1;  4BY7 I;  1Q7Y 1;  1N8R 2;  2W03 A;  2QEX 1;  1VQO Z;  2RT9 A;  1Y8C A;  1VQP 1;  4DQY B;  4RVG A;  1VQ7 Z;  2V45 A;  3HOY I;  1VQ9 1;  2OTL Z;  3KIF A;  3GTP I;  1S72 1;  3MON A;  2R7Z I;  1Q82 1;  1I3Q I;  1LQL A;  1VQ4 1;  3BG1 B;  4E2Z A;  3S1M I;  1KQS Z;  4NH1 C;  3CCS Z;  3D6W A;  4A3K I;  1YIT 1;  2VPX A;  3GCF A;  3CXC Y;  2RHB A;  3JAM b;  1NJI 2;  2QR1 B;  1Y1V I;  2RPR A;  1VQ5 1;  2JR6 A;  3I55 Z;  4S1T A;  3HOZ I;  1N2F A;  1RO2 A;  2K3R A;  2QA4 Z;  1K73 1;  1ZB9 A;  3CC2 Z;  3VB9 A;  3CC7 1;  2E2H I;  3CPW Y;  1USP A;  2KI7 B;  3VTN A;  3PO3 I;  3CC4 Z;  3I07 A;  2JA5 I;  1P9N A;  3J7A 4;  3CCL Z;  2GTI A;  4XX2 A;  1ZH1 A;  1M90 2;  1RO4 A;  1X3W A;  1Q81 2;  2VPW A;  4NBH A;  1VQ8 1;  1WJ2 A;  4E30 A;  4A3J I;  3KIH A;  1VQ7 1;  1VQP Z;  3IFU A;  3FKI I;  2JIM A;  4DK1 A;  3IR7 A;  2KPI A;  1W2B Z;  1VQ9 Z;  2DE7 A;  2F4M A;  1X0T A;  1Y1V S;  3J81 f;  1WII A;  1VQ4 Z;  3CME 1;  1Q86 2;  2E2I I;  1SFO I;  2LEX A;  3VMI A;  2O53 A;  3D9X A;  2ZAE B;  4A3E I;  4BY1 I;  1QYP A;  1X3Z A;  3GKQ A;  1YIT Z;  3J81 b;  2QKD A;  3PO3 S;  3NH8 A;  2AKL A;  3NFZ A;  4NB8 A;  5A2Q f;  4AYB A;  1ZB8 A;  2R93 I;  1N8R 1;  3CCV Z;  4MD9 A;  3G4S Z;  2AYD A;  1JJ2 Y;  1VQM 1;  3M4O I;  3ESW A;  3G71 Z;  3S2D I;  2PMZ A;  4NBA A;  2I3C A;  5A2Q b;  2QRE B;  3CCQ 1;  4NBE A;  3F3P C;  1M1K 2;  3OW2 Z;  1K9M 1;  2HF1 A;  4MXU A;  1Y1W I;  3CD6 Z;  2JIO A;  4E2Y A;  2NVX I;  2V8K A;  1VQ8 Z;  2Q51 A;  4A3F I;  3CMA Z;  2K5R A;  2RBL A;  2E9H A;  1NJI 1;  4E33 A;  1QVF Y;  2LIY A;  3JAM f;  3S16 I;  2IZ4 A;  4TNU A;  4HGZ A;  2E7Z A;  3CME Z;  4E2W A;  3CCR Z;  3MZK B;  3P5J B;  2M48 A;  4A3L I;  3FQQ A;  1YIJ Z;  1RNI A;  4Y52 I;  2IZ3 A;  3T4N B;  4A3M I;  1VQN Z;  1YHQ 1;  1Z03 A;  2NVT I;  4A3D I;  3HOX I;  3CCV 1;  1M90 1;  3G4S 1;  1YUK A;  3PO2 I;  4NB9 A;  1Q81 1;  1ML8 A;  4NOZ A;  5D1O B;  4RV9 A;  3G71 1;  1VQM Z;  1NP6 A;  1TWF I;  4QTT A;  3CCQ Z;  1KC8 1;  1Z01 A;  1QVG Z;  3CD6 1;  1Q86 1;  1QF8 A;  2JMO A;  3Q87 A;  4A3G I;  3CMA 1;  4MD7 A;  2WB1 A;  4NBC