3CMAZ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmaZ00
3CC7Z 1VQN1 3CCEZ 1VQL1 1K9M2 2OTJ1 1VQLZ 1K8A1 3CCM1 1YITZ 2QEX1 3G4SZ 1Q812 3CCJZ 3I561 1VQO1 3CME1 1N8R2 3CCMZ 3CCVZ 2QEXZ 1S721 3CCS1 1VQM1 1VQOZ 1YJWZ 3CMEZ 1K731 1JJ2Y 1YHQZ 1YJ91 1VQ61 3CCSZ 1VQMZ 1M1K2 1KC81 3CC71 1Q7Y2 3CCE1 3CC41 1KD12 1VQ7Z 1YIJZ 1K9M1 3CC4Z 1QVFZ 1Q822 1Q862 1VQ4Z 1YIT1 3G4S1 3CCJ1 3CXCY 3CCQZ 3CCV1 1Q811 1M902 1YJW1 1QVGY 1N8R1 1YHQ1 3CPWY 3G711 1W2BY 3I55Z 1JJ2Z 3CC21 1M1K1 3G71Z 3OW2Z 1VQ5Z 3CC2Z 3CCL1 1Q7Y1 1YIJ1 1VQ71 1KD11 1VQ41 2QA4Z 3CCLZ 1NJI2 1Q821 1Q861 3CCQ1 2OTL1 3CMAZ 1YJNZ 1M901 3CD61 2OTLZ 1VQ9Z 3I551 3CCU1 3CD6Z 1VQKZ 1KQSY 1VQ51 3CCUZ 1YI21 1VQ81 3G6E1 2QA41 1YI2Z 1VQ8Z 3G6EZ 1QVFY 1VQNZ 1NJI1 1YJN1 3CMA1 2OTJZ 1K8A2 3CXCZ 1VQ91 1QVGZ 3I56Z 1VQK1 1VQP1 1K732 3CPWZ 1W2BZ 1S72Z 1KQSZ 3CCR1 1VQPZ 3OW2Y 1YJ9Z 1KC82 1VQ6Z 3CCRZ
chains in the Genus database with same CATH superfamily
3CCEZ 1K9M2 2M6NA 3PO3S 1K83I 3D6WA 2JIOA 4A3FI 3G4SZ 3TDHB 1RLYA 2V3VA 1Z01A 4NOZA 2P3YA 3CCS1 1S721 2YADA 1VQ61 1YJ91 5C44I 2Q4ZA 4RVGA 3CCSZ 3GTJI 1KD12 3IX0A 2BJOA 3JAMb 1TWAI 3RZOI 1K9M1 5IP7I 3HKZA 3LUSA 1X3ZA 2V45A 3CCQZ 4Y7NI 2DE5A 3FQQA 5C4JI 2WB1A 3CPWY 3G711 4NB9A 2JUBA 3CC21 3FQMA 2PM9A 1QF8A 3G71Z 2IV2X 3OW2Z 3QWUA 3CC2Z 2LIYA 1YIJ1 2QREB 3IFUA 1KD11 1VQ41 2QA4Z 1ML8A 4E2ZA 3J80b 2VUGA 2VPZA 2OTL1 1R9TI 3CD61 2OTLZ 3JAMf 3T4NB 2NAPA 3CD6Z 3ESWA 4NBGA 5FLXb 2HF1A 1WIIA 4CL1A 2AYDA 3S15I 1VQNZ 2Y0SA 4MD8A 4E32A 2OTJZ 1FDIA 3S1NI 4HGZA 2JIQA 1VLAA 2QRDB 3GTLI 1TFIA 1QVGZ 2JIMA 1VQK1 1K732 2P28A 5T6BA 4NBFA 3CCR1 3OW2Y 2WAQA 3H0GI 3CCRZ 4BXXI 2QKDA 3CC7Z 3GTPI 2VPXA 5LL6f 1VQL1 2PMZA 2V8KA 5C4XI 4E2WA 3NH5A 1VQLZ 2GU2A 1Y1VI 4E31A 4NBHA 5FLXf 1YITZ 1TWCI 1Q812 1VQO1 3CME1 2O4HA 1Y1VS 4RS4A 2J6AA 2B63I 4AYBA 4XX2A 1VQOZ 3CMEZ 1K731 4DK1A 2NVXI 3Q87A 3CCE1 3PO3I 1USPA 1Q862 1ZB8A 2IZ4A 2NVYI 3HOXI 3G4S1 3H3VJ 3U50C 3BG1B 3S1MI 1Q811 1I6HI 4A3DI 1QVGY 1YUKA 2JA7I 1JJ2Z 1I50I 4NBCA 4A3CI 3I07A 3GCFA 4HH4A 3GTQI 4A3EI 3S1QI 2RBLA 2GTHA 1RNIA 2OOYB 1NJI2 1Q861 1QXFA 4E2YA 3CCQ1 4RVDA 4MONA 1YJNZ 