2K5RA

Solution nmr structure of xf2673 from xylella fastidiosa. northeast structural genomics consortium target xfr39
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIATIQIANFPDKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein XF2673
publication title Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39
rcsb
source organism Xylella fastidiosa temecula1
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k5rA01
1WCMI 1VLAA 3HOUI 3Q87A 4A3CI 1K83I 2JS4A 3S1QI 2E2II 3S1MI 4BXXI 3HOXI 2JA5I 2NVXI 1TWAI 5IP9I 1I3QI 3VMHA 2R93I 1RLYA 3GCFA 1TWCI 1NUIA 3H0GI 2JA7I 3VMIA 3I4NI 5C3EI 3HOWI 2K5RA 3U50C 2VUMI 1USPA 2DE7A 4A3II 4A3LI 2BJOA 2P3YA 5IP7I 1ZB8A 1LQLA 3HOZI 4BY1I 5C4XI 3GTKI 1X3ZA 3RZDI 2F4OA 4NBDA 4NBHA 2AKLA 3S1NI 3VMGA 4NOZA 2PK7A 4A3DI 2E2HI 4NBGA 1Y1VS 1RO4A 4BBRI 3HOYI 5CM2M 1Y1WI 3LUSA 2RBLA 4A3MI 5C44I 2JA8I 4A3BI 2JNYA 4XX2A 4BBSI 4NBEA 3PO2I 3S2DI 4QTUA 3RZOI 2J6AA 4A3GI 3GTOI 1TFIA 4NBBA 3S16I 3S15I 3FKII 1QYPA 4NBCA 1I6HI 3D6WA 3GTGI 3S14I 3S2HI 5C4JI 1I50I 3PO3S 3S17I 1R9TI 4BY7I 1Y1VI 3GTJI 3K7AI 3H3VJ 2R7ZI 4A3FI 1TWFI 1USPB 2B63I 2NVTI 1TWGI 4NB9A 1L1OC 3GTLI 1ZB9A 3S1RI 2JR6A 1TWHI 2HF1A 3GTPI 3GTMI 2R92I 2KPIA 1DL6A 1N2FA 4NBAA 3HOVI 3GTMS 4MH4A 2NVQI 5FLMI 4A3JI 2F4MA 2DE6A 3PO3I 3GKQA 3M3YI 4NBFA 1X3WA 1YUAA 3M4OI 3GTQI 4A3EI 4X6AI 1PFTA 3I07A 2NVYI 3I4MI 1WW9A 4QTTA 3EERA 3ESWA 1ML8A 4NB8A 3VB9A 3CQZI 2YU9I 4A93I 1SFOI 4Y52I 2JA6I 4A3KI 2E2JI 2DE5A 4Y7NI
chains in the Genus database with same CATH superfamily
3CCQZ 5T6BA 2W04A 2V8KA 5IT9b 2IV2X 4CL1A 3S1QI 4BXXI 1VQLZ 2NVXI 1TWAI 2VPYA 3I551 2RHBA 3OW2Y 2PMZA 3H0GI 3MONA 3HOWI 3U50C 3J80b 1VQ8Z 4DK1A 1USPA 2DE7A 4E32A 2BJOA 2P3YA 5IP7I 1LQLA 3HOZI 2VPXA 1X3ZA 5FLXf 4HGYA 2F4OA 2LIYA 4NBHA 4TNUA 2PK7A 4RVFA 1AA6A 2E2HI 3IFUA 3NFZA 2VF1A 4BBRI 3CMEZ 4A3MI 4A3BI 1NJI1 4BBSI 3FQQA 3S2DI 2JIRA 2OZKA 3P5JB 4MD9A 1K732 1Z02A 3KIHA 2QKDA 3S2HI 5C4JI 2E7ZA 3G6E1 2QA41 3HKZA 2K3RA 1Y1VI 1NP6A 1YI2Z 2GTIA 2JUBA 3VTNA 5D1OB 1TWFI 1VQ4Z 2LFUA 1L1OC 1YJWZ 1ZB9A 3F3FC 1RO0A 1DL6A 4NBAA 1Z01A 3GTMS 3G6EZ 4RVHA 4A3JI 2F4MA 2GTHA 3PO3I 3GKQA 3M3YI 3NH8A 4A3EI 1VQKZ 1KRLA 1PFTA 2QREB 3CCL1 1KC81 3BG0B 2RIQA 1ML8A 3ESWA 