3CMAZ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmaZ00
3CCSZ 3CD61 3CCQ1 1KD11 1M901 1W2BY 3CPWY 1Q861 1VQ6Z 3CC7Z 1VQ4Z 3CCR1 2QA4Z 3G71Z 1K8A1 1K732 3I551 1VQMZ 3CCV1 1QVGY 3CCJZ 1VQ51 1VQ71 3CD6Z 3CCEZ 1VQL1 1YJW1 1YJN1 1M1K1 2OTL1 3CCRZ 1KQSY 3CCM1 1YI2Z 3OW2Z 2OTJ1 3CCU1 3I55Z 1KC82 3CMA1 1K9M2 1VQP1 3CCL1 1YIT1 1N8R1 1Q811 1YIJ1 1VQ5Z 3CC41 1YHQ1 1VQLZ 1VQO1 3CXCZ 1YJNZ 3CC21 1YJ9Z 3CCMZ 3I561 3G4S1 3CCQZ 3CMAZ 2QEX1 1VQK1 3CCLZ 1YITZ 1JJ2Z 1K731 3CC4Z 1QVFZ 1VQN1 1Q822 1Q7Y1 1VQ81 1S721 3CCVZ 3CME1 1QVGZ 3OW2Y 1NJI1 1VQ7Z 3G4SZ 1VQKZ 3G6E1 1KD12 1YJWZ 1M902 1VQ41 1KC81 2OTLZ 1VQNZ 1Q862 3CXCY 2OTJZ 1VQ8Z 1S72Z 3CCUZ 1W2BZ 3CPWZ 1K8A2 1VQPZ 3CMEZ 1VQ91 1YIJZ 1YHQZ 3CCE1 3G6EZ 1VQOZ 1JJ2Y 1QVFY 3CC2Z 3CCS1 1YI21 1M1K2 3I56Z 2QEXZ 1Q7Y2 1VQ9Z 1VQ61 3CC71 1Q821 1N8R2 1Q812 2QA41 1NJI2 3G711 1K9M1 1KQSZ 1VQM1 1YJ91 3CCJ1
chains in the Genus database with same CATH superfamily
3J81f 1ZB9A 2VPZA 4NBAA 1M901 3HOXI 2NVQI 2HF1A 3IF8A 2QLVB 2QRCB 4A93I 1K732 1RO0A 2B63I 1TWCI 4E2XA 3S1NI 4BBRI 2J6AA 2JUBA 3CCEZ 5IT9f 4NBGA 1YJN1 2RHBA 1WJ2A 1KQSY 3CCM1 2OTJ1 3OW2Z 2RBLA 3I55Z 3CMA1 1K83I 3GTQI 1JWHC 1Y8CA 3D6WA 4MD7A 5FLMI 2PM9A 2VPWA 2E7ZA 3VMHA 2DE6A 1VQLZ 2OZKA 1YUAA 3CC21 2OOXB 1YJ9Z 2EGTA 4HH4A 2JA7I 3GTKI 1QYPA 4A3DI 2R6MA 2K3RA 1I6HI 3CCLZ 4A3KI 3NH4A 2JIQA 1K731 3CC4Z 2VPYA 4AYBA 1DL6A 2R7ZI 3FQQA 1Q7Y1 3NFZA 3CCVZ 3P5JB 2PMZA 2QRDB 2WB1A 3OW2Y 1NJI1 3VMIA 1VQ7Z 3M4OI 4E32A 3G4SZ 4DQYB 2ZAEB 3FKII 1VQKZ 1TWAI 1TWHI 4NBBA 3MONA 5FLXf 3I07A 1QF8A 1VQNZ 3J81b 3S2DI 4NBHA 1WCMI 1S72Z 3CCUZ 4HGYA 1W2BZ 1K8A2 2JA6I 5C4JI 1YHQZ 3CCE1 5IP7I 3NDIA 3G6EZ 1PFTA 3KIFA 2AKLA 1N2FA 1RNIA 3GTMI 4E30A 1VQ9Z 3S2HI 4BY1I 1VQ61 2M48A 3CC71 2JR6A 2JIPA 4MD9A 2WAQA 4RVHA 1VQM1 2E2II 3PO3I 3HOYI 1YJ91 1USPB 3CCSZ 4DK1A 1W2BY 1VQ4Z 3CCR1 3G71Z 1TWGI 1K8A1 1VLAA 5C44I 3CCV1 3RZOI 1Y1VI 1VQ71 4E33A 3CD6Z 3S1RI 2VUGA 1X3ZA 1SIWA 2NAPA 3TDHB 4A3FI 1YI2Z 2JMOA 3CCU1 1K9M2 3GTLI 1YIT1 2F4MA 1VQ5Z 2NVTI 4CL1A 1YHQ1 2I3CA 1I3QI 1FDIA 2BJOA 1WIIA 4RVDA 3EEDA 1ZH1A 3GTMS 4Y7NI 2LFUA 2K5RA 1WZNA 3S17I 