2K5RA

Solution nmr structure of xf2673 from xylella fastidiosa. northeast structural genomics consortium target xfr39
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIATIQIANFPDKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein XF2673
publication title Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39
rcsb
source organism Xylella fastidiosa temecula1
molecule tags Structural genomics, unknown function
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k5rA01
1TWCI 3HOWI 2NVXI 4NBDA 4Y7NI 3I4MI 4BXXI 1SFOI 3M3YI 3HOVI 3Q87A 5IP9I 2JA8I 3S15I 3S1QI 3S2DI 1NUIA 3GTMS 3HOYI 5C4JI 5C4XI 3GTOI 1USPA 1R9TI 4QTUA 3GTMI 3D6WA 5FLMI 2PK7A 4X6AI 4Y52I 1ML8A 2R93I 1VLAA 3S2HI 2JR6A 2KPIA 4QTTA 2DE7A 4NBGA 1PFTA 2YU9I 1X3ZA 3RZOI 3GKQA 3HOZI 2DE5A 4NOZA 2J6AA 4XX2A 4A3LI 2RBLA 4NBCA 2NVQI 4BY7I 4A3MI 5CM2M 3HOXI 1RO4A 1QYPA 2E2HI 3GTLI 1RLYA 5IP7I 2NVYI 3S14I 2R7ZI 3VMGA 3S1RI 4A3II 3GTQI 2JA7I 1WW9A 1K83I 4A3DI 1I3QI 4NBAA 4NBHA 2AKLA 4NBBA 2R92I 1WCMI 2K5RA 1TWFI 2E2II 1DL6A 4A3FI 3S1MI 3GTGI 2NVTI 3EERA 4NB9A 3H3VJ 3U50C 4BBRI 2E2JI 1LQLA 1Y1VS 4A3EI 4A3GI 2JNYA 3LUSA 3VMHA 3CQZI 2DE6A 1Y1VI 2P3YA 3GTPI 2JA5I 4NB8A 3I4NI 3S17I 3FKII 4BY1I 2JS4A 3S1NI 3VMIA 3ESWA 4MH4A 4A3BI 1I50I 3S16I 2F4MA 1YUAA 2B63I 3HOUI 3GCFA 3GTKI 1ZB8A 3GTJI 2VUMI 3PO3S 1TWAI 1TWGI 3PO2I 3RZDI 3I07A 4NBEA 1TWHI 3M4OI 2JA6I 4A93I 4BBSI 1ZB9A 1Y1WI 3PO3I 5C3EI 2F4OA 2HF1A 1USPB 5C44I 4A3CI 1X3WA 2BJOA 3K7AI 4A3JI 3VB9A 1L1OC 1N2FA 1I6HI 4A3KI 4NBFA 3H0GI 1TFIA
chains in the Genus database with same CATH superfamily
2VPXA 4HGZA 3CC41 4Y7NI 1YJN1 3CC4Z 3M3YI 5IP9I 3S1QI 1YJNZ 3QWUA 1K732 2QREB 1VQ9Z 1Q862 3NH4A 3CMEZ 3D6WA 5FLMI 2PK7A 3GTMI 3CCQ1 2Q4ZA 2AYDA 4NBGA 5D1PA 4MD9A 3OW2Y 2W03A 1X3ZA 3TE5B 2Y0SA 1YIJZ 1K9M2 2DE5A 4A3LI 1WJ2A 1Y8CA 3CCE1 3CCEZ 1RLYA 5IP7I 3IX0A 5A2Qb 3S1RI 1Q812 1WW9A 2WAQA 1N8R1 2AKLA 3KIFA 1DL6A 3NFZA 1Q7Y2 3S1MI 3GTGI 3EERA 3I551 2E9HA 1RO2A 2E2JI 3OW2Z 2ZAEB 2IV2X 1Y1VS 2LIYA 4E2ZA 2KI7B 1VQ81 3VMHA 3CCM1 4NB8A 1KC81 3CC7Z 2JS4A 3G6E1 3S1NI 2M48A 2PM9A 1ZH1A 3ESWA 4DGLA 1VQM1 1VQ6Z 5AN9F 4MH4A 2GTHA 3S16I 3NDIA 1M1K1 4E2YA 3GTKI 2M6NA 2VUMI 2JIQA 3BG0B 1X0TA 1TWAI 2JIOA 4RVFA 1AA6A 