A;  4MON A;  2VPZ A;  3GTG I;  1RLY A;  1Z02 A;  3S1Q I;  3I4N I;  3G6E 1;  2M6N A;  2JNY A;  1WW9 A;  2E2J I;  5C3E I;  3RZO I;  1Q16 A;  3S1N I;  3M3Y I;  4NBG A;  4NFR A;  2QRD B;  1R9T I;  3GTO I;  3CCR 1;  5CM2 M;  2NAP A;  1KQS Y;  3IX0 A;  2VUG A;  1YIJ 1;  1KRL A;  1I6H I;  1VQ6 Z;  1VQN 1;  4MD8 A;  4A3C I;  3NH4 A;  2P3Y A;  1KD1 1;  3H0G I;  1YHQ Z;  3I4M I;  4E32 A;  2WAQ A;  1RQF A;  3TDH B;  3GTM I;  1SIW A;  2R92 I;  2VPY A;  3CXC Z;  4E31 A;  2W04 A;  1FDO A;  2OOX B;  3NDI A;  3D2L A;  2LFU A;  1JWH C;  1L1O C;  2DE5 A;  5LL6 f;  3VMG A;  4RVD A;  3CCJ 1;  5C4X I;  3CPW Z;  1K8A 2;  1QVG Y;  5AN9 F;  1VQK Z;  2G2K A;  1USP B;  2H85 A;  4MRI A;  3NH5 A;  3I56 1;  3TE5 B;  5FLX f;  1YJ9 1;  1WZN A;  4CL1 A;  3G6E Z;  1W2B Y;  5IT9 b;  1YJN Z;  2VUM I;  2GU2 A;  2RIQ A;  5IP7 I;  3BG0 B;  3HOU I;  3NDJ A;  3S2H I;  3GTM S;  3J80 b;  2NVQ I;  2EGT A;  1TWG I;  5FLX b;  3U50 C;  1VQ6 1;  3QWU A;  1TWC I;  2PM9 A;  5C4J I;  4E2X A;  1Q7Y 2;  4EWC A;  4A3B I;  2R6M A;  2GTH A;  1K9M 2;  5T64 A;  2JA8 I;  2JIP A;  1DL6 A;  4A3I I;  4BBS I;  2QA4 1;  2B63 I;  3EED A;  3GTL I;  1Q82 2;  3F3F C;  5IP9 I;  1VLA A;  4HGY A;  3CCE Z;  3S15 I;  1FDI A;  2HU9 A;  1YI2 Z;  4RS4 A;  4A93 I;  1JJ2 Z;  2J6A A;  1VQK 1;  3CQZ I;  4QTU A;  3CCJ Z;  3OW2 Y;  2YU9 I;  5T6B A;  2OZK A;  1TWA I;  2F4O A;  4RVF A;  1YJW Z;  1RO0 A;  1YJN 1;  5FLM I;  3I56 Z;  3CCU 1;  1YJ9 Z;  2OTJ Z;  3CCM Z;  1K73 2;  3K7A I;  1AA6 A;  1VQO 1;  3VMH A;  1VQL Z;  2BJO A;  1NUI A;  1K83 I;  2PK7 A;  2QEX Z;  3GTJ I;  4HH4 A;  4NBF A;  4BBR I;  2V8I A;  1TWH I;  3HKZ A;  1QXF A;  2OTL 1;  1QVF Z;  1I50 I;  3GTK I;  2JIR A;  1S72 Z;  2Y0S A;  1KC8 2;  1S7M A;  2YAD A;  2NVY I;  3S14 I;  2IV2 X;  3CCS 1;  2JS4 A;  4X6A I;  1M1K 1;  3FQM A;  1K8A 1;  4BXX I;  3LUS A;  5D1O A;  1TFI A;  2QLV B;  3MZL B;  4DGL A;  2O4H A;  2JA7 I;  2JUB A;  3HOW I;  3GTQ I;  3S17 I;  2QRC B;  3I55 1;  3CCE 1; 
#chains in the Genus database with same CATH homology