4MONA 4BXXI 1I50I 1JJ2Z 1QVFZ 2P3YA 1S7MA 3VTNA 4A3LI 1QVGZ 3GTPI 2QR1B 2JIRA 1AA6A 3EERA 2YADA 5CM2M 2Q4ZA 1VQ41 3I4MI 1Q862 3FQMA 1VQ8Z 1R9TI 1Y1VS 4NBCA 1Y1WI 1LQLA 3CPWZ 3CMEZ 2RIQA 4XX2A 1YIJZ 4MXUA 2VUMI 3MZKB 2M6NA 3NH8A 1VQOZ 1SFOI 1JJ2Y 3VB9A 1QVFY 2F4OA 1YI21 1M1K2 3K7AI 3I56Z 1L1OC 3PO2I 3MZLB 4RV9A 2JA5I 2IZ3A 4NBFA 4Y52I 1Q812 5T64A 2JIMA 3BG1B 3JAMf 2LIYA 2JA8I 4BBSI 3VMGA 5A2Qf 3CPWY 2LEXA 3D9XA 3H0GI 1Q861 4NB8A 3S16I 2QA4Z 3KIHA 3I551 2G2KA 4RVGA 3I4NI 1KRLA 2VPXA 3CCJZ 5IT9b 3CQZI 2GTHA 1NP6A 2JS4A 3T4NB 3IFUA 4MD8A 1VQL1 3S1QI 1M1K1 4A3BI 2R93I 2E9HA 3CCL1 2V45A 1RQFA 1Q811 5C4XI 1YIJ1 3HOWI 3CC41 4A3CI 2DE7A 2KI7B 1VQO1 2RPRA 2AYDA 1YJNZ 5D1PA 4HGZA 1USPA 3I561 3CCMZ 1QXFA 3G4S1 3CCQZ 3CMAZ 2Q51A 4A3EI 1VQK1 3GTJI 1VQN1 5D1OB 4A3MI 1Q822 2QREB 1S721 4A3GI 1X0TA 1RLYA 2NVXI 1ML8A 5FLXb 1RO4A 3G6E1 3S1MI 1KD12 2GTIA 1YJWZ 4E2YA 4E2WA 3BG0B 2P28A 4MH4A 3F3FC 2OTLZ 3J80f 2V8JA 1FDOA 1Z01A 5A2Qb 3ESWA 4X6AI 1Z02A 3M3YI 1VQPZ 3RZDI 1VQ91 2JIOA 1Z03A 3IR7A 3PO3S 1YUKA 3CCS1 1WW9A 4NOZA 2E2HI 4NFRA 2QEXZ 1Q7Y2 3J7A4 4QTTA 1Q821 3GKQA 1N8R2 3F3PC 1NJI2 3G711 4RVFA 1K9M1 2W03A 4E31A 3LUSA 3NDJA 3CD61 3CCQ1 1KD11 4QTUA 2V8IA 1VQ6Z 3CC7Z 5T6BA 2H85A 2OOYB 3HKZA 5LL6f 1VQMZ 1Q16A 4RS4A 1QVGY 1VQ51 1X3WA 2O4HA 2Y0SA 1YJW1 2OTL1 3CCRZ 3S14I 4A3JI 1TWFI 2JNYA 1NUIA 3HOUI 1KC82 1VQP1 1N8R1 1RO2A 2YU9I 1ZB8A 3D2LA 3H3VJ 1P9NA 3J80b 3CXCZ 2DE5A 4NBEA 4NB9A 2QEX1 2V3VA 2V8KA 3QWUA 5IP9I 1YITZ 5C3EI 4DGLA 3TE5B 2QKDA 4S1TA 3IX0A 3GCFA 1VQ81 3GTOI 3HOVI 3CME1 2E2JI 2PK7A 4NBDA 4BY7I 4TNUA 3GTGI 2VF1A 1M902 2HU9A 1KC81 4A3II 2NVYI 3U50C 3HOZI 3CXCY 2OTJZ 2O53A 3NH5A 2RT9A 2W04A 1TFIA 4EWCA 2R92I 4MRIA 2IV2X 3Q87A 5AN9F 3CC2Z 2KPIA 4E2ZA 3JAMb 2IZ4A 2QA41 4NH1C 1KQSZ 5D1OA 2GU2A 3S15I 5T67A 3CCJ1
chains in the Genus database with same CATH topology
