2K5RA

Solution nmr structure of xf2673 from xylella fastidiosa. northeast structural genomics consortium target xfr39
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
b'MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIATIQIANFPDKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein XF2673
publication title Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39
rcsb
source organism Xylella fastidiosa temecula1
molecule tags Structural genomics, unknown function
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k5rA01
3S1QI 2DE7A 2JA5I 1YUAA 3CQZI 5CM2M 2JA7I 1QYPA 2NVYI 1ZB9A 3RZOI 4Y7NI 5C3EI 1R9TI 4QTUA 1ML8A 1RLYA 3HOXI 4A3CI 4A3BI 2R7ZI 4A3MI 3VB9A 1PFTA 1X3WA 1TWFI 3S1NI 3M4OI 1Y1VI 3H3VJ 3S17I 4NBCA 3GTOI 5C4XI 4A3JI 1Y1VS 3PO3S 4A3DI 3FKII 3S16I 2NVXI 3GKQA 1TWGI 3GCFA 2R92I 4BXXI 1LQLA 2JR6A 5C4JI 2E2HI 2J6AA 3S2HI 3S14I 3GTLI 4BBRI 1VLAA 3LUSA 5IP9I 2YU9I 4A3II 4NBAA 3GTPI 2HF1A 3HOUI 5FLMI 3HOWI 3VMIA 1I6HI 4BY1I 2NVTI 5IP7I 3I07A 1WW9A 2AKLA 2DE5A 2VUMI 3GTKI 3GTMI 1K83I 1SFOI 3S1MI 2JA6I 3S2DI 3H0GI 1NUIA 3ESWA 1Y1WI 4A3FI 2KPIA 4A93I 2RBLA 3S1RI 3M3YI 1WCMI 3Q87A 3RZDI 1TWAI 4NBEA 2BJOA 1RO4A 3GTQI 5C44I 3HOYI 2F4OA 2JS4A 2DE6A 4MH4A 1TFIA 4BBSI 3I4MI 1TWCI 1N2FA 4QTTA 3D6WA 3GTGI 4X6AI 4NBHA 3U50C 4NB9A 3HOZI 3I4NI 1L1OC 2B63I 3GTMS 4NBGA 3HOVI 4XX2A 4A3GI 1USPB 1ZB8A 2F4MA 2E2II 2JA8I 1TWHI 2PK7A 4A3EI 1USPA 4A3KI 1X3ZA 4NOZA 2E2JI 1I3QI 2JNYA 3S15I 2P3YA 3EERA 4NBBA 2R93I 1DL6A 2NVQI 4NB8A 4A3LI 3PO2I 3VMGA 4NBFA 4NBDA 3VMHA 3PO3I 4Y52I 3GTJI 3K7AI 2K5RA 1I50I 4BY7I
chains in the Genus database with same CATH superfamily
2QA41 1Y8CA 5CM2M 1VQK1 2JA7I 3MZLB 4Y7NI 4MD7A 4QTUA 5D1OB 3HOXI 2RIQA 1K8A1 1W2BY 3I551 1YJN1 5T64A 2QEXZ 1FDIA 3IR7A 1TWGI 1Q7Y1 3CC2Z 2QR1B 4NFRA 3S2HI 3S14I 2G2KA 1VLAA 1VQ7Z 5IP9I 3HOWI 3GTPI 5FLMI 3J7A4 2W03A 2QRDB 1I6HI 2RHBA 2QA4Z 4BY1I 2DE5A 1VQKZ 3GTKI 1K83I 4E2WA 2JA6I 3H0GI 1NUIA 1Z01A 1YIJ1 4AYBA 2V8JA 1WCMI 1TWAI 3I55Z 4HGZA 5T6BA 1YJNZ 2JIRA 5C44I 2M6NA 5FLXf 2JUBA 2LEXA 2NAPA 3TDHB 3CCR1 3J81b 1JJ2Y 1RO2A 3D6WA 4DGLA 1Q821 1X0TA 2V3VA 3I561 3JAMb 2VUGA 3I4NI 1S72Z 1QVFZ 3GTMS 4RVHA 2ZAEB 1USPB 5A2Qf 2F4MA 2E2II 1TWHI 1KC82 3F3PC 1YIJZ 