 4NBB A;  3IF8 A;  3HOV I;  1VQ5 Z;  1YI2 1;  2V8J A;  4Y7N I;  3CC2 1;  5IT9 f;  5T67 A;  1PFT A;  2OOY B;  4RVH A;  2DE6 A;  2Q4Z A;  3RZD I;  2P28 A;  1YUA A;  3CC7 Z;  1WCM I;  3H3V J;  2JA6 I;  4NBD A;  3EER A;  3J80 f;  4MH4 A;  5C44 I;  1YJW 1;  3CC4 1;  3S1R I;  2OTJ 1;  1KD1 2;  3CCL 1;  2VF1 A;  3CCM 1;  3CCU Z;  5D1P A;  1VQL 1;  4BY7 I;  1Q7Y 1;  1N8R 2;  2W03 A;  2QEX 1;  1VQO Z;  2RT9 A;  1VQP 1;  4DQY B;  4RVG A;  1VQ7 Z;  3HOY I;  1VQ9 1;  2OTL Z;  3KIF A;  3GTP I;  1S72 1;  3MON A;  2R7Z I;  1Q82 1;  1I3Q I;  1LQL A;  1VQ4 1;  3BG1 B;  4E2Z A;  3S1M I;  1KQS Z;  4NH1 C;  3CCS Z;  3D6W A;  4A3K I;  1YIT 1;  3GCF A;  3CXC Y;  2RHB A;  3JAM b;  1NJI 2;  2QR1 B;  1Y1V I;  2RPR A;  1VQ5 1;  2JR6 A;  3I55 Z;  4S1T A;  3HOZ I;  1N2F A;  1RO2 A;  2K3R A;  1K73 1;  1ZB9 A;  3CC2 Z;  3VB9 A;  3CC7 1;  2E2H I;  3CPW Y;  1USP A;  2KI7 B;  3VTN A;  3PO3 I;  3CC4 Z;  3I07 A;  2JA5 I;  1P9N A;  3J7A 4;  3CCL Z;  2GTI A;  4XX2 A;  1ZH1 A;  1M90 2;  1RO4 A;  1X3W A;  1Q81 2;  4NBH A;  1VQ8 1;  4E30 A;  4A3J I;  3KIH A;  1VQ7 1;  1VQP Z;  3IFU A;  3FKI I;  4DK1 A;  2KPI A;  1W2B Z;  1VQ9 Z;  2DE7 A;  2F4M A;  1X0T A;  1Y1V S;  3J81 f;  1WII A;  1VQ4 Z;  3CME 1;  1Q86 2;  2E2I I;  1SFO I;  3VMI A;  2O53 A;  3D9X A;  2QRC B;  2ZAE B;  4A3E I;  4BY1 I;  1QYP A;  1X3Z A;  3GKQ A;  1YIT Z;  3J81 b;  2QKD A;  3PO3 S;  3NH8 A;  2AKL A;  3NFZ A;  4NB8 A;  5A2Q f;  4AYB A;  1ZB8 A;  2R93 I;  1N8R 1;  3CCV Z;  4MD9 A;  3G4S Z;  1JJ2 Y;  1VQM 1;  3M4O I;  3ESW A;  3G71 Z;  3S2D I;  2PMZ A;  4NBA A;  2I3C A;  5A2Q b;  2QRE B;  3CCQ 1;  4NBE A;  3F3P C;  1M1K 2;  3OW2 Z;  1K9M 1;  2HF1 A;  4MXU A;  1Y1W I;  3CD6 Z;  4E2Y A;  2NVX I;  2V8K A;  1VQ8 Z;  2Q51 A;  4A3F I;  3CMA Z;  2K5R A;  2RBL A;  2E9H A;  1NJI 1;  4E33 A;  1QVF Y;  2LIY A;  3JAM f;  3S16 I;  2IZ4 A;  4TNU A;  4HGZ A;  3CME Z;  4E2W A;  3CCR Z;  3MZK B;  3P5J B;  2M48 A;  4A3L I;  3FQQ A;  1YIJ Z;  1RNI A;  4Y52 I;  2IZ3 A;  3T4N B;  4A3M I;  1VQN Z;  1YHQ 1;  1Z03 A;  2NVT I;  4A3D I;  3HOX I;  3CCV 1;  1M90 1;  3G4S 1;  1YUK A;  3PO2 I;  4NB9 A;  1Q81 1;  1ML8 A;  4NOZ A;  