2QLVB 1Y1WI 4HH4A 2F4OA 4TNUA 5FLXf 1QVFY 4E30A 2IZ3A 2OTJ1 3VB9A 1L1OC 2W04A 1N2FA 1NJI2 1YIT1 4A3KI 1Q821 4MXUA 2H85A 3H0GI 1TWCI 1VQL1 1VQLZ 1YJ91 4BXXI 3HOVI 3Q87A 2JA8I 1NUIA 3HOYI 3IR7A 4HGYA 2O4HA 5C4JI 5T67A 2V8KA 4E32A 3CC2Z 4Y52I 1FDIA 1YJWZ 1ML8A 1VLAA 3CCV1 2KPIA 2JIPA 3CCLZ 1KQSZ 4QTTA 2DE7A 3CCSZ 4DQYB 3J7A4 3HOZI 4NOZA 2VF1A 3JAMb 4BY7I 2QRDB 3NH8A 2OTL1 3MZLB 3HOXI 1YHQ1 2E2HI 1YHQZ 2NVYI 1FDOA 2OZKA 3VMGA 3CPWZ 4A3II 2VPWA 3CCQZ 1I3QI 4NBAA 2LFUA 1WCMI 2K5RA 2E2II 5IT9b 5T64A 2EGTA 2QEX1 3J81f 2NVTI 1Q16A 1VQ51 4NFRA 4A3GI 1N8R2 2JNYA 3CQZI 1VQ71 1Y1VI 3MONA 3S17I 3FKII 2LEXA 1I50I 2F4MA 3HOUI 1P9NA 1QF8A 3GTJI 1VQN1 1TWGI 3PO2I 3I55Z 3I07A 4A93I 3M4OI 2JA6I 4BBSI 3IFUA 2JIRA 2PMZA 5C3EI 1KC82 3VTNA 1VQ8Z 1M1K2 3CCMZ 1Z01A 3G6EZ 1S721 1VQP1 1VQMZ 1S72Z 5A2Qf 3HOWI 3CMA1 3MZKB 4MONA 4RVGA 2NVXI 3CMAZ 3CCU1 3I4MI 1SFOI 3CCUZ 3S15I 2JUBA 5C4XI 3GTOI 3FQQA 1R9TI 2Q51A 3D9XA 4QTUA 3J80b 1W2BZ 1Q822 2VPYA 4S1TA 2HU9A 3I561 3S2HI 2R93I 5T6BA 2NAPA 2OTJZ 1PFTA 2YU9I 2QA41 1YITZ 3RZOI 3GKQA 3CCJ1 2V3VA 2O53A 4RVHA 3CCJZ 2RT9A 4XX2A 2RBLA 2RIQA 3CPWY 2NVQI 4A3MI 1YJ9Z 5CM2M 4E33A 1RO4A 1M901 3G4S1 3GTLI 2P28A 3GTQI 4NH1C 1K83I 1KD11 4RV9A 4A3DI 5D1OB 4NBHA 1TWFI 3CCVZ 1Z03A 4EWCA 1JJ2Y 1VQ41 4DK1A 1VQ4Z 4NB9A 2I3CA 2GU2A 3U50C 2QKDA 1LQLA 2OTLZ 1YI21 4CL1A 1Z02A 4A3EI 3LUSA 2WB1A 1K8A1 3P5JB 3CCR1 2DE6A 2P3YA 3CCRZ 3GTPI 2JA5I 5D1OA 1WZNA 3I4NI 2VUGA 4BY1I 3VMIA 1VQO1 2VPZA 4A3BI 2R6MA 2B63I 1YUAA 2E7ZA 1ZB8A 1JWHC 2JIMA 2QEXZ 3CD61 1YUKA 3PO3S 2V45A 3CD6Z 3F3PC 1VQ91 1ZB9A 1JJ2Z 3CME1 1QXFA 2HF1A 1VQ5Z 3JAMf 1USPB 1K731 2BJOA 1Q861 1VQ7Z 5LL6f 1QVGZ 1YIJ1 1RQFA 3NH5A 4NBDA 1VQK1 1W2BY 4RS4A 1VQKZ 2G2KA 3S2DI 3GTMS 4E31A 5IT9f 1K9M1 1VQNZ 1USPA 2JMOA 1SIWA 1RO0A 4X6AI 2IZ4A 2RHBA 2JR6A 1KRLA 2V8JA 1Q811 3FQMA 1VQPZ 2GTIA 2J6AA 5FLXb 4NBCA 1NP6A 1Q7Y1 3D2LA 3CXCY 1WIIA 1QYPA 4AYBA 2YADA 3CC71 2R7ZI 3S14I 2JA7I 1VQ61 3I56Z 4NBBA 3TDHB 2R92I 1RNIA 4A3FI 3G711 2QA4Z 3NDJA 3G71Z 3H3VJ 2K3RA 2OOXB 3KIHA 1M902 4E2WA 4BBRI 3T4NB 3IF8A 3HKZA 1S7MA 1KD12 1KQSY 4MD8A 3G4SZ 2RPRA 2QR1B 3CXCZ 4MD7A 3J80f 2V8IA 3GCFA 1NJI1 4RVDA 4E2XA 3RZDI 4NBEA 1TWHI 1K8A2 4MRIA 3CC21 1QVGY 3PO3I 2OOYB 1YJW1 1YI2Z 3BG1B 2QRCB 5C44I 1X3WA 4A3CI 4A3JI 3K7AI 3CCL1 3J81b 3F3FC 3CCS1 1I6HI 1VQOZ 1QVFZ 3EEDA 4NBFA 1TFIA