1KQSZ 2VUGA 1M902 4MONA 3JAMf 4A3CI 3CCEZ 1K83I 4E2YA 3D2LA 3CCLZ 3S1MI 2LEXA 1Q7Y2 3HOXI 1M1K1 3CCRZ 5IP9I 1X0TA 1VQ61 1NUIA 1WZNA 1Q811 5D1OA 2OTL1 3EEDA 2VUMI 2O53A 4A3LI 3CCSZ 3OW2Z 1QVFY 3CCM1 2OTJZ 1SIWA 4BY1I 3CCV1 2AYDA 3IX0A 3RZDI 1K9M2 4AYBA 3NH4A 3S1NI 2RPRA 3G4SZ 5CM2M 1ZH1A 1Z03A 2O4HA 1YJ91 2JA8I 1VQM1 1KD12 1QF8A 4NBEA 3PO2I 2V8JA 5D1PA 3CCMZ 2GU2A 2IZ3A 3CCVZ 4RV9A 3S16I 1Q862 3FKII 1QYPA 1K8A2 3S14I 3I55Z 4RS4A 3S17I 2JMOA 1VQMZ 4A3FI 3CMA1 1Y8CA 3I561 5A2Qf 1TWGI 4E31A 5T64A 3G711 3GTLI 2W03A 2JR6A 2HF1A 3GTPI 3GTMI 3NH5A 2KPIA 1N2FA 2Q51A 1VQ51 3NDIA 2DE6A 2WAQA 4DQYB 2JIPA 2M48A 1VQN1 1QXFA 1VQP1 1YIJ1 5FLXb 3CC21 3TE5B 4HH4A 3T4NB 4NH1C 3CCJ1 4QTTA 2KI7B 3VB9A 3J81f 3CQZI 2E2JI 2DE5A 4Y7NI 3CC41 3CPWY 3IF8A 2M6NA 2V45A 3HOUI 2OOXB 2QA4Z 4DGLA 2R6MA 2IZ4A 2E2II 2JA5I 2EGTA 1I3QI 3CXCY 4E2ZA 1VQ71 3GCFA 2V8IA 3VMIA 2Q4ZA 2H85A 1YIT1 3I4NI 1N8R2 2P28A 2VPZA 2QR1B 1ZB8A 3J7A4 2Y0SA 4NFRA 1W2BY 3MZKB 4RVGA 4NOZA 1QVFZ 1Y1VS 2I3CA 3TDHB 3HOYI 1Y1WI 3LUSA 2QRCB 4MD8A 5C44I 1YHQ1 1JJ2Y 4XX2A 4EWCA 2JIQA 4QTUA 4E30A 5IT9f 2JIOA 4A3GI 2HU9A 2OOYB 1TFIA 4NBBA 4NBCA 3JAMb 3GTGI 1I50I 3PO3S 3MZLB 3CC71 1VQ6Z 1YJN1 3NDJA 2R7ZI 2YADA 1KC82 4E2XA 2OTLZ 3J80f 1Q822 1VQ91 2NVTI 3KIFA 4NB9A 1RO2A 2R92I 1VQ81 3HOVI 5LL6f 1K731 3CC7Z 1YJNZ 2G2KA 4NBFA 1X3WA 1M1K2 3GTQI 3CD61 1VQ9Z 3I07A 2NVYI 1YJ9Z 4HGZA 1WW9A 3EERA 1SFOI 1Q812 2JA6I 4A3KI 3CME1 1YUKA 1WCMI 1VLAA 3CCU1 3Q87A 4MXUA 3CD6Z 3IR7A 2JS4A 3CPWZ 3CMAZ 2RT9A 1FDIA 3VMHA 2R93I 3I56Z 1YI21 1RLYA 1TWCI 2WB1A 3G71Z 2JA7I 5AN9F 1WJ2A 2K5RA 3CCUZ 1N8R1 5A2Qb 3CXCZ 1VQ41 1S7MA 2VPWA 1M901 1VQ5Z 1YJW1 1FDOA 2ZAEB 4RVDA 4A3II 1VQNZ 1VQPZ 1YIJZ 3D9XA 5C4XI 3GTKI 3FQMA 2V3VA 2JIMA 3CC2Z 4NBDA 1VQO1 2AKLA 1Q7Y1 2QLVB 3VMGA 2QEX1 4A3DI 3CCJZ 4NBGA 1RO4A 1VQK1 1W2BZ 2RBLA 3CC4Z 2JNYA 1WIIA 1NJI2 3J81b 1QVGZ 1S721 3RZOI 2J6AA 3GTOI 2QRDB 3S15I 1VQOZ 1JJ2Z 2QEXZ 1I6HI 3D6WA 1K9M1 3QWUA 4MD7A 3CCE1 1R9TI 4BY7I 3GTJI 3K7AI 1VQ7Z 3H3VJ 4E2WA 1RQFA 1QVGY 3CCR1 1YITZ 5T67A 1JWHC 1Q821 1USPB 2B63I 1S72Z 1KD11 2E9HA 3S1RI 1TWHI 1Q16A 4MH4A 3CCQ1 2NVQI 5FLMI 1Q861 3CCS1 4S1TA 1K8A1 4MRIA 1KQSY 4E33A 1YUAA 3M4OI 2OTJ1 4X6AI 1YHQZ 3I4MI 1VQL1 1RNIA 2NAPA 3BG1B 4NB8A 3F3PC 2YU9I 4A93I 4Y52I 3G4S1 5C3EI 2PM9A 1P9NA