5D1O B;  4RV9 A;  3G71 1;  1VQM Z;  1NP6 A;  1TWF I;  4QTT A;  3CCQ Z;  1KC8 1;  1Z01 A;  1QVG Z;  3CD6 1;  1Q86 1;  1QF8 A;  2JMO A;  3Q87 A;  4A3G I;  3CMA 1;  4MD7 A;  2WB1 A;  4NBC A;  4MON A;  3GTG I;  1RLY A;  1Z02 A;  3S1Q I;  3I4N I;  3G6E 1;  2M6N A;  2JNY A;  1WW9 A;  2E2J I;  5C3E I;  3RZO I;  3S1N I;  3M3Y I;  4NBG A;  4NFR A;  2QRD B;  1R9T I;  3GTO I;  3CCR 1;  5CM2 M;  1KQS Y;  3IX0 A;  2VUG A;  1YIJ 1;  1KRL A;  1I6H I;  1VQ6 Z;  1VQN 1;  4MD8 A;  4A3C I;  3NH4 A;  2P3Y A;  1KD1 1;  3H0G I;  1YHQ Z;  3I4M I;  4E32 A;  2WAQ A;  1RQF A;  3TDH B;  3GTM I;  2R92 I;  3CXC Z;  4E31 A;  2W04 A;  2OOX B;  3NDI A;  2LFU A;  1JWH C;  1L1O C;  2DE5 A;  5LL6 f;  3VMG A;  4RVD A;  3CCJ 1;  5C4X I;  3CPW Z;  1K8A 2;  1QVG Y;  5AN9 F;  1VQK Z;  2G2K A;  1USP B;  2H85 A;  4MRI A;  3NH5 A;  3I56 1;  3TE5 B;  5FLX f;  1YJ9 1;  4CL1 A;  3G6E Z;  1W2B Y;  5IT9 b;  1YJN Z;  2VUM I;  2GU2 A;  2RIQ A;  5IP7 I;  3BG0 B;  3HOU I;  3NDJ A;  3S2H I;  3GTM S;  3J80 b;  2NVQ I;  2EGT A;  1TWG I;  5FLX b;  3U50 C;  1VQ6 1;  3QWU A;  1TWC I;  2PM9 A;  5C4J I;  4E2X A;  1Q7Y 2;  4EWC A;  4A3B I;  2R6M A;  2GTH A;  1K9M 2;  5T64 A;  2JA8 I;  1DL6 A;  4A3I I;  4BBS I;  2QA4 1;  2B63 I;  3EED A;  3GTL I;  1Q82 2;  3F3F C;  5IP9 I;  1VLA A;  4HGY A;  3CCE Z;  3S15 I;  2HU9 A;  1YI2 Z;  4RS4 A;  4A93 I;  1JJ2 Z;  2J6A A;  1VQK 1;  3CQZ I;  4QTU A;  3CCJ Z;  3OW2 Y;  2YU9 I;  5T6B A;  2OZK A;  1TWA I;  2F4O A;  4RVF A;  1YJW Z;  1RO0 A;  1YJN 1;  5FLM I;  3I56 Z;  3CCU 1;  1YJ9 Z;  2OTJ Z;  3CCM Z;  1K73 2;  3K7A I;  1VQO 1;  3VMH A;  1VQL Z;  2BJO A;  1NUI A;  1K83 I;  2PK7 A;  2QEX Z;  3GTJ I;  4HH4 A;  4NBF A;  4BBR I;  2V8I A;  1TWH I;  3HKZ A;  2OTL 1;  1QVF Z;  1I50 I;  3GTK I;  1S72 Z;  2Y0S A;  1KC8 2;  1S7M A;  2YAD A;  2NVY I;  3S14 I;  3CCS 1;  2JS4 A;  4X6A I;  1M1K 1;  3FQM A;  1K8A 1;  4BXX I;  3LUS A;  5D1O A;  1TFI A;  2QLV B;  3MZL B;  4DGL A;  2O4H A;  2JA7 I;  2JUB A;  3HOW I;  3GTQ I;  3S17 I;  2QA4 Z;  3I55 1;  3CCE 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...