chains in the Genus database with same CATH topology
4HGZA 3CC41 4Y7NI 1YJN1 3CC4Z 3M3YI 5IP9I 3S1QI 1YJNZ 3QWUA 1K732 2QREB 1VQ9Z 1Q862 3NH4A 3CMEZ 3D6WA 5FLMI 2PK7A 3GTMI 3CCQ1 2Q4ZA 4NBGA 5D1PA 4MD9A 3OW2Y 2W03A 1X3ZA 3TE5B 2Y0SA 1YIJZ 1K9M2 2DE5A 4A3LI 3CCE1 3CCEZ 1RLYA 5IP7I 3IX0A 5A2Qb 3S1RI 1Q812 1WW9A 2WAQA 1N8R1 2AKLA 3KIFA 1DL6A 3NFZA 1Q7Y2 3S1MI 3GTGI 3EERA 3I551 2E9HA 1RO2A 2E2JI 3OW2Z 2ZAEB 1Y1VS 2LIYA 4E2ZA 2KI7B 1VQ81 3VMHA 3CCM1 4NB8A 1KC81 3CC7Z 2JS4A 3G6E1 3S1NI 2M48A 2PM9A 1ZH1A 3ESWA 4DGLA 1VQM1 1VQ6Z 5AN9F 4MH4A 2GTHA 3S16I 3NDIA 1M1K1 4E2YA 3GTKI 2M6NA 2VUMI 3BG0B 1X0TA 1TWAI 4RVFA 2QLVB 1Y1WI 4HH4A 2F4OA 4TNUA 5FLXf 1QVFY 4E30A 2IZ3A 2OTJ1 3VB9A 1L1OC 2W04A 1N2FA 1NJI2 1YIT1 4A3KI 1Q821 4MXUA 2H85A 3H0GI 1TWCI 1VQL1 1VQLZ 1YJ91 4BXXI 3HOVI 3Q87A 2JA8I 1NUIA 3HOYI 4HGYA 2O4HA 5C4JI 5T67A 2V8KA 4E32A 3CC2Z 4Y52I 1YJWZ 1ML8A 1VLAA 3CCV1 2KPIA 3CCLZ 1KQSZ 4QTTA 2DE7A 3CCSZ 4DQYB 3J7A4 3HOZI 4NOZA 2VF1A 3JAMb 4BY7I 2QRDB 3NH8A 2OTL1 3MZLB 3HOXI 1YHQ1 2E2HI 1YHQZ 2NVYI 2OZKA 3VMGA 3CPWZ 4A3II 3CCQZ 1I3QI 4NBAA 2LFUA 1WCMI 2K5RA 2E2II 5IT9b 5T64A 2EGTA 2QEX1 3J81f 2NVTI 1VQ51 4NFRA 4A3GI 1N8R2 2JNYA 3CQZI 1VQ71 1Y1VI 3MONA 3S17I 3FKII 1I50I 2F4MA 3HOUI 1P9NA 1QF8A 3GTJI 1VQN1 1TWGI 3PO2I 3I55Z 3I07A 4A93I 3M4OI 2JA6I 4BBSI 3IFUA 1KC82 2PMZA 5C3EI 3VTNA 1VQ8Z 1M1K2 3CCMZ 1Z01A 3G6EZ 1S721 1VQP1 1VQMZ 1S72Z 5A2Qf 3HOWI 3CMA1 3MZKB 4MONA 4RVGA 2NVXI 3CMAZ 3CCU1 3I4MI 1SFOI 3CCUZ 3S15I 2JUBA 5C4XI 3GTOI 3FQQA 1R9TI 2Q51A 3D9XA 4QTUA 3J80b 1W2BZ 1Q822 4S1TA 2HU9A 3I561 3S2HI 2R93I 5T6BA 2OTJZ 1PFTA 2YU9I 2QA41 1YITZ 3RZOI 3GKQA 3CCJ1 4RVHA 2O53A 3CCJZ 2RT9A 4XX2A 2RBLA 2RIQA 3CPWY 2NVQI 4A3MI 1YJ9Z 5CM2M 4E33A 1RO4A 1M901 3G4S1 3GTLI 2P28A 3GTQI 4NH1C 1K83I 1KD11 4RV9A 4A3DI 5D1OB 4NBHA 1TWFI 3CCVZ 1Z03A 4EWCA 1JJ2Y 1VQ41 4DK1A 1VQ4Z 4NB9A 2I3CA 2GU2A 3U50C 2QKDA 1LQLA 2OTLZ 1YI21 4CL1A 1Z02A 4A3EI 3LUSA 2WB1A 1K8A1 3P5JB 3CCR1 2DE6A 2P3YA 3CCRZ 3GTPI 2JA5I 5D1OA 3I4NI 2VUGA 4BY1I 3VMIA 1VQO1 4A3BI 2R6MA 2B63I 1YUAA 1ZB8A 1JWHC 3CD61 2QEXZ 3PO3S 1YUKA 3CD6Z 3F3PC 1VQ91 1ZB9A 1JJ2Z 3CME1 