5T67A 1M902 4A3KI 2E2JI 2JIQA 3CD61 4E30A 3EERA 3D2LA 4E31A 1DL6A 5FLXb 3VMGA 2OTL1 3G4S1 2R6MA 2OZKA 2H85A 2IZ4A 1VQ61 3EEDA 1QVFY 3CCRZ 4RVFA 1QF8A 4BY7I 4E32A 3G711 2LIYA 2JA5I 3MZKB 3CQZI 3MONA 2HU9A 3I56Z 1NJI2 1YJ91 3QWUA 3KIHA 5C3EI 2KI7B 4A3CI 4MXUA 1Q812 4A3BI 1P9NA 1VQLZ 3VB9A 1TWFI 3S1NI 3IX0A 2O53A 3IF8A 1VQ41 2QLVB 4NBCA 3CD6Z 5C4XI 2OOXB 3PO3S 3GKQA 2GU2A 3NH5A 2IZ3A 3GCFA 4MONA 4E2XA 1SIWA 1K731 2OTLZ 2VPYA 1N8R1 2JR6A 1FDOA 3CCL1 2E2HI 2OTJ1 3GTLI 1VQ6Z 4BBRI 1VQ91 4NBAA 3G71Z 1Q862 2V45A 3FQQA 2EGTA 1YJ9Z 3CMA1 2GTIA 3S1MI 3ESWA 4A93I 2RBLA 2AYDA 5D1PA 2JIPA 3S1RI 5IT9f 3CCQ1 2BJOA 2Q4ZA 1RO4A 1VQ4Z 3GTQI 1VQ81 2QRCB 1K9M1 3HOYI 3J81f 4E33A 3IFUA 4MH4A 1TFIA 2RPRA 3I4MI 1TWCI 2M48A 4TNUA 3JAMf 1JJ2Z 1WJ2A 2GTHA 1WIIA 1YIT1 2OTJZ 4EWCA 4S1TA 2B63I 3CCJ1 2QKDA 3CCE1 2PM9A 3CMAZ 2JA8I 2E7ZA 2OOYB 1M1K2 5IT9b 4A3EI 1X3ZA 1I3QI 3CXCZ 3CCU1 3CCQZ 3NDJA 2JIMA 3BG0B 1KQSZ 3PO2I 4RV9A 1VQ8Z 4NBDA 3VMHA 4Y52I 1VQ51 3GTJI 2K5RA 3F3FC 1WZNA 1I50I 2DE7A 1YITZ 2WAQA 2NVYI 1ZB9A 1K8A2 3RZOI 1Z03A 3VTNA 1R9TI 3CCJZ 1ML8A 1RLYA 3CXCY 3CCEZ 1VQN1 2R7ZI 3FQMA 1KQSY 4A3MI 1PFTA 3M4OI 1Q7Y2 1YUKA 2WB1A 1ZH1A 3CCUZ 4A3JI 4A3DI 2NVXI 4NH1C 1VQ5Z 2VF1A 4BXXI 2J6AA 2K3RA 1NP6A 2YU9I 4A3II 2HF1A 2VPWA 2AKLA 2VUMI 4HGYA 3S2DI 2Q51A 2KPIA 1VQNZ 3CCM1 1S7MA 3Q87A 2JIOA 3J80b 4E2YA 1RQFA 2QEX1 3NH4A 3G4SZ 2F4OA 4MD8A 4DK1A 1Q822 2PMZA 4BBSI 2LFUA 1N2FA 2W04A 3GTGI 2VPXA 4X6AI 4RVDA 4NB9A 3HOZI 1RO0A 4RS4A 4A3GI 5LL6f 2YADA 1VQO1 3CCS1 1RNIA 3KIFA 3CCMZ 4CL1A 2P3YA 4NBBA 2IV2X 2NVQI 4NB8A 4HH4A 1KC81 1M901 3CCLZ 2JMOA 2RT9A 3OW2Z 3K7AI 1VQM1 1VQ9Z 4DQYB 3NFZA 1KD12 3P5JB 3S1QI 1YUAA 4MRIA 3TE5B 1QYPA 3CC41 3CPWZ 4E2ZA 4MD9A 1S721 2Y0SA 1YI21 1VQP1 1NJI1 1VQOZ 3CCSZ 1X3WA 1Q16A 3NH8A 5D1OA 1QVGZ 1Y1VI 3H3VJ 1K732 3S17I 3GTOI 3OW2Y 1Q811 3CC71 1N8R2 2VPZA 1Y1VS 3FKII 3S16I 5AN9F 3G6E1 2R92I 2QREB 1LQLA 3CME1 5C4JI 1VQMZ 3CPWY 3LUSA 3HOUI 3VMIA 2NVTI 5IP7I 3I07A 1WW9A 2V8KA 3BG1B 1QVGY 3CC4Z 3GTMI 1SFOI 3CCV1 1Y1WI 4A3FI 1YI2Z 3J80f 1VQPZ 1Q861 3M3YI 1K9M2 2O4HA 3NDIA 3RZDI 2E9HA 3HKZA 1VQL1 4NBEA 3D9XA 3CC7Z 2I3CA 2JS4A 2DE6A 1YJW1 1YHQ1 3G6EZ 3T4NB 4RVGA 3CMEZ 4QTTA 4NBHA 3U50C 1L1OC 4NBGA 1Z02A 3HOVI 4XX2A 1JWHC 1ZB8A 3CCVZ 1KD11 2PK7A 5A2Qb 1USPA 2V8IA 4NOZA 2JNYA 3S15I 1AA6A 2R93I 4A3LI 2P28A 1M1K1 1W2BZ 3CC21 4NBFA 3PO3I 1YJWZ 1YHQZ 1QXFA 1VQ71 1KRLA
