3CMAZ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmaZ00
3G6E1 1K8A1 1QVFZ 1KQSY 2QA4Z 1QVGY 3CCSZ 3CCJ1 1Q811 3I56Z 3CCRZ 1VQMZ 1VQP1 1YJ9Z 1YJN1 1KC81 1VQ7Z 1YIJZ 3CPWZ 1M1K1 1JJ2Y 2QA41 3CC2Z 3CCS1 3I561 2OTJZ 1Q7Y1 3CCR1 1M901 1VQNZ 1VQ6Z 1VQM1 1K8A2 1YJ91 1YITZ 1VQ71 3CD6Z 1VQ4Z 1Q812 1YIJ1 3CXCY 1S72Z 3CCVZ 1KD11 3CC21 1K9M1 1YHQZ 3G4SZ 1N8R1 2OTJ1 3CCMZ 1KC82 1VQ9Z 3CMEZ 1YI2Z 1VQN1 1VQ61 2QEXZ 1Q861 1M1K2 1YIT1 1NJI1 3CD61 3CC4Z 1VQ41 1VQKZ 1VQOZ 2OTLZ 1S721 1Q7Y2 1VQ8Z 3CCV1 1M902 1QVFY 3CCEZ 3G4S1 1YHQ1 1YJWZ 3CCM1 3CCQZ 1VQ91 3CME1 1YI21 1W2BZ 3G71Z 2QEX1 3CCUZ 3CCLZ 3OW2Z 1KD12 3CC41 1VQLZ 1K9M2 1VQK1 1N8R2 1VQO1 2OTL1 1VQ81 1VQ5Z 1K731 3CPWY 3CMAZ 1KQSZ 3CCE1 1QVGZ 1YJW1 1Q862 3CCQ1 1Q821 1NJI2 3G711 3CCL1 3CCU1 3CC7Z 1VQL1 1VQ51 1JJ2Z 3CMA1 3I55Z 1K732 3CC71 3G6EZ 1Q822 3CXCZ 3I551 3CCJZ 1W2BY 1VQPZ 3OW2Y 1YJNZ
chains in the Genus database with same CATH superfamily
3NH5A 3G6E1 3RZOI 1X0TA 3GTLI 3K7AI 3VMIA 1K8A1 4A3CI 1QVGY 3J81f 3S16I 1Q811 2E2JI 1X3ZA 2JIRA 3S2DI 3CCRZ 4A3LI 2R7ZI 3IF8A 1VQMZ 5C3EI 2QRCB 3CPWZ 2RT9A 2JIMA 4MD7A 2QA41 3CCS1 4E31A 4MD9A 2OTJZ 1Q7Y1 3PO3I 5LL6f 2W03A 1VQ6Z 4A3GI 1Y1VS 3IX0A 1YJ91 1VQ71 4E2ZA 5T6BA 3S1MI 4E2WA 3GTMS 2J6AA 3CC21 2JUBA 3G4SZ 2E2II 3CCMZ 2LEXA 3BG1B 2JA6I 2V45A 1RLYA 1VQN1 2NVTI 4E32A 3S14I 1M1K2 2JR6A 1NJI1 3RZDI 1VQ41 2WB1A 3S1RI 5D1OA 1M902 4MH4A 2HF1A 2P28A 2OZKA 1YJWZ 4A3JI 3CCQZ 3CME1 1YI21 2QKDA 1R9TI 1PFTA 1USPB 1Z02A 2GU2A 3CCLZ 3F3PC 1VQO1 1VQ81 4RV9A 1SFOI 1VQ5Z 3CPWY 3CMAZ 4BXXI 1KQSZ 3H3VJ 2P3YA 3LUSA 2DE7A 3CCU1 3P5JB 3CC7Z 1I50I 1NUIA 1VQL1 4E2XA 2Q4ZA 1JJ2Z 1RO2A 4MRIA 1Q16A 1K732 4NBAA 5CM2M 3S2HI 3G6EZ 1YUKA 1WJ2A 1QXFA 3FKII 1ZB8A 2EGTA 4A93I 1Y8CA 4E30A 3HKZA 2R92I 3D9XA 1LQLA 2VPYA 1Z01A 4A3DI 1RO0A 3HOUI 3M4OI 2Y0SA 1QVFZ 1KQSY 2QA4Z 3CCSZ 1SIWA 3ESWA 3HOVI 1YJ9Z 1YJN1 2VUGA 1KC81 5C4XI 1VQ7Z 1ZH1A 1I6HI 2KI7B 1JJ2Y 2IZ3A 3CC2Z 2JIPA 5T64A 5C4JI 1N2FA 3I4NI 1VQNZ 2DE6A 3H0GI 4MONA 1RQFA 1VQ4Z 1YIJ1 1TFIA 2QREB 3J80b 4BY1I 1KD11 1N8R1 2V3VA 4HGZA 3CMEZ 1YI2Z 4RVDA 1Q861 4RVGA 1VQOZ 1S721 4XX2A 1VQ8Z 2R93I 1ML8A 1QVFY 1YHQ1 1VQ91 1USPA 3Q87A 4E2YA 1YUAA 1W2BZ 3GTQI 1Y1VI 3CCUZ 4DK1A 1FDOA 2V8KA 1VQLZ 1K9M2 2BJOA 2OOYB 2RHBA 2IV2X 4NH1C 3GTMI 3CQZI 5AN9F 1RO4A 4QTTA 5FLMI 1ZB9A 3G711 3QWUA 3S15I 3GCFA 3NFZA 3IR7A 4NBEA 4NOZA 2F4OA 2LIYA 2VUMI 2GTHA 