3J81f 1ZB9A 4NBAA 1M901 3HOXI 2NVQI 2HF1A 3IF8A 2QLVB 2QRCB 4A93I 1K732 1RO0A 2B63I 1TWCI 4E2XA 3S1NI 4BBRI 2J6AA 2JUBA 3CCEZ 5IT9f 4NBGA 1YJN1 2RHBA 1KQSY 3CCM1 2OTJ1 3OW2Z 2RBLA 3I55Z 3CMA1 1K83I 3GTQI 1JWHC 3D6WA 4MD7A 5FLMI 2PM9A 3VMHA 2DE6A 1VQLZ 2OZKA 1YUAA 3CC21 2OOXB 1YJ9Z 2EGTA 4HH4A 2JA7I 3GTKI 1QYPA 4A3DI 2R6MA 2K3RA 1I6HI 3CCLZ 4A3KI 3NH4A 1K731 3CC4Z 4AYBA 1DL6A 2R7ZI 3FQQA 1Q7Y1 3NFZA 3CCVZ 3P5JB 2PMZA 2QRDB 2WB1A 3OW2Y 1NJI1 3VMIA 1VQ7Z 3M4OI 4E32A 3G4SZ 4DQYB 2ZAEB 3FKII 1VQKZ 1TWAI 1TWHI 4NBBA 3MONA 5FLXf 3I07A 1QF8A 1VQNZ 3J81b 3S2DI 4NBHA 1WCMI 1S72Z 3CCUZ 4HGYA 1W2BZ 1K8A2 2JA6I 5C4JI 1YHQZ 3CCE1 5IP7I 3NDIA 3G6EZ 1PFTA 3KIFA 2AKLA 1N2FA 1RNIA 3GTMI 4E30A 1VQ9Z 3S2HI 4BY1I 1VQ61 2M48A 3CC71 2JR6A 4MD9A 2WAQA 4RVHA 1VQM1 2E2II 3PO3I 3HOYI 1YJ91 1USPB 3CCSZ 4DK1A 1W2BY 1VQ4Z 3CCR1 3G71Z 1TWGI 1K8A1 1VLAA 5C44I 3CCV1 3RZOI 1Y1VI 1VQ71 4E33A 3CD6Z 3S1RI 2VUGA 1X3ZA 3TDHB 4A3FI 1YI2Z 2JMOA 3CCU1 1K9M2 3GTLI 1YIT1 2F4MA 1VQ5Z 2NVTI 4CL1A 1YHQ1 2I3CA 1I3QI 2BJOA 1WIIA 4RVDA 3EEDA 1ZH1A 3GTMS 4Y7NI 2LFUA 2K5RA 3S17I 4MONA 4BXXI 1I50I 1JJ2Z 1QVFZ 2P3YA 1S7MA 3VTNA 4A3LI 1QVGZ 3GTPI 2QR1B 3EERA 2YADA 5CM2M 2Q4ZA 1VQ41 3I4MI 1Q862 3FQMA 1VQ8Z 1R9TI 1Y1VS 4NBCA 1Y1WI 1LQLA 3CPWZ 3CMEZ 2RIQA 4XX2A 1YIJZ 4MXUA 2VUMI 3MZKB 2M6NA 3NH8A 1VQOZ 1SFOI 1JJ2Y 3VB9A 1QVFY 2F4OA 1YI21 1M1K2 3K7AI 3I56Z 1L1OC 3PO2I 3MZLB 4RV9A 2JA5I 2IZ3A 4NBFA 4Y52I 1Q812 5T64A 3BG1B 3JAMf 2LIYA 2JA8I 4BBSI 3VMGA 5A2Qf 3CPWY 3D9XA 3H0GI 1Q861 4NB8A 3S16I 2QA4Z 3KIHA 3I551 2G2KA 4RVGA 3I4NI 1KRLA 3CCJZ 5IT9b 3CQZI 2GTHA 1NP6A 2JS4A 3T4NB 3IFUA 4MD8A 1VQL1 3S1QI 1M1K1 4A3BI 2R93I 2E9HA 3CCL1 1RQFA 1Q811 5C4XI 1YIJ1 3HOWI 3CC41 4A3CI 2DE7A 2KI7B 1VQO1 2RPRA 1YJNZ 5D1PA 4HGZA 1USPA 3I561 3CCMZ 3G4S1 3CCQZ 3CMAZ 2Q51A 4A3EI 1VQK1 3GTJI 1VQN1 5D1OB 4A3MI 1Q822 2QREB 1S721 4A3GI 1X0TA 1RLYA 2NVXI 1ML8A 5FLXb 1RO4A 3G6E1 3S1MI 1KD12 2GTIA 1YJWZ 4E2YA 4E2WA 3BG0B 2P28A 4MH4A 3F3FC 2OTLZ 3J80f 2V8JA 4X6AI 1Z01A 3ESWA 5A2Qb 1Z02A 3M3YI 1VQPZ 3RZDI 1VQ91 1Z03A 3PO3S 1YUKA 3CCS1 1WW9A 4NOZA 2E2HI 4NFRA 2QEXZ 1Q7Y2 3J7A4 4QTTA 1Q821 3GKQA 1N8R2 3F3PC 1NJI2 3G711 4RVFA 1K9M1 2W03A 4E31A 3LUSA 3NDJA 3CD61 3CCQ1 1KD11 4QTUA 2V8IA 1VQ6Z 3CC7Z 5T6BA 2H85A 2OOYB 3HKZA 5LL6f 1VQMZ 4RS4A 1QVGY 1VQ51 1X3WA 2O4HA 2Y0SA 1YJW1 2OTL1 3CCRZ 3S14I 4A3JI 1TWFI 