chains in the Genus database with same CATH topology
3CCQZ 5T6BA 2W04A 2V8KA 5IT9b 4CL1A 3S1QI 4BXXI 1VQLZ 2NVXI 1TWAI 3I551 2RHBA 3OW2Y 2PMZA 3H0GI 3MONA 3HOWI 3U50C 3J80b 1VQ8Z 4DK1A 1USPA 2DE7A 4E32A 2BJOA 2P3YA 5IP7I 1LQLA 3HOZI 1X3ZA 4HGYA 5FLXf 2F4OA 2LIYA 4NBHA 4TNUA 2PK7A 4RVFA 2E2HI 3IFUA 3NFZA 2VF1A 4BBRI 3CMEZ 4A3MI 4A3BI 1NJI1 4BBSI 3FQQA 3S2DI 2OZKA 3P5JB 4MD9A 1K732 1Z02A 3KIHA 2QKDA 3S2HI 5C4JI 3G6E1 2QA41 3HKZA 2K3RA 1Y1VI 1NP6A 1YI2Z 2GTIA 2JUBA 3VTNA 5D1OB 1TWFI 1VQ4Z 2LFUA 1L1OC 1YJWZ 1ZB9A 3F3FC 1RO0A 1DL6A 4NBAA 1Z01A 3GTMS 3G6EZ 4RVHA 4A3JI 2F4MA 2GTHA 3PO3I 3GKQA 3M3YI 3NH8A 4A3EI 1VQKZ 1KRLA 1PFTA 2QREB 3CCL1 1KC81 3BG0B 2RIQA 1ML8A 3ESWA 1KQSZ 2VUGA 1M902 4MONA 3JAMf 4A3CI 3CCEZ 1K83I 4E2YA 3CCLZ 3S1MI 1Q7Y2 3HOXI 1M1K1 3CCRZ 5IP9I 1X0TA 1VQ61 1NUIA 1Q811 5D1OA 2OTL1 3EEDA 2VUMI 2O53A 4A3LI 3CCSZ 3OW2Z 1QVFY 3CCM1 2OTJZ 4BY1I 3CCV1 3IX0A 3RZDI 1K9M2 4AYBA 3NH4A 3S1NI 2RPRA 3G4SZ 5CM2M 1ZH1A 1Z03A 2O4HA 1YJ91 2JA8I 1VQM1 1KD12 1QF8A 4NBEA 3PO2I 2V8JA 5D1PA 3CCMZ 2GU2A 2IZ3A 3CCVZ 4RV9A 3S16I 1Q862 3FKII 1QYPA 1K8A2 3S14I 3I55Z 4RS4A 3S17I 2JMOA 1VQMZ 4A3FI 3CMA1 3I561 5A2Qf 1TWGI 4E31A 5T64A 3G711 3GTLI 2W03A 2JR6A 2HF1A 3GTPI 3GTMI 3NH5A 2KPIA 1N2FA 2Q51A 1VQ51 3NDIA 2DE6A 2WAQA 4DQYB 2M48A 1VQN1 1VQP1 1YIJ1 5FLXb 3CC21 3TE5B 4HH4A 3T4NB 4NH1C 3CCJ1 4QTTA 2KI7B 3VB9A 3J81f 3CQZI 2E2JI 2DE5A 4Y7NI 3CC41 3CPWY 3IF8A 2M6NA 3HOUI 2OOXB 2QA4Z 4DGLA 2R6MA 2IZ4A 2E2II 2JA5I 2EGTA 1I3QI 3CXCY 4E2ZA 1VQ71 3GCFA 2V8IA 3VMIA 2Q4ZA 2H85A 1YIT1 3I4NI 1N8R2 2P28A 2QR1B 1ZB8A 3J7A4 2Y0SA 4NFRA 1W2BY 3MZKB 4RVGA 4NOZA 1QVFZ 1Y1VS 2I3CA 3TDHB 3HOYI 1Y1WI 3LUSA 2QRCB 4MD8A 5C44I 1YHQ1 1JJ2Y 4XX2A 4EWCA 4QTUA 4E30A 5IT9f 4A3GI 2HU9A 2OOYB 1TFIA 4NBBA 4NBCA 3JAMb 3GTGI 1I50I 3PO3S 3MZLB 3CC71 1VQ6Z 1YJN1 3NDJA 2R7ZI 2YADA 1KC82 4E2XA 2OTLZ 3J80f 1Q822 1VQ91 2NVTI 3KIFA 4NB9A 1RO2A 2R92I 1VQ81 3HOVI 5LL6f 1K731 3CC7Z 1YJNZ 2G2KA 4NBFA 1X3WA 1M1K2 3GTQI 3CD61 1VQ9Z 3I07A 2NVYI 1YJ9Z 4HGZA 1WW9A 3EERA 1SFOI 1Q812 2JA6I 4A3KI 3CME1 1YUKA 1WCMI 1VLAA 3CCU1 3Q87A 4MXUA 3CD6Z 2JS4A 3CPWZ 3CMAZ 2RT9A 3VMHA 2R93I 3I56Z 1YI21 1RLYA 