chains in the Genus database with same CATH topology
2QA41 5CM2M 1VQK1 2JA7I 3MZLB 4Y7NI 4MD7A 4QTUA 5D1OB 3HOXI 2RIQA 1K8A1 1W2BY 3I551 1YJN1 5T64A 2QEXZ 1TWGI 1Q7Y1 3CC2Z 2QR1B 4NFRA 3S2HI 3S14I 2G2KA 1VLAA 1VQ7Z 5IP9I 3HOWI 3GTPI 5FLMI 3J7A4 2W03A 2QRDB 1I6HI 2RHBA 2QA4Z 4BY1I 2DE5A 1VQKZ 3GTKI 1K83I 4E2WA 2JA6I 3H0GI 1NUIA 1Z01A 1YIJ1 4AYBA 2V8JA 1WCMI 1TWAI 3I55Z 4HGZA 5T6BA 1YJNZ 5C44I 2M6NA 5FLXf 2JUBA 3TDHB 3CCR1 3J81b 1JJ2Y 1RO2A 3D6WA 4DGLA 1Q821 1X0TA 3I561 3JAMb 2VUGA 3I4NI 1S72Z 1QVFZ 3GTMS 4RVHA 2ZAEB 1USPB 5A2Qf 2F4MA 2E2II 1TWHI 1KC82 3F3PC 1YIJZ 5T67A 1M902 4A3KI 2E2JI 3CD61 4E30A 3EERA 4E31A 1DL6A 5FLXb 3VMGA 2OTL1 3G4S1 2R6MA 2OZKA 2H85A 2IZ4A 1VQ61 3EEDA 1QVFY 3CCRZ 4RVFA 1QF8A 4BY7I 4E32A 3G711 2LIYA 2JA5I 3MZKB 3CQZI 3MONA 2HU9A 3I56Z 1NJI2 1YJ91 3QWUA 3KIHA 5C3EI 2KI7B 4A3CI 4MXUA 1Q812 4A3BI 1P9NA 1VQLZ 3VB9A 1TWFI 3S1NI 3IX0A 2O53A 3IF8A 1VQ41 2QLVB 4NBCA 3CD6Z 5C4XI 2OOXB 3PO3S 3GKQA 2GU2A 3NH5A 2IZ3A 3GCFA 4MONA 4E2XA 1K731 2OTLZ 1N8R1 2JR6A 3CCL1 2E2HI 2OTJ1 3GTLI 1VQ6Z 4BBRI 1VQ91 4NBAA 3G71Z 1Q862 3FQQA 2EGTA 1YJ9Z 3CMA1 2GTIA 3S1MI 3ESWA 4A93I 2RBLA 5D1PA 3S1RI 5IT9f 3CCQ1 2BJOA 2Q4ZA 1RO4A 1VQ4Z 3GTQI 1VQ81 2QRCB 1K9M1 3HOYI 3J81f 4E33A 3IFUA 4MH4A 1TFIA 2RPRA 3I4MI 1TWCI 2M48A 4TNUA 3JAMf 1JJ2Z 2GTHA 1WIIA 1YIT1 2OTJZ 4EWCA 4S1TA 2B63I 3CCJ1 2QKDA 3CCE1 2PM9A 3CMAZ 2JA8I 2OOYB 1M1K2 5IT9b 4A3EI 1X3ZA 1I3QI 3CXCZ 3CCU1 3CCQZ 3NDJA 3BG0B 1KQSZ 3PO2I 4RV9A 1VQ8Z 4NBDA 3VMHA 4Y52I 1VQ51 3GTJI 2K5RA 3F3FC 1I50I 2DE7A 1YITZ 2WAQA 2NVYI 1ZB9A 1K8A2 3RZOI 1Z03A 3VTNA 1R9TI 3CCJZ 1ML8A 1RLYA 3CXCY 3CCEZ 1VQN1 2R7ZI 3FQMA 1KQSY 4A3MI 1PFTA 3M4OI 1Q7Y2 1YUKA 2WB1A 1ZH1A 3CCUZ 4A3JI 4A3DI 2NVXI 4NH1C 1VQ5Z 2VF1A 4BXXI 2J6AA 2K3RA 1NP6A 2YU9I 4A3II 2HF1A 2AKLA 2VUMI 4HGYA 3S2DI 2Q51A 2KPIA 1VQNZ 3CCM1 1S7MA 3Q87A 3J80b 4E2YA 1RQFA 2QEX1 3NH4A 3G4SZ 2F4OA 4MD8A 4DK1A 1Q822 2PMZA 4BBSI 2LFUA 1N2FA 2W04A 3GTGI 4X6AI 4RVDA 4NB9A 3HOZI 1RO0A 4RS4A 4A3GI 5LL6f 2YADA 1VQO1 3CCS1 1RNIA 3KIFA 3CCMZ 4CL1A 2P3YA 4NBBA 2NVQI 4NB8A 4HH4A 1KC81 1M901 3CCLZ 