2JNYA 1NUIA 3HOUI 1KC82 1VQP1 1N8R1 1RO2A 2YU9I 1ZB8A 3H3VJ 1P9NA 3J80b 3CXCZ 2DE5A 4NBEA 4NB9A 2QEX1 3QWUA 2V8KA 5IP9I 1YITZ 5C3EI 4DGLA 3TE5B 2QKDA 4S1TA 3IX0A 3GCFA 1VQ81 3GTOI 3HOVI 3CME1 2E2JI 2PK7A 4NBDA 4BY7I 4TNUA 3GTGI 2VF1A 1M902 2HU9A 1KC81 4A3II 2NVYI 3U50C 3HOZI 3CXCY 2OTJZ 2O53A 3NH5A 2RT9A 2W04A 1TFIA 4EWCA 2R92I 4MRIA 3Q87A 5AN9F 3CC2Z 2KPIA 4E2ZA 3JAMb 2IZ4A 2QA41 4NH1C 1KQSZ 5D1OA 2GU2A 3S15I 5T67A 3CCJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Z;  3CD6 1;  3CCQ 1;  1KD1 1;  1M90 1;  1W2B Y;  3CPW Y;  1Q86 1;  1VQ6 Z;  3CC7 Z;  1VQ4 Z;  3CCR 1;  2QA4 Z;  3G71 Z;  1K8A 1;  1K73 2;  3I55 1;  1VQM Z;  3CCV 1;  1QVG Y;  3CCJ Z;  1VQ5 1;  1VQ7 1;  3CD6 Z;  3CCE Z;  1VQL 1;  1YJW 1;  1YJN 1;  1M1K 1;  2OTL 1;  3CCR Z;  1KQS Y;  3CCM 1;  1YI2 Z;  3OW2 Z;  2OTJ 1;  3CCU 1;  3I55 Z;  1KC8 2;  3CMA 1;  1K9M 2;  1VQP 1;  3CCL 1;  1YIT 1;  1N8R 1;  1Q81 1;  1YIJ 1;  1VQ5 Z;  3CC4 1;  1YHQ 1;  1VQL Z;  1VQO 1;  3CXC Z;  1YJN Z;  3CC2 1;  1YJ9 Z;  3CCM Z;  3I56 1;  3G4S 1;  3CCQ Z;  3CMA Z;  2QEX 1;  1VQK 1;  3CCL Z;  1YIT Z;  1JJ2 Z;  1K73 1;  3CC4 Z;  1QVF Z;  1VQN 1;  1Q82 2;  1Q7Y 1;  1VQ8 1;  1S72 1;  3CCV Z;  3CME 1;  1QVG Z;  3OW2 Y;  1NJI 1;  1VQ7 Z;  3G4S Z;  1VQK Z;  3G6E 1;  1KD1 2;  1YJW Z;  1M90 2;  1VQ4 1;  1KC8 1;  2OTL Z;  1VQN Z;  1Q86 2;  3CXC Y;  2OTJ Z;  1VQ8 Z;  1S72 Z;  3CCU Z;  1W2B Z;  3CPW Z;  1K8A 2;  1VQP Z;  3CME Z;  1VQ9 1;  1YIJ Z;  1YHQ Z;  3CCE 1;  3G6E Z;  1VQO Z;  1JJ2 Y;  1QVF Y;  3CC2 Z;  3CCS 1;  1YI2 1;  1M1K 2;  3I56 Z;  2QEX Z;  1Q7Y 2;  1VQ9 Z;  1VQ6 1;  3CC7 1;  1Q82 1;  1N8R 2;  1Q81 2;  2QA4 1;  1NJI 2;  3G71 1;  1K9M 1;  1KQS Z;  1VQM 1;  1YJ9 1;  3CCJ 1; 
#chains in the Genus database with same CATH topology
 3J81 f;  1ZB9 A;  2VPZ A;  4NBA A;  1M90 1;  3HOX I;  2NVQ I;  2HF1 A;  3IF8 A;  2QLV B;  2QRC B;  4A93 I;  1K73 2;  1RO0 A;  2B63 I;  1TWC I;  4E2X A;  3S1N I;  4BBR I;  2J6A A;  2JUB A;  3CCE Z;  5IT9 f;  4NBG A;  1YJN 1;  2RHB A;  1WJ2 A;  1KQS Y;  3CCM 1;  2OTJ 1;  3OW2 Z;  2RBL A;  3I55 Z;  3CMA 1;  1K83 I;  3GTQ I;  1JWH C;  1Y8C A;  3D6W A;  4MD7 A;  5FLM I;  2PM9 A;  2VPW A;  2E7Z A;  3VMH A;  2DE6 A;  1VQL Z;  2OZK A;  1YUA A;  3CC2 1;  2OOX B;  1YJ9 Z;  2EGT A;  4HH4 A;  2JA7 I;  3GTK I;  1QYP A;  4A3D I;  2R6M A;  2K3R A;  1I6H I;  3CCL Z;  4A3K I;  3NH4 A;  2JIQ A;  1K73 1;  3CC4 Z;  2VPY A;  4AYB A;  1DL6 A;  2R7Z I;  3FQQ A;  1Q7Y 1;  3NFZ A;  3CCV Z;  3P5J B;  2PMZ A;  2QRD B;  2WB1 A;  3OW2 Y;  1NJI 1;  3VMI A;  1VQ7 Z;  3M4O I;  4E32 A;  3G4S Z;  4DQY B;  2ZAE B;  3FKI I;  1VQK Z;  1TWA I;  1TWH I;  4NBB A;  3MON A;  5FLX f;  3I07 A;  1QF8 A;  1VQN Z;  3J81 b;  3S2D I;  4NBH A;  1WCM I;  1S72 Z;  3CCU Z;  4HGY A;  1W2B Z;  1K8A 2;  2JA6 I;  5C4J I;  1YHQ Z;  3CCE 1;  5IP7 I;  3NDI A;  3G6E Z;  1PFT A;  3KIF A;  2AKL A;  1N2F A;  1RNI A;  3GTM I;  4E30 A;  1VQ9 Z;  3S2H I;  4BY1 I;  1VQ6 1;  2M48 A;  3CC7 1;  2JR6 A;  2JIP A;  4MD9 A;  2WAQ A;  4RVH A;  1VQM 1;  2E2I I;  3PO3 I;  3HOY I;  1YJ9 1;  1USP B;  3CCS Z;  4DK1 A;  1W2B Y;  1VQ4 Z;  3CCR 1;  3G71 Z;  1TWG I;  1K8A 1;  1VLA A;  5C44 I;  3CCV 1;  3RZO I;  1Y1V I;  1VQ7 1;  4E33 A;  3CD6 Z;  3S1R I;  2VUG A;  1X3Z A;  1SIW A;  2NAP A;  3TDH B;  4A3F I;  1YI2 Z;  2JMO A;  3CCU 1;  1K9M 2;  3GTL I;  1YIT 1;  2F4M A;  1VQ5 Z;  2NVT I;  4CL1 A;  1YHQ 1;  2I3C A;  1I3Q I;  1FDI A;  2BJO A;  1WII A;  4RVD A;  3EED A;  1ZH1 A;  3GTM S;  4Y7N I;  2LFU A;  2K5R A;  1WZN A;  3S17 I;  4MON A;  4BXX I;  1I50 I;  1JJ2 Z;  1QVF Z;  2P3Y A;  1S7M A;  3VTN A;  4A3L I;  1QVG Z;  3GTP I;  2QR1 B;  2JIR A;  1AA6 A;  3EER A;  2YAD A;  5CM2 M;  2Q4Z A;  1VQ4 1;  3I4M I;  1Q86 2;  3FQM A;  1VQ8 Z;  1R9T I;  1Y1V S;  4NBC A;  1Y1W I;  1LQL A;  3CPW Z;  3CME Z;  2RIQ A;  4XX2 A;  1YIJ Z;  4MXU A;  2VUM I;  3MZK B;  2M6N A;  3NH8 A;  1VQO Z;  1SFO I;  1JJ2 Y;  3VB9 A;  1QVF Y;  2F4O A;  1YI2 1;  1M1K 2;  3K7A I;  3I56 Z;  1L1O C;  3PO2 I;  3MZL B;  4RV9 A;  2JA5 I;  2IZ3 A;  4NBF A;  4Y52 I;  1Q81 2;  5T64 A;  2JIM A;  3BG1 B;  3JAM f;  2LIY A;  2JA8 I;  4BBS I;  3VMG A;  5A2Q f;  3CPW Y;  2LEX A;  3D9X A;  3H0G I;  1Q86 1;  4NB8 A;  3S16 I;  2QA4 