1TWCI 2WB1A 3G71Z 2JA7I 5AN9F 2K5RA 3CCUZ 1N8R1 5A2Qb 3CXCZ 1VQ41 1S7MA 1M901 1VQ5Z 1YJW1 2ZAEB 4RVDA 4A3II 1VQNZ 1VQPZ 1YIJZ 3D9XA 5C4XI 3GTKI 3FQMA 3CC2Z 4NBDA 1VQO1 2AKLA 1Q7Y1 2QLVB 3VMGA 2QEX1 4A3DI 3CCJZ 4NBGA 1RO4A 1VQK1 1W2BZ 2RBLA 3CC4Z 2JNYA 1WIIA 1NJI2 3J81b 1QVGZ 1S721 3RZOI 2J6AA 3GTOI 2QRDB 3S15I 1VQOZ 1JJ2Z 2QEXZ 1I6HI 3D6WA 1K9M1 3QWUA 4MD7A 3CCE1 1R9TI 4BY7I 3GTJI 3K7AI 1VQ7Z 3H3VJ 4E2WA 1RQFA 1QVGY 3CCR1 1YITZ 5T67A 1JWHC 1Q821 1USPB 2B63I 1S72Z 1KD11 2E9HA 3S1RI 1TWHI 4MH4A 3CCQ1 2NVQI 5FLMI 1Q861 3CCS1 4S1TA 1K8A1 4MRIA 1KQSY 4E33A 1YUAA 3M4OI 2OTJ1 4X6AI 1YHQZ 3I4MI 1VQL1 1RNIA 3BG1B 4NB8A 3F3PC 2YU9I 4A93I 4Y52I 3G4S1 5C3EI 2PM9A 1P9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM I;  1VLA A;  3HOU I;  3Q87 A;  4A3C I;  1K83 I;  2JS4 A;  3S1Q I;  2E2I I;  3S1M I;  4BXX I;  3HOX I;  2JA5 I;  2NVX I;  1TWA I;  5IP9 I;  1I3Q I;  3VMH A;  2R93 I;  1RLY A;  3GCF A;  1TWC I;  1NUI A;  3H0G I;  2JA7 I;  3VMI A;  3I4N I;  5C3E I;  3HOW I;  2K5R A;  3U50 C;  2VUM I;  1USP A;  2DE7 A;  4A3I I;  4A3L I;  2BJO A;  2P3Y A;  5IP7 I;  1ZB8 A;  1LQL A;  3HOZ I;  4BY1 I;  5C4X I;  3GTK I;  1X3Z A;  3RZD I;  2F4O A;  4NBD A;  4NBH A;  2AKL A;  3S1N I;  3VMG A;  4NOZ A;  2PK7 A;  4A3D I;  2E2H I;  4NBG A;  1Y1V S;  1RO4 A;  4BBR I;  3HOY I;  5CM2 M;  1Y1W I;  3LUS A;  2RBL A;  4A3M I;  5C44 I;  2JA8 I;  4A3B I;  2JNY A;  4XX2 A;  4BBS I;  4NBE A;  3PO2 I;  3S2D I;  4QTU A;  3RZO I;  2J6A A;  4A3G I;  3GTO I;  1TFI A;  4NBB A;  3S16 I;  3S15 I;  3FKI I;  1QYP A;  4NBC A;  1I6H I;  3D6W A;  3GTG I;  3S14 I;  3S2H I;  5C4J I;  1I50 I;  3PO3 S;  3S17 I;  1R9T I;  4BY7 I;  1Y1V I;  3GTJ I;  3K7A I;  3H3V J;  2R7Z I;  4A3F I;  1TWF I;  1USP B;  2B63 I;  2NVT I;  1TWG I;  4NB9 A;  1L1O C;  3GTL I;  1ZB9 A;  3S1R I;  2JR6 A;  1TWH I;  2HF1 A;  3GTP I;  3GTM I;  2R92 I;  2KPI A;  1DL6 A;  1N2F A;  4NBA A;  3HOV I;  3GTM S;  4MH4 A;  2NVQ I;  5FLM I;  4A3J I;  2F4M A;  2DE6 A;  3PO3 I;  3GKQ A;  3M3Y I;  4NBF A;  1X3W A;  1YUA A;  3M4O I;  3GTQ I;  4A3E I;  4X6A I;  1PFT A;  3I07 A;  2NVY I;  3I4M I;  1WW9 A;  4QTT A;  3EER A;  3ESW A;  1ML8 A;  4NB8 A;  3VB9 A;  3CQZ I;  2YU9 I;  4A93 I;  1SFO I;  4Y52 I;  2JA6 I;  4A3K I;  2E2J I;  2DE5 A;  4Y7N I; 