3M3YI 2K3RA 3CCU1 4E30A 1KQSY 4MD7A 5D1OB 2HU9A 2VPYA 3CCUZ 2Q51A 2JA8I 2GTIA 2QA41 1RO4A 1S7MA 4X6AI 1NJI1 4Y52I 3J81b 2KPIA 2QLVB 2JMOA 3NDIA 2E7ZA 1NP6A 1WCMI 3S14I 3S17I 4NBDA 3CXCZ 3D2LA 5IT9b 3FKII 3I56Z 3S1RI 1I3QI 5IP9I 1W2BZ 2JS4A 3HOUI 2F4MA 1KC82 1RQFA 1VQN1 4A3JI 4QTTA 4RV9A 2OTJ1 1SFOI 3HOYI 2O53A 3F3PC 3CCM1 2QEX1 3CCJZ 3CCMZ 3CCVZ 2QEXZ 4HGYA 1VQM1 1YJWZ 3VTNA 4BBSI 2E2HI 3J81f 1YHQZ 1VQMZ 1M1K2 3TE5B 1N2FA 2QR1B 1KC81 2LEXA 2ZAEB 3CC71 5FLMI 4S1TA 5IT9f 1Q7Y2 3CC41 1WW9A 3MZKB 3MZLB 1VQ7Z 5T64A 2PK7A 3CC4Z 3GTMI 1Q822 1PFTA 1YIT1 3CQZI 3GTMS 3S2DI 4BBRI 3CXCY 4NBEA 4QTUA 3I4NI 2E2JI 3S16I 2W04A 2RIQA 2IZ3A 1X3WA 1W2BY 3I55Z 3HOZI 5A2Qb 1M1K1 2NVTI 2E2II 1NUIA 2RT9A 1VQ5Z 1QYPA 3BG0B 3GKQA 1Q7Y1 4E33A 1X0TA 2AKLA 2G2KA 2JNYA 3D9XA 4A3GI 2OOXB 1Q821 3HOWI 3KIFA 3CMAZ 2JIRA 2JIPA 3GTOI 1VQ9Z 1Q16A 2DE7A 3IF8A 3NH8A 4NFRA 1YI21 1VQ81 3G6E1 4A3MI 1YI2Z 1VQ8Z 1TWHI 2QRCB 3G6EZ 3PO2I 4NB8A 5A2Qf 1YJN1 3NFZA 3GTGI 1RO0A 1K8A2 1DL6A 3NH4A 4NH1C 1ZB9A 2K5RA 4A3BI 5C3EI 4A93I 1S72Z 1SIWA 2JA5I 5T67A 3M4OI 4RVHA 1YJ9Z 1VQ6Z 2M48A 2R93I 2H85A 5D1OA 3VMHA 3MONA 3VMIA 2YU9I 4NBBA 1K8A1 1ZH1A 3I561 3S2HI 4MH4A 1P9NA 1N8R2 1YUAA 4BY1I 2F4OA 1JJ2Y 1WZNA 2RHBA 2V8IA 1FDOA 2R92I 1YIJZ 2DE6A 3NDJA 5AN9F 1QVFZ 3F3FC 1AA6A 1VQ4Z 4TNUA 2RPRA 3CCJ1 4NBAA 3RZDI 1RO2A 4A3KI 3CCV1 1M902 2W03A 1TWFI 1YJW1 1N8R1 3K7AI 1Y1WI 1YHQ1 3VMGA 4MD9A 2VPWA 3EEDA 2E9HA 1TWGI 4MXUA 4BY7I 1JWHC 1WJ2A 5D1PA 3CCL1 3I4MI 1VQ71 4E2XA 3CCLZ 3HOVI 5CM2M 2LFUA 2KI7B 2JA6I 1LQLA 1M901 4EWCA 3I551 4A3II 3J80f 2VUMI 1VQKZ 1Z03A 1L1OC 3J7A4 1VQ51 2OZKA 4A3LI 4DGLA 3IR7A 2VF1A 2V8JA 3VB9A 2R7ZI 3P5JB 2I3CA 4RVFA 1QVFY 3CMA1 1Y8CA 3KIHA 4MRIA 1VQ91 2EGTA 1VQP1 2R6MA 3CPWZ 3GTKI 2NVQI 2JR6A 1KQSZ 1VQPZ 1USPB 1KRLA 4DQYB 1Z02A 3EERA
chains in the Genus database with same CATH topology