2JMOA 2RT9A 3OW2Z 3K7AI 1VQM1 1VQ9Z 4DQYB 3NFZA 1KD12 3P5JB 3S1QI 1YUAA 4MRIA 3TE5B 1QYPA 3CC41 3CPWZ 4E2ZA 4MD9A 1S721 2Y0SA 1YI21 1VQP1 1NJI1 1VQOZ 3CCSZ 1X3WA 3NH8A 5D1OA 1QVGZ 1Y1VI 3H3VJ 1K732 3S17I 3GTOI 3OW2Y 1Q811 3CC71 1N8R2 1Y1VS 3FKII 3S16I 5AN9F 3G6E1 2R92I 2QREB 1LQLA 3CME1 5C4JI 1VQMZ 3CPWY 3LUSA 3HOUI 3VMIA 2NVTI 5IP7I 3I07A 1WW9A 2V8KA 3BG1B 1QVGY 3CC4Z 3GTMI 1SFOI 3CCV1 1Y1WI 4A3FI 1YI2Z 3J80f 1VQPZ 1Q861 3M3YI 1K9M2 2O4HA 3NDIA 3RZDI 2E9HA 3HKZA 1VQL1 4NBEA 3D9XA 3CC7Z 2I3CA 2JS4A 2DE6A 1YJW1 1YHQ1 3G6EZ 3T4NB 4RVGA 3CMEZ 4QTTA 4NBHA 3U50C 1L1OC 4NBGA 1Z02A 3HOVI 4XX2A 1JWHC 1ZB8A 3CCVZ 1KD11 2PK7A 5A2Qb 1USPA 2V8IA 4NOZA 2JNYA 3S15I 2R93I 4A3LI 2P28A 1M1K1 1W2BZ 3CC21 4NBFA 3PO3I 1YJWZ 1YHQZ 1VQ71 1KRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q I;  2DE7 A;  2JA5 I;  1YUA A;  3CQZ I;  5CM2 M;  2JA7 I;  1QYP A;  2NVY I;  1ZB9 A;  3RZO I;  4Y7N I;  5C3E I;  1R9T I;  4QTU A;  1ML8 A;  1RLY A;  3HOX I;  4A3C I;  4A3B I;  2R7Z I;  4A3M I;  3VB9 A;  1PFT A;  1X3W A;  1TWF I;  3S1N I;  3M4O I;  1Y1V I;  3H3V J;  3S17 I;  4NBC A;  3GTO I;  5C4X I;  4A3J I;  1Y1V S;  3PO3 S;  4A3D I;  3FKI I;  3S16 I;  2NVX I;  3GKQ A;  1TWG I;  3GCF A;  2R92 I;  4BXX I;  1LQL A;  2JR6 A;  5C4J I;  2E2H I;  2J6A A;  3S2H I;  3S14 I;  3GTL I;  4BBR I;  1VLA A;  3LUS A;  5IP9 I;  2YU9 I;  4A3I I;  4NBA A;  3GTP I;  2HF1 A;  3HOU I;  5FLM I;  3HOW I;  3VMI A;  1I6H I;  4BY1 I;  2NVT I;  5IP7 I;  3I07 A;  1WW9 A;  2AKL A;  2DE5 A;  2VUM I;  3GTK I;  3GTM I;  1K83 I;  1SFO I;  3S1M I;  2JA6 I;  3S2D I;  3H0G I;  1NUI A;  3ESW A;  1Y1W I;  4A3F I;  2KPI A;  4A93 I;  2RBL A;  3S1R I;  3M3Y I;  1WCM I;  3Q87 A;  3RZD I;  1TWA I;  4NBE A;  2BJO A;  1RO4 A;  3GTQ I;  5C44 I;  3HOY I;  2F4O A;  2JS4 A;  2DE6 A;  4MH4 A;  1TFI A;  4BBS I;  3I4M I;  1TWC I;  1N2F A;  4QTT A;  3D6W A;  3GTG I;  4X6A I;  4NBH A;  3U50 C;  4NB9 A;  3HOZ I;  3I4N I;  1L1O C;  2B63 I;  3GTM S;  4NBG A;  3HOV I;  4XX2 A;  4A3G I;  1USP B;  1ZB8 A;  2F4M A;  2E2I I;  2JA8 I;  1TWH I;  2PK7 A;  4A3E I;  1USP A;  4A3K I;  1X3Z A;  4NOZ A;  2E2J I;  1I3Q I;  2JNY A;  3S15 I;  2P3Y A;  3EER A;  4NBB A;  2R93 I;  1DL6 A;  2NVQ I;  4NB8 A;  4A3L I;  3PO2 I;  3VMG A;  4NBF A;  4NBD A;  3VMH A;  3PO3 I;  4Y52 I;  3GTJ I;  3K7A I;  2K5R A;  1I50 I;  4BY7 I; 