#chains in the Genus database with same CATH topology
 3CCQ Z;  5T6B A;  2W04 A;  2V8K A;  5IT9 b;  2IV2 X;  4CL1 A;  3S1Q I;  4BXX I;  1VQL Z;  2NVX I;  1TWA I;  2VPY A;  3I55 1;  2RHB A;  3OW2 Y;  2PMZ A;  3H0G I;  3MON A;  3HOW I;  3U50 C;  3J80 b;  1VQ8 Z;  4DK1 A;  1USP A;  2DE7 A;  4E32 A;  2BJO A;  2P3Y A;  5IP7 I;  1LQL A;  3HOZ I;  2VPX A;  1X3Z A;  5FLX f;  4HGY A;  2F4O A;  2LIY A;  4NBH A;  4TNU A;  2PK7 A;  4RVF A;  1AA6 A;  2E2H I;  3IFU A;  3NFZ A;  2VF1 A;  4BBR I;  3CME Z;  4A3M I;  4A3B I;  1NJI 1;  4BBS I;  3FQQ A;  3S2D I;  2JIR A;  2OZK A;  3P5J B;  4MD9 A;  1K73 2;  1Z02 A;  3KIH A;  2QKD A;  3S2H I;  5C4J I;  2E7Z A;  3G6E 1;  2QA4 1;  3HKZ A;  2K3R A;  1Y1V I;  1NP6 A;  1YI2 Z;  2GTI A;  2JUB A;  3VTN A;  5D1O B;  1TWF I;  1VQ4 Z;  2LFU A;  1L1O C;  1YJW Z;  1ZB9 A;  3F3F C;  1RO0 A;  1DL6 A;  4NBA A;  1Z01 A;  3GTM S;  3G6E Z;  4RVH A;  4A3J I;  2F4M A;  2GTH A;  3PO3 I;  3GKQ A;  3M3Y I;  3NH8 A;  4A3E I;  1VQK Z;  1KRL A;  1PFT A;  2QRE B;  3CCL 1;  1KC8 1;  3BG0 B;  2RIQ A;  1ML8 A;  3ESW A;  1KQS Z;  2VUG A;  1M90 2;  4MON A;  3JAM f;  4A3C I;  3CCE Z;  1K83 I;  4E2Y A;  3D2L A;  3CCL Z;  3S1M I;  2LEX A;  1Q7Y 2;  3HOX I;  1M1K 1;  3CCR Z;  5IP9 I;  1X0T A;  1VQ6 1;  1NUI A;  1WZN A;  1Q81 1;  5D1O A;  2OTL 1;  3EED A;  2VUM I;  2O53 A;  4A3L I;  3CCS Z;  3OW2 Z;  1QVF Y;  3CCM 1;  2OTJ Z;  1SIW A;  4BY1 I;  3CCV 1;  2AYD A;  3IX0 A;  3RZD I;  1K9M 2;  4AYB A;  3NH4 A;  3S1N I;  2RPR A;  3G4S Z;  5CM2 M;  1ZH1 A;  1Z03 A;  2O4H A;  1YJ9 1;  2JA8 I;  1VQM 1;  1KD1 2;  1QF8 A;  4NBE A;  3PO2 I;  2V8J A;  5D1P A;  3CCM Z;  2GU2 A;  2IZ3 A;  3CCV Z;  4RV9 A;  3S16 I;  1Q86 2;  3FKI I;  1QYP A;  1K8A 2;  3S14 I;  3I55 Z;  4RS4 A;  3S17 I;  2JMO A;  1VQM Z;  4A3F I;  3CMA 1;  1Y8C A;  3I56 1;  5A2Q f;  1TWG I;  4E31 A;  5T64 A;  3G71 1;  3GTL I;  2W03 A;  2JR6 A;  2HF1 A;  3GTP I;  3GTM I;  3NH5 A;  2KPI A;  1N2F A;  2Q51 A;  1VQ5 1;  3NDI A;  2DE6 A;  2WAQ A;  4DQY B;  2JIP A;  2M48 A;  1VQN 1;  1QXF A;  1VQP 1;  1YIJ 1;  5FLX b;  3CC2 1;  3TE5 B;  4HH4 A;  3T4N B;  4NH1 C;  3CCJ 1;  4QTT A;  2KI7 