3CCEZ 1K9M2 2M6NA 3PO3S 1K83I 3D6WA 4A3FI 3G4SZ 3TDHB 1RLYA 1Z01A 4NOZA 2P3YA 3CCS1 1S721 2YADA 1VQ61 1YJ91 5C44I 2Q4ZA 4RVGA 3CCSZ 3GTJI 1KD12 3IX0A 2BJOA 3JAMb 1TWAI 3RZOI 1K9M1 5IP7I 3HKZA 3LUSA 1X3ZA 3CCQZ 4Y7NI 2DE5A 3FQQA 5C4JI 2WB1A 3CPWY 3G711 4NB9A 2JUBA 3CC21 3FQMA 2PM9A 1QF8A 3G71Z 3OW2Z 3QWUA 3CC2Z 2LIYA 1YIJ1 2QREB 3IFUA 1KD11 1VQ41 2QA4Z 1ML8A 4E2ZA 3J80b 2VUGA 2OTL1 1R9TI 3CD61 2OTLZ 3JAMf 3T4NB 3CD6Z 3ESWA 4NBGA 5FLXb 2HF1A 1WIIA 4CL1A 3S15I 1VQNZ 2Y0SA 4MD8A 4E32A 2OTJZ 3S1NI 4HGZA 1VLAA 2QRDB 3GTLI 1TFIA 1QVGZ 1VQK1 1K732 2P28A 5T6BA 4NBFA 3CCR1 3OW2Y 2WAQA 3H0GI 3CCRZ 4BXXI 2QKDA 3CC7Z 3GTPI 5LL6f 1VQL1 2PMZA 2V8KA 5C4XI 4E2WA 3NH5A 1VQLZ 2GU2A 1Y1VI 4E31A 4NBHA 5FLXf 1YITZ 1TWCI 1Q812 1VQO1 3CME1 2O4HA 1Y1VS 4RS4A 2J6AA 2B63I 4AYBA 4XX2A 1VQOZ 3CMEZ 1K731 4DK1A 2NVXI 3Q87A 3CCE1 3PO3I 1USPA 1Q862 1ZB8A 2IZ4A 2NVYI 3HOXI 3G4S1 3H3VJ 3U50C 3BG1B 3S1MI 1Q811 1I6HI 4A3DI 1QVGY 1YUKA 2JA7I 1JJ2Z 1I50I 4NBCA 4A3CI 3I07A 3GCFA 4HH4A 3GTQI 4A3EI 3S1QI 2RBLA 2GTHA 1RNIA 2OOYB 1NJI2 1Q861 4E2YA 3CCQ1 4RVDA 4MONA 1YJNZ 3M3YI 2K3RA 3CCU1 4E30A 1KQSY 4MD7A 5D1OB 2HU9A 3CCUZ 2Q51A 2JA8I 2GTIA 2QA41 1RO4A 1S7MA 4X6AI 1NJI1 4Y52I 3J81b 2KPIA 2QLVB 2JMOA 3NDIA 1NP6A 1WCMI 3S14I 3S17I 4NBDA 3CXCZ 5IT9b 3FKII 3I56Z 3S1RI 1I3QI 5IP9I 1W2BZ 2JS4A 3HOUI 2F4MA 1KC82 1RQFA 1VQN1 4A3JI 4QTTA 4RV9A 2OTJ1 1SFOI 3HOYI 2O53A 3F3PC 3CCM1 2QEX1 3CCJZ 3CCMZ 3CCVZ 2QEXZ 4HGYA 1VQM1 1YJWZ 3VTNA 4BBSI 2E2HI 3J81f 1YHQZ 1VQMZ 1M1K2 3TE5B 1N2FA 2QR1B 1KC81 2ZAEB 3CC71 5FLMI 4S1TA 5IT9f 1Q7Y2 3CC41 1WW9A 3MZKB 3MZLB 1VQ7Z 5T64A 2PK7A 3CC4Z 3GTMI 1Q822 1PFTA 1YIT1 3CQZI 3GTMS 3S2DI 4BBRI 3CXCY 4NBEA 4QTUA 3I4NI 2E2JI 3S16I 2W04A 2RIQA 2IZ3A 1X3WA 1W2BY 3I55Z 3HOZI 5A2Qb 1M1K1 2NVTI 2E2II 1NUIA 2RT9A 1VQ5Z 1QYPA 3BG0B 3GKQA 1Q7Y1 4E33A 1X0TA 2AKLA 2G2KA 2JNYA 3D9XA 4A3GI 2OOXB 1Q821 3HOWI 3KIFA 3CMAZ 3GTOI 1VQ9Z 2DE7A 3IF8A 3NH8A 4NFRA 1YI21 1VQ81 3G6E1 4A3MI 1YI2Z 1VQ8Z 1TWHI 2QRCB 3G6EZ 3PO2I 4NB8A 5A2Qf 1YJN1 3NFZA 3GTGI 1RO0A 1K8A2 1DL6A 3NH4A 4NH1C 1ZB9A 2K5RA 4A3BI 5C3EI 4A93I 1S72Z 2JA5I 5T67A 3M4OI 4RVHA 1YJ9Z 1VQ6Z 2M48A 2R93I 2H85A 5D1OA 3VMHA 3MONA 3VMIA 2YU9I 4NBBA 1K8A1 1ZH1A 3I561 3S2HI 4MH4A 1P9NA 1N8R2 1YUAA 4BY1I 2F4OA 1JJ2Y 2RHBA 2V8IA 2R92I 1YIJZ 2DE6A 3NDJA 5AN9F 1QVFZ 3F3FC 1VQ4Z 4TNUA 2RPRA 3CCJ1 4NBAA 3RZDI 