2HF1A 1VQ5Z 3JAMf 1USPB 1K731 2BJOA 1Q861 1VQ7Z 5LL6f 1QVGZ 1YIJ1 1RQFA 3NH5A 4NBDA 1VQK1 1W2BY 4RS4A 1VQKZ 2G2KA 3S2DI 3GTMS 4E31A 5IT9f 1K9M1 1VQNZ 1USPA 2JMOA 1RO0A 4X6AI 2IZ4A 2RHBA 2JR6A 1KRLA 2V8JA 1Q811 3FQMA 1VQPZ 2GTIA 2J6AA 5FLXb 4NBCA 1NP6A 1Q7Y1 3CXCY 1WIIA 1QYPA 4AYBA 2YADA 3CC71 2R7ZI 3S14I 2JA7I 1VQ61 3I56Z 4NBBA 3TDHB 2R92I 1RNIA 4A3FI 3G711 2QA4Z 3NDJA 3G71Z 3H3VJ 2K3RA 2OOXB 3KIHA 1M902 4E2WA 4BBRI 3T4NB 3IF8A 3HKZA 1S7MA 1KD12 1KQSY 4MD8A 3G4SZ 2RPRA 2QR1B 3CXCZ 4MD7A 3J80f 2V8IA 3GCFA 1NJI1 4RVDA 4E2XA 3RZDI 4NBEA 1TWHI 1K8A2 4MRIA 3CC21 1QVGY 3PO3I 2OOYB 1YJW1 1YI2Z 3BG1B 2QRCB 5C44I 1X3WA 4A3CI 4A3JI 3K7AI 3CCL1 3J81b 3F3FC 3CCS1 1I6HI 1VQOZ 1QVFZ 3EEDA 4NBFA 1TFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC I;  3HOW I;  2NVX I;  4NBD A;  4Y7N I;  3I4M I;  4BXX I;  1SFO I;  3M3Y I;  3HOV I;  3Q87 A;  5IP9 I;  2JA8 I;  3S15 I;  3S1Q I;  3S2D I;  1NUI A;  3GTM S;  3HOY I;  5C4J I;  5C4X I;  3GTO I;  1USP A;  1R9T I;  4QTU A;  3GTM I;  3D6W A;  5FLM I;  2PK7 A;  4X6A I;  4Y52 I;  1ML8 A;  2R93 I;  1VLA A;  3S2H I;  2JR6 A;  2KPI A;  4QTT A;  2DE7 A;  4NBG A;  1PFT A;  2YU9 I;  1X3Z A;  3RZO I;  3GKQ A;  3HOZ I;  2DE5 A;  4NOZ A;  2J6A A;  4XX2 A;  4A3L I;  2RBL A;  4NBC A;  2NVQ I;  4BY7 I;  4A3M I;  5CM2 M;  3HOX I;  1RO4 A;  1QYP A;  2E2H I;  3GTL I;  1RLY A;  5IP7 I;  2NVY I;  3S14 I;  2R7Z I;  3VMG A;  3S1R I;  4A3I I;  3GTQ I;  2JA7 I;  1WW9 A;  1K83 I;  4A3D I;  1I3Q I;  4NBA A;  4NBH A;  2AKL A;  4NBB A;  2R92 I;  1WCM I;  2K5R A;  1TWF I;  2E2I I;  1DL6 A;  4A3F I;  3S1M I;  3GTG I;  2NVT I;  3EER A;  4NB9 A;  3H3V J;  3U50 C;  4BBR I;  2E2J I;  1LQL A;  1Y1V S;  4A3E I;  4A3G I;  2JNY A;  3LUS A;  3VMH A;  3CQZ I;  2DE6 A;  1Y1V I;  2P3Y A;  3GTP I;  2JA5 I;  4NB8 A;  3I4N I;  3S17 I;  3FKI I;  4BY1 I;  2JS4 A;  3S1N I;  3VMI A;  3ESW A;  4MH4 A;  4A3B I;  1I50 I;  3S16 I;  2F4M A;  1YUA A;  2B63 I;  3HOU I;  3GCF A;  3GTK I;  1ZB8 A;  3GTJ I;  2VUM I;  3PO3 S;  1TWA I;  1TWG I;  3PO2 I;  3RZD I;  3I07 A;  4NBE A;  1TWH I;  3M4O I;  2JA6 I;  4A93 I;  4BBS I;  1ZB9 A;  1Y1W I;  3PO3 I;  5C3E I;  2F4O A;  2HF1 A;  1USP B;  5C44 I;  4A3C I;  1X3W A;  2BJO A;  3K7A I;  4A3J I;  3VB9 A;  1L1O C;  1N2F A;  1I6H I;  4A3K I;  4NBF A;  3H0G I;  1TFI A; 