Z;  3KIH A;  3I55 1;  2G2K A;  4RVG A;  3I4N I;  1KRL A;  2VPX A;  3CCJ Z;  5IT9 b;  3CQZ I;  2GTH A;  1NP6 A;  2JS4 A;  3T4N B;  3IFU A;  4MD8 A;  1VQL 1;  3S1Q I;  1M1K 1;  4A3B I;  2R93 I;  2E9H A;  3CCL 1;  2V45 A;  1RQF A;  1Q81 1;  5C4X I;  1YIJ 1;  3HOW I;  3CC4 1;  4A3C I;  2DE7 A;  2KI7 B;  1VQO 1;  2RPR A;  2AYD A;  1YJN Z;  5D1P A;  4HGZ A;  1USP A;  3I56 1;  3CCM Z;  1QXF A;  3G4S 1;  3CCQ Z;  3CMA Z;  2Q51 A;  4A3E I;  1VQK 1;  3GTJ I;  1VQN 1;  5D1O B;  4A3M I;  1Q82 2;  2QRE B;  1S72 1;  4A3G I;  1X0T A;  1RLY A;  2NVX I;  1ML8 A;  5FLX b;  1RO4 A;  3G6E 1;  3S1M I;  1KD1 2;  2GTI A;  1YJW Z;  4E2Y A;  4E2W A;  3BG0 B;  2P28 A;  4MH4 A;  3F3F C;  2OTL Z;  3J80 f;  2V8J A;  1FDO A;  1Z01 A;  5A2Q b;  3ESW A;  4X6A I;  1Z02 A;  3M3Y I;  1VQP Z;  3RZD I;  1VQ9 1;  2JIO A;  1Z03 A;  3IR7 A;  3PO3 S;  1YUK A;  3CCS 1;  1WW9 A;  4NOZ A;  2E2H I;  4NFR A;  2QEX Z;  1Q7Y 2;  3J7A 4;  4QTT A;  1Q82 1;  3GKQ A;  1N8R 2;  3F3P C;  1NJI 2;  3G71 1;  4RVF A;  1K9M 1;  2W03 A;  4E31 A;  3LUS A;  3NDJ A;  3CD6 1;  3CCQ 1;  1KD1 1;  4QTU A;  2V8I A;  1VQ6 Z;  3CC7 Z;  5T6B A;  2H85 A;  2OOY B;  3HKZ A;  5LL6 f;  1VQM Z;  1Q16 A;  4RS4 A;  1QVG Y;  1VQ5 1;  1X3W A;  2O4H A;  2Y0S A;  1YJW 1;  2OTL 1;  3CCR Z;  3S14 I;  4A3J I;  1TWF I;  2JNY A;  1NUI A;  3HOU I;  1KC8 2;  1VQP 1;  1N8R 1;  1RO2 A;  2YU9 I;  1ZB8 A;  3D2L A;  3H3V J;  1P9N A;  3J80 b;  3CXC Z;  2DE5 A;  4NBE A;  4NB9 A;  2QEX 1;  2V3V A;  2V8K A;  3QWU A;  5IP9 I;  1YIT Z;  5C3E I;  4DGL A;  3TE5 B;  2QKD A;  4S1T A;  3IX0 A;  3GCF A;  1VQ8 1;  3GTO I;  3HOV I;  3CME 1;  2E2J I;  2PK7 A;  4NBD A;  4BY7 I;  4TNU A;  3GTG I;  2VF1 A;  1M90 2;  2HU9 A;  1KC8 1;  4A3I I;  2NVY I;  3U50 C;  3HOZ I;  3CXC Y;  2OTJ Z;  2O53 A;  3NH5 A;  2RT9 A;  2W04 A;  1TFI A;  4EWC A;  2R92 I;  4MRI A;  2IV2 X;  3Q87 A;  5AN9 F;  3CC2 Z;  2KPI A;  4E2Z A;  3JAM b;  2IZ4 A;  2QA4 1;  4NH1 C;  1KQS Z;  5D1O A;  2GU2 A;  3S15 I;  5T67 A;  3CCJ 1; 
#chains in the Genus database with same CATH homology