1RO2A 4A3KI 3CCV1 1M902 2W03A 1TWFI 1YJW1 1N8R1 3K7AI 1Y1WI 1YHQ1 3VMGA 4MD9A 3EEDA 2E9HA 1TWGI 4MXUA 4BY7I 1JWHC 5D1PA 3CCL1 3I4MI 1VQ71 4E2XA 3CCLZ 3HOVI 5CM2M 2LFUA 2KI7B 2JA6I 1LQLA 1M901 4EWCA 3I551 4A3II 3J80f 2VUMI 1VQKZ 1Z03A 1L1OC 3J7A4 1VQ51 2OZKA 4A3LI 4DGLA 2VF1A 2V8JA 3VB9A 2R7ZI 3P5JB 2I3CA 4RVFA 1QVFY 3CMA1 3KIHA 4MRIA 1VQ91 2EGTA 1VQP1 2R6MA 3CPWZ 3GTKI 2NVQI 2JR6A 1KQSZ 1VQPZ 1USPB 1KRLA 4DQYB 1Z02A 3EERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 Z;  1VQN 1;  3CCE Z;  1VQL 1;  1K9M 2;  2OTJ 1;  1VQL Z;  1K8A 1;  3CCM 1;  1YIT Z;  2QEX 1;  3G4S Z;  1Q81 2;  3CCJ Z;  3I56 1;  1VQO 1;  3CME 1;  1N8R 2;  3CCM Z;  3CCV Z;  2QEX Z;  1S72 1;  3CCS 1;  1VQM 1;  1VQO Z;  1YJW Z;  3CME Z;  1K73 1;  1JJ2 Y;  1YHQ Z;  1YJ9 1;  1VQ6 1;  3CCS Z;  1VQM Z;  1M1K 2;  1KC8 1;  3CC7 1;  1Q7Y 2;  3CCE 1;  3CC4 1;  1KD1 2;  1VQ7 Z;  1YIJ Z;  1K9M 1;  3CC4 Z;  1QVF Z;  1Q82 2;  1Q86 2;  1VQ4 Z;  1YIT 1;  3G4S 1;  3CCJ 1;  3CXC Y;  3CCQ Z;  3CCV 1;  1Q81 1;  1M90 2;  1YJW 1;  1QVG Y;  1N8R 1;  1YHQ 1;  3CPW Y;  3G71 1;  1W2B Y;  3I55 Z;  1JJ2 Z;  3CC2 1;  1M1K 1;  3G71 Z;  3OW2 Z;  1VQ5 Z;  3CC2 Z;  3CCL 1;  1Q7Y 1;  1YIJ 1;  1VQ7 1;  1KD1 1;  1VQ4 1;  2QA4 Z;  3CCL Z;  1NJI 2;  1Q82 1;  1Q86 1;  3CCQ 1;  2OTL 1;  3CMA Z;  1YJN Z;  1M90 1;  3CD6 1;  2OTL Z;  1VQ9 Z;  3I55 1;  3CCU 1;  3CD6 Z;  1VQK Z;  1KQS Y;  1VQ5 1;  3CCU Z;  1YI2 1;  1VQ8 1;  3G6E 1;  2QA4 1;  1YI2 Z;  1VQ8 Z;  3G6E Z;  1QVF Y;  1VQN Z;  1NJI 1;  1YJN 1;  3CMA 1;  2OTJ Z;  1K8A 2;  3CXC Z;  1VQ9 1;  1QVG Z;  3I56 Z;  1VQK 1;  1VQP 1;  1K73 2;  3CPW Z;  1W2B Z;  1S72 Z;  1KQS Z;  3CCR 1;  1VQP Z;  3OW2 Y;  1YJ9 Z;  1KC8 2;  1VQ6 Z;  3CCR Z; 
#chains in the Genus database with same CATH topology
 3CCE Z;  1K9M 2;  2M6N A;  3PO3 S;  1K83 I;  3D6W A;  2JIO A;  4A3F I;  3G4S Z;  3TDH B;  1RLY A;  2V3V A;  1Z01 A;  4NOZ A;  2P3Y A;  3CCS 1;  1S72 1;  2YAD A;  1VQ6 1;  1YJ9 1;  5C44 I;  2Q4Z A;  4RVG A;  3CCS Z;  3GTJ I;  1KD1 2;  3IX0 A;  2BJO A;  3JAM b;  1TWA I;  3RZO I;  1K9M 1;  5IP7 I;  3HKZ A;  3LUS A;  1X3Z