B;  3VB9 A;  3J81 f;  3CQZ I;  2E2J I;  2DE5 A;  4Y7N I;  3CC4 1;  3CPW Y;  3IF8 A;  2M6N A;  2V45 A;  3HOU I;  2OOX B;  2QA4 Z;  4DGL A;  2R6M A;  2IZ4 A;  2E2I I;  2JA5 I;  2EGT A;  1I3Q I;  3CXC Y;  4E2Z A;  1VQ7 1;  3GCF A;  2V8I A;  3VMI A;  2Q4Z A;  2H85 A;  1YIT 1;  3I4N I;  1N8R 2;  2P28 A;  2VPZ A;  2QR1 B;  1ZB8 A;  3J7A 4;  2Y0S A;  4NFR A;  1W2B Y;  3MZK B;  4RVG A;  4NOZ A;  1QVF Z;  1Y1V S;  2I3C A;  3TDH B;  3HOY I;  1Y1W I;  3LUS A;  2QRC B;  4MD8 A;  5C44 I;  1YHQ 1;  1JJ2 Y;  4XX2 A;  4EWC A;  2JIQ A;  4QTU A;  4E30 A;  5IT9 f;  2JIO A;  4A3G I;  2HU9 A;  2OOY B;  1TFI A;  4NBB A;  4NBC A;  3JAM b;  3GTG I;  1I50 I;  3PO3 S;  3MZL B;  3CC7 1;  1VQ6 Z;  1YJN 1;  3NDJ A;  2R7Z I;  2YAD A;  1KC8 2;  4E2X A;  2OTL Z;  3J80 f;  1Q82 2;  1VQ9 1;  2NVT I;  3KIF A;  4NB9 A;  1RO2 A;  2R92 I;  1VQ8 1;  3HOV I;  5LL6 f;  1K73 1;  3CC7 Z;  1YJN Z;  2G2K A;  4NBF A;  1X3W A;  1M1K 2;  3GTQ I;  3CD6 1;  1VQ9 Z;  3I07 A;  2NVY I;  1YJ9 Z;  4HGZ A;  1WW9 A;  3EER A;  1SFO I;  1Q81 2;  2JA6 I;  4A3K I;  3CME 1;  1YUK A;  1WCM I;  1VLA A;  3CCU 1;  3Q87 A;  4MXU A;  3CD6 Z;  3IR7 A;  2JS4 A;  3CPW Z;  3CMA Z;  2RT9 A;  1FDI A;  3VMH A;  2R93 I;  3I56 Z;  1YI2 1;  1RLY A;  1TWC I;  2WB1 A;  3G71 Z;  2JA7 I;  5AN9 F;  1WJ2 A;  2K5R A;  3CCU Z;  1N8R 1;  5A2Q b;  3CXC Z;  1VQ4 1;  1S7M A;  2VPW A;  1M90 1;  1VQ5 Z;  1YJW 1;  1FDO A;  2ZAE B;  4RVD A;  4A3I I;  1VQN Z;  1VQP Z;  1YIJ Z;  3D9X A;  5C4X I;  3GTK I;  3FQM A;  2V3V A;  2JIM A;  3CC2 Z;  4NBD A;  1VQO 1;  2AKL A;  1Q7Y 1;  2QLV B;  3VMG A;  2QEX 1;  4A3D I;  3CCJ Z;  4NBG A;  1RO4 A;  1VQK 1;  1W2B Z;  2RBL A;  3CC4 Z;  2JNY A;  1WII A;  1NJI 2;  3J81 b;  1QVG Z;  1S72 1;  3RZO I;  2J6A A;  3GTO I;  2QRD B;  3S15 I;  1VQO Z;  1JJ2 Z;  2QEX Z;  1I6H I;  3D6W A;  1K9M 1;  3QWU A;  4MD7 A;  3CCE 1;  1R9T I;  4BY7 I;  3GTJ I;  3K7A I;  1VQ7 Z;  3H3V J;  4E2W A;  1RQF A;  1QVG Y;  3CCR 1;  1YIT Z;  5T67 A;  1JWH C;  1Q82 1;  1USP B;  2B63 I;  1S72 Z;  1KD1 1;  2E9H A;  3S1R I;  1TWH I;  1Q16 A;  4MH4 A;  3CCQ 1;  2NVQ I;  5FLM I;  1Q86 1;  3CCS 1;  4S1T A;  1K8A 1;  4MRI A;  1KQS Y;  4E33 A;  1YUA A;  3M4O I;  2OTJ 1;  4X6A I;  1YHQ Z;  3I4M I;  1VQL 1;  1RNI A;  2NAP A;  3BG1 B;  4NB8 A;  3F3P C;  2YU9 I;  4A93 I;  4Y52 I;  3G4S 1;  5C3E I;  2PM9 A;  1P9N A; 