#chains in the Genus database with same CATH topology
 2VPX A;  4HGZ A;  3CC4 1;  4Y7N I;  1YJN 1;  3CC4 Z;  3M3Y I;  5IP9 I;  3S1Q I;  1YJN Z;  3QWU A;  1K73 2;  2QRE B;  1VQ9 Z;  1Q86 2;  3NH4 A;  3CME Z;  3D6W A;  5FLM I;  2PK7 A;  3GTM I;  3CCQ 1;  2Q4Z A;  2AYD A;  4NBG A;  5D1P A;  4MD9 A;  3OW2 Y;  2W03 A;  1X3Z A;  3TE5 B;  2Y0S A;  1YIJ Z;  1K9M 2;  2DE5 A;  4A3L I;  1WJ2 A;  1Y8C A;  3CCE 1;  3CCE Z;  1RLY A;  5IP7 I;  3IX0 A;  5A2Q b;  3S1R I;  1Q81 2;  1WW9 A;  2WAQ A;  1N8R 1;  2AKL A;  3KIF A;  1DL6 A;  3NFZ A;  1Q7Y 2;  3S1M I;  3GTG I;  3EER A;  3I55 1;  2E9H A;  1RO2 A;  2E2J I;  3OW2 Z;  2ZAE B;  2IV2 X;  1Y1V S;  2LIY A;  4E2Z A;  2KI7 B;  1VQ8 1;  3VMH A;  3CCM 1;  4NB8 A;  1KC8 1;  3CC7 Z;  2JS4 A;  3G6E 1;  3S1N I;  2M48 A;  2PM9 A;  1ZH1 A;  3ESW A;  4DGL A;  1VQM 1;  1VQ6 Z;  5AN9 F;  4MH4 A;  2GTH A;  3S16 I;  3NDI A;  1M1K 1;  4E2Y A;  3GTK I;  2M6N A;  2VUM I;  2JIQ A;  3BG0 B;  1X0T A;  1TWA I;  2JIO A;  4RVF A;  1AA6 A;  2QLV B;  1Y1W I;  4HH4 A;  2F4O A;  4TNU A;  5FLX f;  1QVF Y;  4E30 A;  2IZ3 A;  2OTJ 1;  3VB9 A;  1L1O C;  2W04 A;  1N2F A;  1NJI 2;  1YIT 1;  4A3K I;  1Q82 1;  4MXU A;  2H85 A;  3H0G I;  1TWC I;  1VQL 1;  1VQL Z;  1YJ9 1;  4BXX I;  3HOV I;  3Q87 A;  2JA8 I;  1NUI A;  3HOY I;  3IR7 A;  4HGY A;  2O4H A;  5C4J I;  5T67 A;  2V8K A;  4E32 A;  3CC2 Z;  4Y52 I;  1FDI A;  1YJW Z;  1ML8 A;  1VLA A;  3CCV 1;  2KPI A;  2JIP A;  3CCL Z;  1KQS Z;  4QTT A;  2DE7 A;  3CCS Z;  4DQY B;  3J7A 4;  3HOZ I;  4NOZ A;  2VF1 A;  3JAM b;  4BY7 I;  2QRD B;  3NH8 A;  2OTL 1;  3MZL B;  3HOX I;  1YHQ 1;  2E2H I;  1YHQ Z;  2NVY I;  1FDO A;  2OZK A;  3VMG A;  3CPW Z;  4A3I I;  2VPW A;  3CCQ Z;  1I3Q I;  4NBA A;  2LFU A;  1WCM I;  2K5R A;  2E2I I;  5IT9 b;  5T64 A;  2EGT A;  2QEX 1;  3J81 f;  2NVT I;  1Q16 A;  1VQ5 1;  4NFR A;  4A3G I;  1N8R 2;  2JNY A;  3CQZ I;  1VQ7 1;  1Y1V I;  3MON A;  3S17 I;  3FKI I;  2LEX A;  1I50 I;  2F4M A;  3HOU I;  1P9N A;  1QF8 A;  3GTJ I;  1VQN 1;  1TWG I;  3PO2 I;  3I55 Z;  3I07 A;  4A93 I;  3M4O I;  2JA6 I;  4BBS I;  3IFU A;  2JIR A;  2PMZ A;  5C3E I;  1KC8 