A;  2V45 A;  3CCQ Z;  4Y7N I;  2DE5 A;  3FQQ A;  5C4J I;  2WB1 A;  3CPW Y;  3G71 1;  4NB9 A;  2JUB A;  3CC2 1;  3FQM A;  2PM9 A;  1QF8 A;  3G71 Z;  2IV2 X;  3OW2 Z;  3QWU A;  3CC2 Z;  2LIY A;  1YIJ 1;  2QRE B;  3IFU A;  1KD1 1;  1VQ4 1;  2QA4 Z;  1ML8 A;  4E2Z A;  3J80 b;  2VUG A;  2VPZ A;  2OTL 1;  1R9T I;  3CD6 1;  2OTL Z;  3JAM f;  3T4N B;  2NAP A;  3CD6 Z;  3ESW A;  4NBG A;  5FLX b;  2HF1 A;  1WII A;  4CL1 A;  2AYD A;  3S15 I;  1VQN Z;  2Y0S A;  4MD8 A;  4E32 A;  2OTJ Z;  1FDI A;  3S1N I;  4HGZ A;  2JIQ A;  1VLA A;  2QRD B;  3GTL I;  1TFI A;  1QVG Z;  2JIM A;  1VQK 1;  1K73 2;  2P28 A;  5T6B A;  4NBF A;  3CCR 1;  3OW2 Y;  2WAQ A;  3H0G I;  3CCR Z;  4BXX I;  2QKD A;  3CC7 Z;  3GTP I;  2VPX A;  5LL6 f;  1VQL 1;  2PMZ A;  2V8K A;  5C4X I;  4E2W A;  3NH5 A;  1VQL Z;  2GU2 A;  1Y1V I;  4E31 A;  4NBH A;  5FLX f;  1YIT Z;  1TWC I;  1Q81 2;  1VQO 1;  3CME 1;  2O4H A;  1Y1V S;  4RS4 A;  2J6A A;  2B63 I;  4AYB A;  4XX2 A;  1VQO Z;  3CME Z;  1K73 1;  4DK1 A;  2NVX I;  3Q87 A;  3CCE 1;  3PO3 I;  1USP A;  1Q86 2;  1ZB8 A;  2IZ4 A;  2NVY I;  3HOX I;  3G4S 1;  3H3V J;  3U50 C;  3BG1 B;  3S1M I;  1Q81 1;  1I6H I;  4A3D I;  1QVG Y;  1YUK A;  2JA7 I;  1JJ2 Z;  1I50 I;  4NBC A;  4A3C I;  3I07 A;  3GCF A;  4HH4 A;  3GTQ I;  4A3E I;  3S1Q I;  2RBL A;  2GTH A;  1RNI A;  2OOY B;  1NJI 2;  1Q86 1;  1QXF A;  4E2Y A;  3CCQ 1;  4RVD A;  4MON A;  1YJN Z;  3M3Y I;  2K3R A;  3CCU 1;  4E30 A;  1KQS Y;  4MD7 A;  5D1O B;  2HU9 A;  2VPY A;  3CCU Z;  2Q51 A;  2JA8 I;  2GTI A;  2QA4 1;  1RO4 A;  1S7M A;  4X6A I;  1NJI 1;  4Y52 I;  3J81 b;  2KPI A;  2QLV B;  2JMO A;  3NDI A;  2E7Z A;  1NP6 A;  1WCM I;  3S14 I;  3S17 I;  4NBD A;  3CXC Z;  3D2L A;  5IT9 b;  3FKI I;  3I56 Z;  3S1R I;  1I3Q I;  5IP9 I;  1W2B Z;  2JS4 A;  3HOU I;  2F4M A;  1KC8 2;  1RQF A;  1VQN 1;  4A3J I;  4QTT A;  4RV9 A;  2OTJ 1;  1SFO I;  3HOY I;  2O53 A;  3F3P C;  3CCM 1;  2QEX 1;  3CCJ Z;  3CCM Z;  3CCV Z;  2QEX Z;  4HGY A;  1VQM 1;  1YJW Z;  3VTN A;  4BBS I;  2E2H I;  3J81 f;  1YHQ Z;  1VQM Z;  1M1K 2;  3TE5 B;  1N2F A;  2QR1 B;  1KC8 1;  2LEX A;  2ZAE B;  3CC7 1;  5FLM I;  4S1T A;  5IT9 f;  1Q7Y 2;  3CC4 1;  1WW9 A;  3MZK B;  3MZL B;  1VQ7 Z;  5T64 A;  2PK7 A;  3CC4 Z;  3GTM I;  1Q82 2;  1PFT A;  1YIT 1;  3CQZ I;  3GTM S;  3S2D I;  4BBR I;  3CXC Y;  4NBE A;  4QTU A;  3I4N I;  2E2J I;  3S16 I;  2W04 A;  2RIQ A;  2IZ3 A;  1X3W A;  1W2B Y;  3I55 Z;  3HOZ I;  5A2Q b;  1M1K 1;  2NVT I;  2E2I I;  1NUI A;  2RT9 A;  1VQ5 Z;  1QYP A;  3BG0 B;  3GKQ A;  1Q7Y 1;  4E33 A;  1X0T A;  2AKL A;  2G2K A;  2JNY A;  3D9X A;  4A3G I;  2OOX B;  1Q82 1;  3HOW I;  3KIF A;  3CMA Z;  2JIR A;  2JIP A;  3GTO I;  1VQ9 Z;  1Q16 A;  2DE7 A;  3IF8 A;  3NH8 A;  4NFR A;  1YI2 1;  1VQ8 1;  3G6E 1;  4A3M I;  1YI2 Z;  1VQ8 Z;  1TWH I;  2QRC B;  3G6E Z;  3PO2 I;  4NB8 A;  5A2Q f;  1YJN 1;  3NFZ A;  3GTG I;  1RO0 A;  1K8A 2;  1DL6 A;  3NH4 A;  4NH1 C;  1ZB9 A;  2K5R A;  4A3B I;  5C3E I;  4A93 I;  1S72 Z;  1SIW A;  2JA5 I;  5T67 A;  3M4O I;  4RVH A;  1YJ9 Z;  1VQ6 Z;  2M48 A;  2R93 I;  2H85 A;  5D1O A;  3VMH A;  3MON A;  3VMI A;  2YU9 I;  4NBB A;  1K8A 1;  1ZH1 A;  3I56 1;  3S2H I;  4MH4 A;  1P9N A;  1N8R 2;  1YUA A;  4BY1 I;  2F4O A;  1JJ2 Y;  1WZN A;  2RHB A;  2V8I A;  1FDO A;  2R92 I;  1YIJ Z;  2DE6 A;  3NDJ A;  5AN9 F;  1QVF Z;  3F3F C;  1AA6 A;  1VQ4 Z;  4TNU A;  2RPR A;  3CCJ 1;  4NBA A;  3RZD I;  1RO2 A;  4A3K I;  3CCV 1;  1M90 2;  2W03 A;  1TWF I;  1YJW 1;  1N8R 1;  3K7A I;  1Y1W I;  1YHQ 1;  3VMG A;  4MD9 A;  2VPW A;  3EED A;  2E9H A;  1TWG I;  4MXU A;  4BY7 I;  1JWH C;  1WJ2 A;  5D1P A;  3CCL 1;  3I4M I;  1VQ7 1;  4E2X A;  3CCL Z;  3HOV I;  5CM2 M;  2LFU A;  2KI7 B;  2JA6 I;  1LQL A;  1M90 1;  4EWC A;  3I55 1;  4A3I I;  3J80 f;  2VUM I;  1VQK Z;  1Z03 A;  1L1O C;  3J7A 4;  1VQ5 1;  2OZK A;  4A3L I;  4DGL A;  3IR7 A;  2VF1 A;  2V8J A;  3VB9 A;  2R7Z I;  3P5J B;  2I3C A;  4RVF A;  1QVF Y;  3CMA 1;  1Y8C A;  3KIH A;  4MRI A;  1VQ9 1;  2EGT A;  1VQP 1;  2R6M A;  3CPW Z;  3GTK I;  2NVQ I;  2JR6 A;  1KQS Z;  1VQP Z;  1USP B;  1KRL A;  4DQY B;  1Z02 A;  3EER A; 
#chains in the Genus database with same CATH homology