#chains in the Genus database with same CATH homology
 3CCQ Z;  5T6B A;  2W04 A;  2V8K A;  5IT9 b;  4CL1 A;  3S1Q I;  4BXX I;  1VQL Z;  2NVX I;  1TWA I;  3I55 1;  2RHB A;  3OW2 Y;  2PMZ A;  3H0G I;  3MON A;  3HOW I;  3U50 C;  3J80 b;  1VQ8 Z;  4DK1 A;  1USP A;  2DE7 A;  4E32 A;  2BJO A;  2P3Y A;  5IP7 I;  1LQL A;  3HOZ I;  1X3Z A;  4HGY A;  5FLX f;  2F4O A;  2LIY A;  4NBH A;  4TNU A;  2PK7 A;  4RVF A;  2E2H I;  3IFU A;  3NFZ A;  2VF1 A;  4BBR I;  3CME Z;  4A3M I;  4A3B I;  1NJI 1;  4BBS I;  3FQQ A;  3S2D I;  2OZK A;  3P5J B;  4MD9 A;  1K73 2;  1Z02 A;  3KIH A;  2QKD A;  3S2H I;  5C4J I;  3G6E 1;  2QA4 1;  3HKZ A;  2K3R A;  1Y1V I;  1NP6 A;  1YI2 Z;  2GTI A;  2JUB A;  3VTN A;  5D1O B;  1TWF I;  1VQ4 Z;  2LFU A;  1L1O C;  1YJW Z;  1ZB9 A;  3F3F C;  1RO0 A;  1DL6 A;  4NBA A;  1Z01 A;  3GTM S;  3G6E Z;  4RVH A;  4A3J I;  2F4M A;  2GTH A;  3PO3 I;  3GKQ A;  3M3Y I;  3NH8 A;  4A3E I;  1VQK Z;  1KRL A;  1PFT A;  2QRE B;  3CCL 1;  1KC8 1;  3BG0 B;  2RIQ A;  1ML8 A;  3ESW A;  1KQS Z;  2VUG A;  1M90 2;  4MON A;  3JAM f;  4A3C I;  3CCE Z;  1K83 I;  4E2Y A;  3CCL Z;  3S1M I;  1Q7Y 2;  3HOX I;  1M1K 1;  3CCR Z;  5IP9 I;  1X0T A;  1VQ6 1;  1NUI A;  1Q81 1;  5D1O A;  2OTL 1;  3EED A;  2VUM I;  2O53 A;  4A3L I;  3CCS Z;  3OW2 Z;  1QVF Y;  3CCM 1;  2OTJ Z;  4BY1 I;  3CCV 1;  3IX0 A;  3RZD I;  1K9M 2;  4AYB A;  3NH4 A;  3S1N I;  2RPR A;  3G4S Z;  5CM2 M;  1ZH1 A;  1Z03 A;  2O4H A;  1YJ9 1;  2JA8 I;  1VQM 1;  1KD1 2;  1QF8 A;  4NBE A;  3PO2 I;  2V8J A;  5D1P A;  3CCM Z;  2GU2 A;  2IZ3 A;  3CCV Z;  4RV9 A;  3S16 I;  1Q86 2;  3FKI I;  1QYP A;  1K8A 2;  3S14 I;  3I55 Z;  4RS4 A;  3S17 I;  2JMO A;  1VQM Z;  4A3F I;  3CMA 1;  3I56 1;  5A2Q f;  1TWG I;  4E31 A;  5T64 A;  3G71 1;  3GTL I;  2W03 A;  2JR6 A;  2HF1 A;  3GTP I;  3GTM I;  3NH5 A;  2KPI A;  1N2F A;  2Q51 A;  1VQ5 1;  3NDI A;  2DE6 A;  2WAQ A;  4DQY B;  2M48 A;  1VQN 1;  1VQP 1;  1YIJ 1;  5FLX b;  3CC2 1;  3TE5 B;  4HH4 A;  3T4N B;  4NH1 C;  3CCJ 1;  4QTT A;  2KI7 B;  3VB9 A;  3J81 f;  3CQZ I;  2E2J I;  2DE5 A;  4Y7N I;  3CC4 