 3J81 f;  1ZB9 A;  4NBA A;  1M90 1;  3HOX I;  2NVQ I;  2HF1 A;  3IF8 A;  2QLV B;  2QRC B;  4A93 I;  1K73 2;  1RO0 A;  2B63 I;  1TWC I;  4E2X A;  3S1N I;  4BBR I;  2J6A A;  2JUB A;  3CCE Z;  5IT9 f;  4NBG A;  1YJN 1;  2RHB A;  1KQS Y;  3CCM 1;  2OTJ 1;  3OW2 Z;  2RBL A;  3I55 Z;  3CMA 1;  1K83 I;  3GTQ I;  1JWH C;  3D6W A;  4MD7 A;  5FLM I;  2PM9 A;  3VMH A;  2DE6 A;  1VQL Z;  2OZK A;  1YUA A;  3CC2 1;  2OOX B;  1YJ9 Z;  2EGT A;  4HH4 A;  2JA7 I;  3GTK I;  1QYP A;  4A3D I;  2R6M A;  2K3R A;  1I6H I;  3CCL Z;  4A3K I;  3NH4 A;  1K73 1;  3CC4 Z;  4AYB A;  1DL6 A;  2R7Z I;  3FQQ A;  1Q7Y 1;  3NFZ A;  3CCV Z;  3P5J B;  2PMZ A;  2QRD B;  2WB1 A;  3OW2 Y;  1NJI 1;  3VMI A;  1VQ7 Z;  3M4O I;  4E32 A;  3G4S Z;  4DQY B;  2ZAE B;  3FKI I;  1VQK Z;  1TWA I;  1TWH I;  4NBB A;  3MON A;  5FLX f;  3I07 A;  1QF8 A;  1VQN Z;  3J81 b;  3S2D I;  4NBH A;  1WCM I;  1S72 Z;  3CCU Z;  4HGY A;  1W2B Z;  1K8A 2;  2JA6 I;  5C4J I;  1YHQ Z;  3CCE 1;  5IP7 I;  3NDI A;  3G6E Z;  1PFT A;  3KIF A;  2AKL A;  1N2F A;  1RNI A;  3GTM I;  4E30 A;  1VQ9 Z;  3S2H I;  4BY1 I;  1VQ6 1;  2M48 A;  3CC7 1;  2JR6 A;  4MD9 A;  2WAQ A;  4RVH A;  1VQM 1;  2E2I I;  3PO3 I;  3HOY I;  1YJ9 1;  1USP B;  3CCS Z;  4DK1 A;  1W2B Y;  1VQ4 Z;  3CCR 1;  3G71 Z;  1TWG I;  1K8A 1;  1VLA A;  5C44 I;  3CCV 1;  3RZO I;  1Y1V I;  1VQ7 1;  4E33 A;  3CD6 Z;  3S1R I;  2VUG A;  1X3Z A;  3TDH B;  4A3F I;  1YI2 Z;  2JMO A;  3CCU 1;  1K9M 2;  3GTL I;  1YIT 1;  2F4M A;  1VQ5 Z;  2NVT I;  4CL1 A;  1YHQ 1;  2I3C A;  1I3Q I;  2BJO A;  1WII A;  4RVD A;  3EED A;  1ZH1 A;  3GTM S;  4Y7N I;  2LFU A;  2K5R A;  3S17 I;  4MON A;  4BXX I;  1I50 I;  1JJ2 Z;  1QVF Z;  2P3Y A;  1S7M A;  3VTN A;  4A3L I;  1QVG Z;  3GTP I;  2QR1 B;  3EER A;  2YAD A;  5CM2 M;  2Q4Z A;  1VQ4 1;  3I4M I;  1Q86 2;  3FQM A;  1VQ8 Z;  1R9T I;  1Y1V S;  4NBC A;  1Y1W I;  1LQL A;  3CPW Z;  3CME Z;  2RIQ A;  4XX2 A;  1YIJ Z;  4MXU A;  2VUM I;  3MZK B;  2M6N A;  3NH8 A;  1VQO Z;  1SFO I;  1JJ2 Y;  3VB9 A;  1QVF Y;  2F4O A;  1YI2 1;  1M1K 2;  3K7A I;  3I56 Z;  1L1O C;  3PO2 I;  3MZL B;  4RV9 A;  2JA5 I;  2IZ3 A;  4NBF A;  4Y52 I;  