 3CCE Z;  1K9M 2;  2M6N A;  3PO3 S;  1K83 I;  3D6W A;  4A3F I;  3G4S Z;  3TDH B;  1RLY A;  1Z01 A;  4NOZ A;  2P3Y A;  3CCS 1;  1S72 1;  2YAD A;  1VQ6 1;  1YJ9 1;  5C44 I;  2Q4Z A;  4RVG A;  3CCS Z;  3GTJ I;  1KD1 2;  3IX0 A;  2BJO A;  3JAM b;  1TWA I;  3RZO I;  1K9M 1;  5IP7 I;  3HKZ A;  3LUS A;  1X3Z A;  3CCQ Z;  4Y7N I;  2DE5 A;  3FQQ A;  5C4J I;  2WB1 A;  3CPW Y;  3G71 1;  4NB9 A;  2JUB A;  3CC2 1;  3FQM A;  2PM9 A;  1QF8 A;  3G71 Z;  3OW2 Z;  3QWU A;  3CC2 Z;  2LIY A;  1YIJ 1;  2QRE B;  3IFU A;  1KD1 1;  1VQ4 1;  2QA4 Z;  1ML8 A;  4E2Z A;  3J80 b;  2VUG A;  2OTL 1;  1R9T I;  3CD6 1;  2OTL Z;  3JAM f;  3T4N B;  3CD6 Z;  3ESW A;  4NBG A;  5FLX b;  2HF1 A;  1WII A;  4CL1 A;  3S15 I;  1VQN Z;  2Y0S A;  4MD8 A;  4E32 A;  2OTJ Z;  3S1N I;  4HGZ A;  1VLA A;  2QRD B;  3GTL I;  1TFI A;  1QVG Z;  1VQK 1;  1K73 2;  2P28 A;  5T6B A;  4NBF A;  3CCR 1;  3OW2 Y;  2WAQ A;  3H0G I;  3CCR Z;  4BXX I;  2QKD A;  3CC7 Z;  3GTP I;  5LL6 f;  1VQL 1;  2PMZ A;  2V8K A;  5C4X I;  4E2W A;  3NH5 A;  1VQL Z;  2GU2 A;  1Y1V I;  4E31 A;  4NBH A;  5FLX f;  1YIT Z;  1TWC I;  1Q81 2;  1VQO 1;  3CME 1;  2O4H A;  1Y1V S;  4RS4 A;  2J6A A;  2B63 I;  4AYB A;  4XX2 A;  1VQO Z;  3CME Z;  1K73 1;  4DK1 A;  2NVX I;  3Q87 A;  3CCE 1;  3PO3 I;  1USP A;  1Q86 2;  1ZB8 A;  2IZ4 A;  2NVY I;  3HOX I;  3G4S 1;  3H3V J;  3U50 C;  3BG1 B;  3S1M I;  1Q81 1;  1I6H I;  4A3D I;  1QVG Y;  1YUK A;  2JA7 I;  1JJ2 Z;  1I50 I;  4NBC A;  4A3C I;  3I07 A;  3GCF A;  4HH4 A;  3GTQ I;  4A3E I;  3S1Q I;  2RBL A;  2GTH A;  1RNI A;  2OOY B;  1NJI 2;  1Q86 1;  4E2Y A;  3CCQ 1;  4RVD A;  4MON A;  1YJN Z;  3M3Y I;  2K3R A;  3CCU 1;  4E30 A;  1KQS Y;  4MD7 A;  5D1O B;  2HU9 A;  3CCU Z;  2Q51 A;  2JA8 I;  2GTI A;  2QA4 1;  1RO4 A;  1S7M A;  4X6A I;  1NJI 1;  4Y52 I;  3J81 b;  2KPI A;  2QLV B;  2JMO A;  3NDI A;  1NP6 A;  1WCM I;  3S14 I;  3S17 I;  4NBD A;  3CXC Z;  5IT9 b;  3FKI I;  3I56 Z;  3S1R I;  1I3Q I;  5IP9 I;  1W2B Z;  2JS4 A;  3HOU I;  2F4M A;  1KC8 2;  1RQF A;  1VQN 1;  4A3J I;  4QTT A;  4RV9 A;  2OTJ 1;  1SFO I;  3HOY I;  2O53 A;  3F3P C;  3CCM 1;  2QEX 1;  3CCJ Z;  3CCM Z;  