2;  3VTN A;  1VQ8 Z;  1M1K 2;  3CCM Z;  1Z01 A;  3G6E Z;  1S72 1;  1VQP 1;  1VQM Z;  1S72 Z;  5A2Q f;  3HOW I;  3CMA 1;  3MZK B;  4MON A;  4RVG A;  2NVX I;  3CMA Z;  3CCU 1;  3I4M I;  1SFO I;  3CCU Z;  3S15 I;  2JUB A;  5C4X I;  3GTO I;  3FQQ A;  1R9T I;  2Q51 A;  3D9X A;  4QTU A;  3J80 b;  1W2B Z;  1Q82 2;  2VPY A;  4S1T A;  2HU9 A;  3I56 1;  3S2H I;  2R93 I;  5T6B A;  2NAP A;  2OTJ Z;  1PFT A;  2YU9 I;  2QA4 1;  1YIT Z;  3RZO I;  3GKQ A;  3CCJ 1;  2V3V A;  2O53 A;  4RVH A;  3CCJ Z;  2RT9 A;  4XX2 A;  2RBL A;  2RIQ A;  3CPW Y;  2NVQ I;  4A3M I;  1YJ9 Z;  5CM2 M;  4E33 A;  1RO4 A;  1M90 1;  3G4S 1;  3GTL I;  2P28 A;  3GTQ I;  4NH1 C;  1K83 I;  1KD1 1;  4RV9 A;  4A3D I;  5D1O B;  4NBH A;  1TWF I;  3CCV Z;  1Z03 A;  4EWC A;  1JJ2 Y;  1VQ4 1;  4DK1 A;  1VQ4 Z;  4NB9 A;  2I3C A;  2GU2 A;  3U50 C;  2QKD A;  1LQL A;  2OTL Z;  1YI2 1;  4CL1 A;  1Z02 A;  4A3E I;  3LUS A;  2WB1 A;  1K8A 1;  3P5J B;  3CCR 1;  2DE6 A;  2P3Y A;  3CCR Z;  3GTP I;  2JA5 I;  5D1O A;  1WZN A;  3I4N I;  2VUG A;  4BY1 I;  3VMI A;  1VQO 1;  2VPZ A;  4A3B I;  2R6M A;  2B63 I;  1YUA A;  2E7Z A;  1ZB8 A;  1JWH C;  2JIM A;  2QEX Z;  3CD6 1;  1YUK A;  3PO3 S;  2V45 A;  3CD6 Z;  3F3P C;  1VQ9 1;  1ZB9 A;  1JJ2 Z;  3CME 1;  1QXF A;  2HF1 A;  1VQ5 Z;  3JAM f;  1USP B;  1K73 1;  2BJO A;  1Q86 1;  1VQ7 Z;  5LL6 f;  1QVG Z;  1YIJ 1;  1RQF A;  3NH5 A;  4NBD A;  1VQK 1;  1W2B Y;  4RS4 A;  1VQK Z;  2G2K A;  3S2D I;  3GTM S;  4E31 A;  5IT9 f;  1K9M 1;  1VQN Z;  1USP A;  2JMO A;  1SIW A;  1RO0 A;  4X6A I;  2IZ4 A;  2RHB A;  2JR6 A;  1KRL A;  2V8J A;  1Q81 1;  3FQM A;  1VQP Z;  2GTI A;  2J6A A;  5FLX b;  4NBC A;  1NP6 A;  1Q7Y 1;  3D2L A;  3CXC Y;  1WII A;  1QYP A;  4AYB A;  2YAD A;  3CC7 1;  2R7Z I;  3S14 I;  2JA7 I;  1VQ6 1;  3I56 Z;  4NBB A;  3TDH B;  2R92 I;  1RNI A;  4A3F I;  3G71 1;  2QA4 Z;  3NDJ A;  3G71 Z;  3H3V J;  2K3R A;  2OOX B;  3KIH A;  1M90 2;  4E2W A;  4BBR I;  3T4N B;  3IF8 A;  3HKZ A;  1S7M A;  1KD1 2;  1KQS Y;  4MD8 A;  3G4S Z;  2RPR A;  2QR1 B;  3CXC Z;  4MD7 A;  3J80 f;  2V8I A;  3GCF A;  1NJI 1;  4RVD A;  4E2X A;  3RZD I;  4NBE A;  1TWH I;  1K8A 2;  4MRI A;  3CC2 1;  1QVG Y;  3PO3 I;  2OOY B;  1YJW 1;  1YI2 Z;  3BG1 B;  2QRC B;  5C44 I;  1X3W A;  4A3C I;  4A3J I;  3K7A I;  3CCL 1;  3J81 b;  3F3F C;  3CCS 1;  1I6H I;  1VQO Z;  1QVF Z;  3EED A;  4NBF A;  1TFI A; 