#chains in the Genus database with same CATH topology
 2QA4 1;  1Y8C A;  5CM2 M;  1VQK 1;  2JA7 I;  3MZL B;  4Y7N I;  4MD7 A;  4QTU A;  5D1O B;  3HOX I;  2RIQ A;  1K8A 1;  1W2B Y;  3I55 1;  1YJN 1;  5T64 A;  2QEX Z;  1FDI A;  3IR7 A;  1TWG I;  1Q7Y 1;  3CC2 Z;  2QR1 B;  4NFR A;  3S2H I;  3S14 I;  2G2K A;  1VLA A;  1VQ7 Z;  5IP9 I;  3HOW I;  3GTP I;  5FLM I;  3J7A 4;  2W03 A;  2QRD B;  1I6H I;  2RHB A;  2QA4 Z;  4BY1 I;  2DE5 A;  1VQK Z;  3GTK I;  1K83 I;  4E2W A;  2JA6 I;  3H0G I;  1NUI A;  1Z01 A;  1YIJ 1;  4AYB A;  2V8J A;  1WCM I;  1TWA I;  3I55 Z;  4HGZ A;  5T6B A;  1YJN Z;  2JIR A;  5C44 I;  2M6N A;  5FLX f;  2JUB A;  2LEX A;  2NAP A;  3TDH B;  3CCR 1;  3J81 b;  1JJ2 Y;  1RO2 A;  3D6W A;  4DGL A;  1Q82 1;  1X0T A;  2V3V A;  3I56 1;  3JAM b;  2VUG A;  3I4N I;  1S72 Z;  1QVF Z;  3GTM S;  4RVH A;  2ZAE B;  1USP B;  5A2Q f;  2F4M A;  2E2I I;  1TWH I;  1KC8 2;  3F3P C;  1YIJ Z;  5T67 A;  1M90 2;  4A3K I;  2E2J I;  2JIQ A;  3CD6 1;  4E30 A;  3EER A;  3D2L A;  4E31 A;  1DL6 A;  5FLX b;  3VMG A;  2OTL 1;  3G4S 1;  2R6M A;  2OZK A;  2H85 A;  2IZ4 A;  1VQ6 1;  3EED A;  1QVF Y;  3CCR Z;  4RVF A;  1QF8 A;  4BY7 I;  4E32 A;  3G71 1;  2LIY A;  2JA5 I;  3MZK B;  3CQZ I;  3MON A;  2HU9 A;  3I56 Z;  1NJI 2;  1YJ9 1;  3QWU A;  3KIH A;  5C3E I;  2KI7 B;  4A3C I;  4MXU A;  1Q81 2;  4A3B I;  1P9N A;  1VQL Z;  3VB9 A;  1TWF I;  3S1N I;  3IX0 A;  2O53 A;  3IF8 A;  1VQ4 1;  2QLV B;  4NBC A;  3CD6 Z;  5C4X I;  2OOX B;  3PO3 S;  3GKQ A;  2GU2 A;  3NH5 A;  2IZ3 A;  3GCF A;  4MON A;  4E2X A;  1SIW A;  1K73 1;  2OTL Z;  2VPY A;  1N8R 1;  2JR6 A;  1FDO A;  3CCL 1;  2E2H I;  2OTJ 1;  3GTL I;  1VQ6 Z;  4BBR I;  1VQ9 1;  4NBA A;  3G71 Z;  1Q86 2;  2V45 A;  3FQQ A;  2EGT A;  1YJ9 Z;  3CMA 1;  2GTI A;  3S1M I;  3ESW A;  4A93 I;  2RBL A;  2AYD A;  5D1P A;  2JIP A;  3S1R I;  5IT9 f;  3CCQ 1;  2BJO A;  2Q4Z A;  1RO4 A;  1VQ4 Z;  3GTQ I;  1VQ8 1;  2QRC B;  1K9M 1;  3HOY I;  3J81 f;  4E33 A;  3IFU A;  4MH4 A;  1TFI A;  2RPR A;  3I4M I;  1TWC I;  2M48 A;  4TNU A;  3JAM f;  1JJ2 Z;  1WJ2 A;  2GTH A;  1WII A;  1YIT 1;  