3CCV Z;  2QEX Z;  4HGY A;  1VQM 1;  1YJW Z;  3VTN A;  4BBS I;  2E2H I;  3J81 f;  1YHQ Z;  1VQM Z;  1M1K 2;  3TE5 B;  1N2F A;  2QR1 B;  1KC8 1;  2ZAE B;  3CC7 1;  5FLM I;  4S1T A;  5IT9 f;  1Q7Y 2;  3CC4 1;  1WW9 A;  3MZK B;  3MZL B;  1VQ7 Z;  5T64 A;  2PK7 A;  3CC4 Z;  3GTM I;  1Q82 2;  1PFT A;  1YIT 1;  3CQZ I;  3GTM S;  3S2D I;  4BBR I;  3CXC Y;  4NBE A;  4QTU A;  3I4N I;  2E2J I;  3S16 I;  2W04 A;  2RIQ A;  2IZ3 A;  1X3W A;  1W2B Y;  3I55 Z;  3HOZ I;  5A2Q b;  1M1K 1;  2NVT I;  2E2I I;  1NUI A;  2RT9 A;  1VQ5 Z;  1QYP A;  3BG0 B;  3GKQ A;  1Q7Y 1;  4E33 A;  1X0T A;  2AKL A;  2G2K A;  2JNY A;  3D9X A;  4A3G I;  2OOX B;  1Q82 1;  3HOW I;  3KIF A;  3CMA Z;  3GTO I;  1VQ9 Z;  2DE7 A;  3IF8 A;  3NH8 A;  4NFR A;  1YI2 1;  1VQ8 1;  3G6E 1;  4A3M I;  1YI2 Z;  1VQ8 Z;  1TWH I;  2QRC B;  3G6E Z;  3PO2 I;  4NB8 A;  5A2Q f;  1YJN 1;  3NFZ A;  3GTG I;  1RO0 A;  1K8A 2;  1DL6 A;  3NH4 A;  4NH1 C;  1ZB9 A;  2K5R A;  4A3B I;  5C3E I;  4A93 I;  1S72 Z;  2JA5 I;  5T67 A;  3M4O I;  4RVH A;  1YJ9 Z;  1VQ6 Z;  2M48 A;  2R93 I;  2H85 A;  5D1O A;  3VMH A;  3MON A;  3VMI A;  2YU9 I;  4NBB A;  1K8A 1;  1ZH1 A;  3I56 1;  3S2H I;  4MH4 A;  1P9N A;  1N8R 2;  1YUA A;  4BY1 I;  2F4O A;  1JJ2 Y;  2RHB A;  2V8I A;  2R92 I;  1YIJ Z;  2DE6 A;  3NDJ A;  5AN9 F;  1QVF Z;  3F3F C;  1VQ4 Z;  4TNU A;  2RPR A;  3CCJ 1;  4NBA A;  3RZD I;  1RO2 A;  4A3K I;  3CCV 1;  1M90 2;  2W03 A;  1TWF I;  1YJW 1;  1N8R 1;  3K7A I;  1Y1W I;  1YHQ 1;  3VMG A;  4MD9 A;  3EED A;  2E9H A;  1TWG I;  4MXU A;  4BY7 I;  1JWH C;  5D1P A;  3CCL 1;  3I4M I;  1VQ7 1;  4E2X A;  3CCL Z;  3HOV I;  5CM2 M;  2LFU A;  2KI7 B;  2JA6 I;  1LQL A;  1M90 1;  4EWC A;  3I55 1;  4A3I I;  3J80 f;  2VUM I;  1VQK Z;  1Z03 A;  1L1O C;  3J7A 4;  1VQ5 1;  2OZK A;  4A3L I;  4DGL A;  2VF1 A;  2V8J A;  3VB9 A;  2R7Z I;  3P5J B;  2I3C A;  4RVF A;  1QVF Y;  3CMA 1;  3KIH A;  4MRI A;  1VQ9 1;  2EGT A;  1VQP 1;  2R6M A;  3CPW Z;  3GTK I;  2NVQ I;  2JR6 A;  1KQS Z;  1VQP Z;  1USP B;  1KRL A;  4DQY B;  1Z02 A;  3EER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...