#chains in the Genus database with same CATH homology
 4HGZ A;  3CC4 1;  4Y7N I;  1YJN 1;  3CC4 Z;  3M3Y I;  5IP9 I;  3S1Q I;  1YJN Z;  3QWU A;  1K73 2;  2QRE B;  1VQ9 Z;  1Q86 2;  3NH4 A;  3CME Z;  3D6W A;  5FLM I;  2PK7 A;  3GTM I;  3CCQ 1;  2Q4Z A;  4NBG A;  5D1P A;  4MD9 A;  3OW2 Y;  2W03 A;  1X3Z A;  3TE5 B;  2Y0S A;  1YIJ Z;  1K9M 2;  2DE5 A;  4A3L I;  3CCE 1;  3CCE Z;  1RLY A;  5IP7 I;  3IX0 A;  5A2Q b;  3S1R I;  1Q81 2;  1WW9 A;  2WAQ A;  1N8R 1;  2AKL A;  3KIF A;  1DL6 A;  3NFZ A;  1Q7Y 2;  3S1M I;  3GTG I;  3EER A;  3I55 1;  2E9H A;  1RO2 A;  2E2J I;  3OW2 Z;  2ZAE B;  1Y1V S;  2LIY A;  4E2Z A;  2KI7 B;  1VQ8 1;  3VMH A;  3CCM 1;  4NB8 A;  1KC8 1;  3CC7 Z;  2JS4 A;  3G6E 1;  3S1N I;  2M48 A;  2PM9 A;  1ZH1 A;  3ESW A;  4DGL A;  1VQM 1;  1VQ6 Z;  5AN9 F;  4MH4 A;  2GTH A;  3S16 I;  3NDI A;  1M1K 1;  4E2Y A;  3GTK I;  2M6N A;  2VUM I;  3BG0 B;  1X0T A;  1TWA I;  4RVF A;  2QLV B;  1Y1W I;  4HH4 A;  2F4O A;  4TNU A;  5FLX f;  1QVF Y;  4E30 A;  2IZ3 A;  2OTJ 1;  3VB9 A;  1L1O C;  2W04 A;  1N2F A;  1NJI 2;  1YIT 1;  4A3K I;  1Q82 1;  4MXU A;  2H85 A;  3H0G I;  1TWC I;  1VQL 1;  1VQL Z;  1YJ9 1;  4BXX I;  3HOV I;  3Q87 A;  2JA8 I;  1NUI A;  3HOY I;  4HGY A;  2O4H A;  5C4J I;  5T67 A;  2V8K A;  4E32 A;  3CC2 Z;  4Y52 I;  1YJW Z;  1ML8 A;  1VLA A;  3CCV 1;  2KPI A;  3CCL Z;  1KQS Z;  4QTT A;  2DE7 A;  3CCS Z;  4DQY B;  3J7A 4;  3HOZ I;  4NOZ A;  2VF1 A;  3JAM b;  4BY7 I;  2QRD B;  3NH8 A;  2OTL 1;  3MZL B;  3HOX I;  1YHQ 1;  2E2H I;  1YHQ Z;  2NVY I;  2OZK A;  3VMG A;  3CPW Z;  4A3I I;  3CCQ Z;  1I3Q I;  4NBA A;  2LFU A;  1WCM I;  2K5R A;  2E2I I;  5IT9 b;  5T64 A;  2EGT A;  2QEX 1;  3J81 f;  2NVT I;  1VQ5 1;  4NFR A;  4A3G I;  1N8R 2;  2JNY A;  3CQZ I;  1VQ7 1;  1Y1V I;  3MON A;  3S17 I;  3FKI I;  1I50 I;  2F4M A;  3HOU I;  1P9N A;  1QF8 A;  3GTJ I;  1VQN 1;  1TWG I;  3PO2 I;  3I55 Z;  3I07 A;  4A93 I;  3M4O I;  2JA6 I;  4BBS I;  3IFU A;  1KC8 2;  2PMZ A;  5C3E I;  3VTN A;  1VQ8 Z;  1M1K 2;  3CCM Z;  1Z01 A;  3G6E Z;  1S72 1;  1VQP 1;  1VQM Z;  1S72 Z;  