1;  3CPW Y;  3IF8 A;  2M6N A;  3HOU I;  2OOX B;  2QA4 Z;  4DGL A;  2R6M A;  2IZ4 A;  2E2I I;  2JA5 I;  2EGT A;  1I3Q I;  3CXC Y;  4E2Z A;  1VQ7 1;  3GCF A;  2V8I A;  3VMI A;  2Q4Z A;  2H85 A;  1YIT 1;  3I4N I;  1N8R 2;  2P28 A;  2QR1 B;  1ZB8 A;  3J7A 4;  2Y0S A;  4NFR A;  1W2B Y;  3MZK B;  4RVG A;  4NOZ A;  1QVF Z;  1Y1V S;  2I3C A;  3TDH B;  3HOY I;  1Y1W I;  3LUS A;  2QRC B;  4MD8 A;  5C44 I;  1YHQ 1;  1JJ2 Y;  4XX2 A;  4EWC A;  4QTU A;  4E30 A;  5IT9 f;  4A3G I;  2HU9 A;  2OOY B;  1TFI A;  4NBB A;  4NBC A;  3JAM b;  3GTG I;  1I50 I;  3PO3 S;  3MZL B;  3CC7 1;  1VQ6 Z;  1YJN 1;  3NDJ A;  2R7Z I;  2YAD A;  1KC8 2;  4E2X A;  2OTL Z;  3J80 f;  1Q82 2;  1VQ9 1;  2NVT I;  3KIF A;  4NB9 A;  1RO2 A;  2R92 I;  1VQ8 1;  3HOV I;  5LL6 f;  1K73 1;  3CC7 Z;  1YJN Z;  2G2K A;  4NBF A;  1X3W A;  1M1K 2;  3GTQ I;  3CD6 1;  1VQ9 Z;  3I07 A;  2NVY I;  1YJ9 Z;  4HGZ A;  1WW9 A;  3EER A;  1SFO I;  1Q81 2;  2JA6 I;  4A3K I;  3CME 1;  1YUK A;  1WCM I;  1VLA A;  3CCU 1;  3Q87 A;  4MXU A;  3CD6 Z;  2JS4 A;  3CPW Z;  3CMA Z;  2RT9 A;  3VMH A;  2R93 I;  3I56 Z;  1YI2 1;  1RLY A;  1TWC I;  2WB1 A;  3G71 Z;  2JA7 I;  5AN9 F;  2K5R A;  3CCU Z;  1N8R 1;  5A2Q b;  3CXC Z;  1VQ4 1;  1S7M A;  1M90 1;  1VQ5 Z;  1YJW 1;  2ZAE B;  4RVD A;  4A3I I;  1VQN Z;  1VQP Z;  1YIJ Z;  3D9X A;  5C4X I;  3GTK I;  3FQM A;  3CC2 Z;  4NBD A;  1VQO 1;  2AKL A;  1Q7Y 1;  2QLV B;  3VMG A;  2QEX 1;  4A3D I;  3CCJ Z;  4NBG A;  1RO4 A;  1VQK 1;  1W2B Z;  2RBL A;  3CC4 Z;  2JNY A;  1WII A;  1NJI 2;  3J81 b;  1QVG Z;  1S72 1;  3RZO I;  2J6A A;  3GTO I;  2QRD B;  3S15 I;  1VQO Z;  1JJ2 Z;  2QEX Z;  1I6H I;  3D6W A;  1K9M 1;  3QWU A;  4MD7 A;  3CCE 1;  1R9T I;  4BY7 I;  3GTJ I;  3K7A I;  1VQ7 Z;  3H3V J;  4E2W A;  1RQF A;  1QVG Y;  3CCR 1;  1YIT Z;  5T67 A;  1JWH C;  1Q82 1;  1USP B;  2B63 I;  1S72 Z;  1KD1 1;  2E9H A;  3S1R I;  1TWH I;  4MH4 A;  3CCQ 1;  2NVQ I;  5FLM I;  1Q86 1;  3CCS 1;  4S1T A;  1K8A 1;  4MRI A;  1KQS Y;  4E33 A;  1YUA A;  3M4O I;  2OTJ 1;  4X6A I;  1YHQ Z;  3I4M I;  1VQL 1;  1RNI A;  3BG1 B;  4NB8 A;  3F3P C;  2YU9 I;  4A93 I;  4Y52 I;  3G4S 1;  5C3E I;  2PM9 A;  1P9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...