2OTJ Z;  4EWC A;  4S1T A;  2B63 I;  3CCJ 1;  2QKD A;  3CCE 1;  2PM9 A;  3CMA Z;  2JA8 I;  2E7Z A;  2OOY B;  1M1K 2;  5IT9 b;  4A3E I;  1X3Z A;  1I3Q I;  3CXC Z;  3CCU 1;  3CCQ Z;  3NDJ A;  2JIM A;  3BG0 B;  1KQS Z;  3PO2 I;  4RV9 A;  1VQ8 Z;  4NBD A;  3VMH A;  4Y52 I;  1VQ5 1;  3GTJ I;  2K5R A;  3F3F C;  1WZN A;  1I50 I;  2DE7 A;  1YIT Z;  2WAQ A;  2NVY I;  1ZB9 A;  1K8A 2;  3RZO I;  1Z03 A;  3VTN A;  1R9T I;  3CCJ Z;  1ML8 A;  1RLY A;  3CXC Y;  3CCE Z;  1VQN 1;  2R7Z I;  3FQM A;  1KQS Y;  4A3M I;  1PFT A;  3M4O I;  1Q7Y 2;  1YUK A;  2WB1 A;  1ZH1 A;  3CCU Z;  4A3J I;  4A3D I;  2NVX I;  4NH1 C;  1VQ5 Z;  2VF1 A;  4BXX I;  2J6A A;  2K3R A;  1NP6 A;  2YU9 I;  4A3I I;  2HF1 A;  2VPW A;  2AKL A;  2VUM I;  4HGY A;  3S2D I;  2Q51 A;  2KPI A;  1VQN Z;  3CCM 1;  1S7M A;  3Q87 A;  2JIO A;  3J80 b;  4E2Y A;  1RQF A;  2QEX 1;  3NH4 A;  3G4S Z;  2F4O A;  4MD8 A;  4DK1 A;  1Q82 2;  2PMZ A;  4BBS I;  2LFU A;  1N2F A;  2W04 A;  3GTG I;  2VPX A;  4X6A I;  4RVD A;  4NB9 A;  3HOZ I;  1RO0 A;  4RS4 A;  4A3G I;  5LL6 f;  2YAD A;  1VQO 1;  3CCS 1;  1RNI A;  3KIF A;  3CCM Z;  4CL1 A;  2P3Y A;  4NBB A;  2IV2 X;  2NVQ I;  4NB8 A;  4HH4 A;  1KC8 1;  1M90 1;  3CCL Z;  2JMO A;  2RT9 A;  3OW2 Z;  3K7A I;  1VQM 1;  1VQ9 Z;  4DQY B;  3NFZ A;  1KD1 2;  3P5J B;  3S1Q I;  1YUA A;  4MRI A;  3TE5 B;  1QYP A;  3CC4 1;  3CPW Z;  4E2Z A;  4MD9 A;  1S72 1;  2Y0S A;  1YI2 1;  1VQP 1;  1NJI 1;  1VQO Z;  3CCS Z;  1X3W A;  1Q16 A;  3NH8 A;  5D1O A;  1QVG Z;  1Y1V I;  3H3V J;  1K73 2;  3S17 I;  3GTO I;  3OW2 Y;  1Q81 1;  3CC7 1;  1N8R 2;  2VPZ A;  1Y1V S;  3FKI I;  3S16 I;  5AN9 F;  3G6E 1;  2R92 I;  2QRE B;  1LQL A;  3CME 1;  5C4J I;  1VQM Z;  3CPW Y;  3LUS A;  3HOU I;  3VMI A;  2NVT I;  5IP7 I;  3I07 A;  1WW9 A;  2V8K A;  3BG1 B;  1QVG Y;  3CC4 Z;  3GTM I;  1SFO I;  3CCV 1;  1Y1W I;  4A3F I;  1YI2 Z;  3J80 f;  1VQP Z;  1Q86 1;  3M3Y I;  1K9M 2;  2O4H A;  3NDI A;  3RZD I;  2E9H A;  3HKZ A;  1VQL 1;  4NBE A;  3D9X A;  3CC7 Z;  2I3C A;  2JS4 A;  2DE6 A;  1YJW 1;  1YHQ 1;  3G6E Z;  3T4N B;  4RVG A;  3CME Z;  4QTT A;  4NBH A;  3U50 C;  1L1O C;  4NBG A;  1Z02 A;  3HOV I;  4XX2 A;  1JWH C;  1ZB8 A;  3CCV Z;  1KD1 1;  2PK7 A;  5A2Q b;  1USP A;  2V8I A;  4NOZ A;  2JNY A;  3S15 I;  1AA6 A;  2R93 I;  4A3L I;  2P28 A;  1M1K 1;  1W2B Z;  3CC2 1;  4NBF A;  3PO3 I;  1YJW Z;  1YHQ Z;  1QXF A;  1VQ7 1;  1KRL A; 