5A2Q f;  3HOW I;  3CMA 1;  3MZK B;  4MON A;  4RVG A;  2NVX I;  3CMA Z;  3CCU 1;  3I4M I;  1SFO I;  3CCU Z;  3S15 I;  2JUB A;  5C4X I;  3GTO I;  3FQQ A;  1R9T I;  2Q51 A;  3D9X A;  4QTU A;  3J80 b;  1W2B Z;  1Q82 2;  4S1T A;  2HU9 A;  3I56 1;  3S2H I;  2R93 I;  5T6B A;  2OTJ Z;  1PFT A;  2YU9 I;  2QA4 1;  1YIT Z;  3RZO I;  3GKQ A;  3CCJ 1;  4RVH A;  2O53 A;  3CCJ Z;  2RT9 A;  4XX2 A;  2RBL A;  2RIQ A;  3CPW Y;  2NVQ I;  4A3M I;  1YJ9 Z;  5CM2 M;  4E33 A;  1RO4 A;  1M90 1;  3G4S 1;  3GTL I;  2P28 A;  3GTQ I;  4NH1 C;  1K83 I;  1KD1 1;  4RV9 A;  4A3D I;  5D1O B;  4NBH A;  1TWF I;  3CCV Z;  1Z03 A;  4EWC A;  1JJ2 Y;  1VQ4 1;  4DK1 A;  1VQ4 Z;  4NB9 A;  2I3C A;  2GU2 A;  3U50 C;  2QKD A;  1LQL A;  2OTL Z;  1YI2 1;  4CL1 A;  1Z02 A;  4A3E I;  3LUS A;  2WB1 A;  1K8A 1;  3P5J B;  3CCR 1;  2DE6 A;  2P3Y A;  3CCR Z;  3GTP I;  2JA5 I;  5D1O A;  3I4N I;  2VUG A;  4BY1 I;  3VMI A;  1VQO 1;  4A3B I;  2R6M A;  2B63 I;  1YUA A;  1ZB8 A;  1JWH C;  3CD6 1;  2QEX Z;  3PO3 S;  1YUK A;  3CD6 Z;  3F3P C;  1VQ9 1;  1ZB9 A;  1JJ2 Z;  3CME 1;  2HF1 A;  1VQ5 Z;  3JAM f;  1USP B;  1K73 1;  2BJO A;  1Q86 1;  1VQ7 Z;  5LL6 f;  1QVG Z;  1YIJ 1;  1RQF A;  3NH5 A;  4NBD A;  1VQK 1;  1W2B Y;  4RS4 A;  1VQK Z;  2G2K A;  3S2D I;  3GTM S;  4E31 A;  5IT9 f;  1K9M 1;  1VQN Z;  1USP A;  2JMO A;  1RO0 A;  4X6A I;  2IZ4 A;  2RHB A;  2JR6 A;  1KRL A;  2V8J A;  1Q81 1;  3FQM A;  1VQP Z;  2GTI A;  2J6A A;  5FLX b;  4NBC A;  1NP6 A;  1Q7Y 1;  3CXC Y;  1WII A;  1QYP A;  4AYB A;  2YAD A;  3CC7 1;  2R7Z I;  3S14 I;  2JA7 I;  1VQ6 1;  3I56 Z;  4NBB A;  3TDH B;  2R92 I;  1RNI A;  4A3F I;  3G71 1;  2QA4 Z;  3NDJ A;  3G71 Z;  3H3V J;  2K3R A;  2OOX B;  3KIH A;  1M90 2;  4E2W A;  4BBR I;  3T4N B;  3IF8 A;  3HKZ A;  1S7M A;  1KD1 2;  1KQS Y;  4MD8 A;  3G4S Z;  2RPR A;  2QR1 B;  3CXC Z;  4MD7 A;  3J80 f;  2V8I A;  3GCF A;  1NJI 1;  4RVD A;  4E2X A;  3RZD I;  4NBE A;  1TWH I;  1K8A 2;  4MRI A;  3CC2 1;  1QVG Y;  3PO3 I;  2OOY B;  1YJW 1;  1YI2 Z;  3BG1 B;  2QRC B;  5C44 I;  1X3W A;  4A3C I;  4A3J I;  3K7A I;  3CCL 1;  3J81 b;  3F3F C;  3CCS 1;  1I6H I;  1VQO Z;  1QVF Z;  3EED A;  4NBF A;  1TFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...