1Q81 2;  5T64 A;  3BG1 B;  3JAM f;  2LIY A;  2JA8 I;  4BBS I;  3VMG A;  5A2Q f;  3CPW Y;  3D9X A;  3H0G I;  1Q86 1;  4NB8 A;  3S16 I;  2QA4 Z;  3KIH A;  3I55 1;  2G2K A;  4RVG A;  3I4N I;  1KRL A;  3CCJ Z;  5IT9 b;  3CQZ I;  2GTH A;  1NP6 A;  2JS4 A;  3T4N B;  3IFU A;  4MD8 A;  1VQL 1;  3S1Q I;  1M1K 1;  4A3B I;  2R93 I;  2E9H A;  3CCL 1;  1RQF A;  1Q81 1;  5C4X I;  1YIJ 1;  3HOW I;  3CC4 1;  4A3C I;  2DE7 A;  2KI7 B;  1VQO 1;  2RPR A;  1YJN Z;  5D1P A;  4HGZ A;  1USP A;  3I56 1;  3CCM Z;  3G4S 1;  3CCQ Z;  3CMA Z;  2Q51 A;  4A3E I;  1VQK 1;  3GTJ I;  1VQN 1;  5D1O B;  4A3M I;  1Q82 2;  2QRE B;  1S72 1;  4A3G I;  1X0T A;  1RLY A;  2NVX I;  1ML8 A;  5FLX b;  1RO4 A;  3G6E 1;  3S1M I;  1KD1 2;  2GTI A;  1YJW Z;  4E2Y A;  4E2W A;  3BG0 B;  2P28 A;  4MH4 A;  3F3F C;  2OTL Z;  3J80 f;  2V8J A;  4X6A I;  1Z01 A;  3ESW A;  5A2Q b;  1Z02 A;  3M3Y I;  1VQP Z;  3RZD I;  1VQ9 1;  1Z03 A;  3PO3 S;  1YUK A;  3CCS 1;  1WW9 A;  4NOZ A;  2E2H I;  4NFR A;  2QEX Z;  1Q7Y 2;  3J7A 4;  4QTT A;  1Q82 1;  3GKQ A;  1N8R 2;  3F3P C;  1NJI 2;  3G71 1;  4RVF A;  1K9M 1;  2W03 A;  4E31 A;  3LUS A;  3NDJ A;  3CD6 1;  3CCQ 1;  1KD1 1;  4QTU A;  2V8I A;  1VQ6 Z;  3CC7 Z;  5T6B A;  2H85 A;  2OOY B;  3HKZ A;  5LL6 f;  1VQM Z;  4RS4 A;  1QVG Y;  1VQ5 1;  1X3W A;  2O4H A;  2Y0S A;  1YJW 1;  2OTL 1;  3CCR Z;  3S14 I;  4A3J I;  1TWF I;  2JNY A;  1NUI A;  3HOU I;  1KC8 2;  1VQP 1;  1N8R 1;  1RO2 A;  2YU9 I;  1ZB8 A;  3H3V J;  1P9N A;  3J80 b;  3CXC Z;  2DE5 A;  4NBE A;  4NB9 A;  2QEX 1;  3QWU A;  2V8K A;  5IP9 I;  1YIT Z;  5C3E I;  4DGL A;  3TE5 B;  2QKD A;  4S1T A;  3IX0 A;  3GCF A;  1VQ8 1;  3GTO I;  3HOV I;  3CME 1;  2E2J I;  2PK7 A;  4NBD A;  4BY7 I;  4TNU A;  3GTG I;  2VF1 A;  1M90 2;  2HU9 A;  1KC8 1;  4A3I I;  2NVY I;  3U50 C;  3HOZ I;  3CXC Y;  2OTJ Z;  2O53 A;  3NH5 A;  2RT9 A;  2W04 A;  1TFI A;  4EWC A;  2R92 I;  4MRI A;  3Q87 A;  5AN9 F;  3CC2 Z;  2KPI A;  4E2Z A;  3JAM b;  2IZ4 A;  2QA4 1;  4NH1 C;  1KQS Z;  5D1O A;  2GU2 A;  3S15 I;  5T67 A;  3CCJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...