#chains in the Genus database with same CATH homology
 2QA4 1;  5CM2 M;  1VQK 1;  2JA7 I;  3MZL B;  4Y7N I;  4MD7 A;  4QTU A;  5D1O B;  3HOX I;  2RIQ A;  1K8A 1;  1W2B Y;  3I55 1;  1YJN 1;  5T64 A;  2QEX Z;  1TWG I;  1Q7Y 1;  3CC2 Z;  2QR1 B;  4NFR A;  3S2H I;  3S14 I;  2G2K A;  1VLA A;  1VQ7 Z;  5IP9 I;  3HOW I;  3GTP I;  5FLM I;  3J7A 4;  2W03 A;  2QRD B;  1I6H I;  2RHB A;  2QA4 Z;  4BY1 I;  2DE5 A;  1VQK Z;  3GTK I;  1K83 I;  4E2W A;  2JA6 I;  3H0G I;  1NUI A;  1Z01 A;  1YIJ 1;  4AYB A;  2V8J A;  1WCM I;  1TWA I;  3I55 Z;  4HGZ A;  5T6B A;  1YJN Z;  5C44 I;  2M6N A;  5FLX f;  2JUB A;  3TDH B;  3CCR 1;  3J81 b;  1JJ2 Y;  1RO2 A;  3D6W A;  4DGL A;  1Q82 1;  1X0T A;  3I56 1;  3JAM b;  2VUG A;  3I4N I;  1S72 Z;  1QVF Z;  3GTM S;  4RVH A;  2ZAE B;  1USP B;  5A2Q f;  2F4M A;  2E2I I;  1TWH I;  1KC8 2;  3F3P C;  1YIJ Z;  5T67 A;  1M90 2;  4A3K I;  2E2J I;  3CD6 1;  4E30 A;  3EER A;  4E31 A;  1DL6 A;  5FLX b;  3VMG A;  2OTL 1;  3G4S 1;  2R6M A;  2OZK A;  2H85 A;  2IZ4 A;  1VQ6 1;  3EED A;  1QVF Y;  3CCR Z;  4RVF A;  1QF8 A;  4BY7 I;  4E32 A;  3G71 1;  2LIY A;  2JA5 I;  3MZK B;  3CQZ I;  3MON A;  2HU9 A;  3I56 Z;  1NJI 2;  1YJ9 1;  3QWU A;  3KIH A;  5C3E I;  2KI7 B;  4A3C I;  4MXU A;  1Q81 2;  4A3B I;  1P9N A;  1VQL Z;  3VB9 A;  1TWF I;  3S1N I;  3IX0 A;  2O53 A;  3IF8 A;  1VQ4 1;  2QLV B;  4NBC A;  3CD6 Z;  5C4X I;  2OOX B;  3PO3 S;  3GKQ A;  2GU2 A;  3NH5 A;  2IZ3 A;  3GCF A;  4MON A;  4E2X A;  1K73 1;  2OTL Z;  1N8R 1;  2JR6 A;  3CCL 1;  2E2H I;  2OTJ 1;  3GTL I;  1VQ6 Z;  4BBR I;  1VQ9 1;  4NBA A;  3G71 Z;  1Q86 2;  3FQQ A;  2EGT A;  1YJ9 Z;  3CMA 1;  2GTI A;  3S1M I;  3ESW A;  4A93 I;  2RBL A;  5D1P A;  3S1R I;  5IT9 f;  3CCQ 1;  2BJO A;  2Q4Z A;  1RO4 A;  1VQ4 Z;  3GTQ I;  1VQ8 1;  2QRC B;  1K9M 1;  3HOY I;  3J81 f;  4E33 A;  3IFU A;  4MH4 A;  1TFI A;  2RPR A;  3I4M I;  1TWC I;  2M48 A;  4TNU A;  3JAM f;  1JJ2 Z;  2GTH A;  1WII A;  1YIT 1;  2OTJ Z;  4EWC A;  4S1T A;  2B63 I;  3CCJ 1;  2QKD A;  3CCE 1;  2PM9 A;  3CMA Z;  2JA8 I;  2OOY B;  1M1K 2;  5IT9 b;  4A3E I;  1X3Z A;  1I3Q I;  3CXC Z;  3CCU 1;  3CCQ Z;  3NDJ A;  3BG0 B;  1KQS Z;  3PO2 I;  4RV9 A;  1VQ8 Z;  4NBD A;  3VMH A;  4Y52 I;  1VQ5 1;  3GTJ I;  2K5R A;  3F3F C;  1I50 I;  2DE7 A;  1YIT Z;  2WAQ A;  2NVY I;  1ZB9 A;  1K8A 2;  3RZO I;  1Z03 A;  3VTN A;  1R9T I;  3CCJ Z;  1ML8 A;  1RLY A;  3CXC Y;  3CCE Z;  1VQN 1;  2R7Z I;  3FQM A;  1KQS Y;  4A3M I;  1PFT A;  3M4O I;  1Q7Y 2;  1YUK A;  2WB1 A;  1ZH1 A;  3CCU Z;  4A3J I;  4A3D I;  2NVX I;  4NH1 C;  1VQ5 Z;  2VF1 A;  4BXX I;  2J6A A;  2K3R A;  1NP6 A;  2YU9 I;  4A3I I;  2HF1 A;  2AKL A;  2VUM I;  4HGY A;  3S2D I;  2Q51 A;  2KPI A;  1VQN Z;  3CCM 1;  1S7M A;  3Q87 A;  3J80 b;  4E2Y A;  1RQF A;  2QEX 1;  3NH4 A;  3G4S Z;  2F4O A;  4MD8 A;  4DK1 A;  1Q82 2;  2PMZ A;  4BBS I;  2LFU A;  1N2F A;  2W04 A;  3GTG I;  4X6A I;  4RVD A;  4NB9 A;  3HOZ I;  1RO0 A;  4RS4 A;  4A3G I;  5LL6 f;  2YAD A;  1VQO 1;  3CCS 1;  1RNI A;  3KIF A;  3CCM Z;  4CL1 A;  2P3Y A;  4NBB A;  2NVQ I;  4NB8 A;  4HH4 A;  1KC8 1;  1M90 1;  3CCL Z;  2JMO A;  2RT9 A;  3OW2 Z;  3K7A I;  1VQM 1;  1VQ9 Z;  4DQY B;  3NFZ A;  1KD1 2;  3P5J B;  3S1Q I;  1YUA A;  4MRI A;  3TE5 B;  1QYP A;  3CC4 1;  3CPW Z;  4E2Z A;  4MD9 A;  1S72 1;  2Y0S A;  1YI2 1;  1VQP 1;  1NJI 1;  1VQO Z;  3CCS Z;  1X3W A;  3NH8 A;  5D1O A;  1QVG Z;  1Y1V I;  3H3V J;  1K73 2;  3S17 I;  3GTO I;  3OW2 Y;  1Q81 1;  3CC7 1;  1N8R 2;  1Y1V S;  3FKI I;  3S16 I;  5AN9 F;  3G6E 1;  2R92 I;  2QRE B;  1LQL A;  3CME 1;  5C4J I;  1VQM Z;  3CPW Y;  3LUS A;  3HOU I;  3VMI A;  2NVT I;  5IP7 I;  3I07 A;  1WW9 A;  2V8K A;  3BG1 B;  1QVG Y;  3CC4 Z;  3GTM I;  1SFO I;  3CCV 1;  1Y1W I;  4A3F I;  1YI2 Z;  3J80 f;  1VQP Z;  1Q86 1;  3M3Y I;  1K9M 2;  2O4H A;  3NDI A;  3RZD I;  2E9H A;  3HKZ A;  1VQL 1;  4NBE A;  3D9X A;  3CC7 Z;  2I3C A;  2JS4 A;  2DE6 A;  1YJW 1;  1YHQ 1;  3G6E Z;  3T4N B;  4RVG A;  3CME Z;  4QTT A;  4NBH A;  3U50 C;  1L1O C;  4NBG A;  1Z02 A;  3HOV I;  4XX2 A;  1JWH C;  1ZB8 A;  3CCV Z;  1KD1 1;  2PK7 A;  5A2Q b;  1USP A;  2V8I A;  4NOZ A;  2JNY A;  3S15 I;  2R93 I;  4A3L I;  2P28 A;  1M1K 1;  1W2B Z;  3CC2 1;  4NBF A;  3PO3 I;  1YJW Z;  1YHQ Z;  1VQ7 1;  1KRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...