2O4HA 4DGLA 2JA7I 2NVQI 1Y1WI 2VPWA 1QYPA 3F3FC 3NH4A 2PK7A 2HU9A 4NBFA 3VMHA 4NBBA 1Q822 3CXCZ 2ZAEB 1TWGI 4NB8A 2RPRA 3I551 2JA5I 3MZKB 1I3QI 1W2BY 3S1QI 3MONA 1YJNZ 3GTGI 3J80f 2JIOA 3I4MI 2M48A 4DQYB 3FQQA 5C44I 2NAPA 4BY7I 1Z03A 4CL1A 3T4NB 2F4MA 2JS4A 3NH8A 1YIJZ 4E33A 5T67A 1M1K1 1NP6A 5FLXf 3I561 1M901 4A3EI 1K8A2 3U50C 2IZ4A 1Q812 3CXCY 1S72Z 3M3YI 2M6NA 4AYBA 1YHQZ 2GTIA 5IT9f 1KRLA 1VQ9Z 4X6AI 1YIT1 1FDIA 3CD61 1RNIA 3HOXI 1Q7Y2 3CCV1 2B63I 3D6WA 2KPIA 3VB9A 3HOYI 3G71Z 2QEX1 4RS4A 4NBHA 3OW2Z 1TWAI 5IP9I 3CC41 2AYDA 1TWFI 1VQK1 2OTL1 4HH4A 4A3BI 2DE5A 1K731 3CCE1 2YADA 2JMOA 3S17I 1NJI2 2PMZA 4Y7NI 5A2Qb 1WCMI 2H85A 3GTJI 4NBGA 3IFUA 3TE5B 3I55Z 5FLXb 1AA6A 2LFUA 2O53A 2V8IA 5IT9b 4BBSI 3JAMb 4MXUA 4NB9A 3PO3S 3EERA 2VPZA 3GTOI 4TNUA 3FQMA 3OW2Y 2V8JA 1TWCI 3HOZI 1X3WA 2WAQA 3CCJ1 3NDJA 3I56Z 4QTUA 2QR1B 3BG0B 2OOXB 1K83I 4NBDA 4NBCA 1VQP1 2YU9I 5IP7I 2JNYA 3GTKI 3D2LA 3EEDA 3CCR1 2E7ZA 1DL6A 1VQM1 2RIQA 3I07A 1YITZ 3CD6Z 2NVXI 3CCVZ 4A3KI 2W04A 1K9M1 2K5RA 3J81b 2OTJ1 2VF1A 1KC82 4HGYA 4Y52I 1VQ61 2JA8I 2QEXZ 5A2Qf 3VMGA 2I3CA 3CC4Z 3KIHA 1VQKZ 2OTLZ 4S1TA 5D1OB 3CCEZ 3G4S1 1JWHC 2VPXA 4A3MI 2K3RA 3CCM1 2R6MA 3J7A4 1WZNA 3PO2I 4RVFA 4RVHA 4BBRI 1S7MA 1KD12 1QF8A 1N8R2 3GTPI 1QVGZ 3JAMf 1YJW1 1Q862 3CCQ1 1Q821 3MZLB 3HOWI 2RBLA 3KIFA 3CCL1 1VLAA 1TWHI 1VQ51 2G2KA 3CMA1 2NVYI 5D1PA 4MD8A 2PM9A 3GKQA 3S1NI 2QLVB 3CC71 1WW9A 1L1OC 3NDIA 2AKLA 2QRDB 2Q51A 2E2HI 4EWCA 2E9HA 4NFRA 3CCJZ 4A3FI 2JIQA 3VTNA 3TDHB 1WIIA 4A3II 1P9NA 1VQPZ
chains in the Genus database with same CATH topology
3NH5A 3G6E1 3RZOI 1X0TA 3GTLI 3K7AI 3VMIA 1K8A1 4A3CI 1QVGY 3J81f 3S16I 1Q811 2E2JI 1X3ZA 3S2DI 3CCRZ 4A3LI 2R7ZI 3IF8A 1VQMZ 5C3EI 2QRCB 3CPWZ 2RT9A 4MD7A 2QA41 3CCS1 4E31A 4MD9A 2OTJZ 1Q7Y1 3PO3I 5LL6f 2W03A 1VQ6Z 4A3GI 1Y1VS 3IX0A 1YJ91 1VQ71 4E2ZA 5T6BA 3S1MI 4E2WA 3GTMS 2J6AA 3CC21 2JUBA 3G4SZ 2E2II 3CCMZ 2JA6I 3BG1B 1RLYA 1VQN1 2NVTI 4E32A 3S14I 1M1K2 2JR6A 1NJI1 3RZDI 1VQ41 2WB1A 3S1RI 5D1OA 1M902 4MH4A 2HF1A 2P28A 2OZKA 1YJWZ 4A3JI 3CCQZ 3CME1 1YI21 2QKDA 1R9TI 1PFTA 1USPB 1Z02A 2GU2A 3CCLZ 3F3PC 1VQO1 1VQ81 4RV9A 1SFOI 1VQ5Z 3CPWY 3CMAZ 4BXXI 1KQSZ 3H3VJ 2P3YA 3LUSA 2DE7A 3CCU1 3P5JB 3CC7Z 1I50I 1NUIA 1VQL1 4E2XA 2Q4ZA 1JJ2Z 1RO2A 4MRIA 1K732 4NBAA 5CM2M 3S2HI 3G6EZ 1YUKA 3FKII 1ZB8A 2EGTA 4A93I 4E30A 2R92I 3HKZA 3D9XA 1LQLA 1Z01A 4A3DI 1RO0A 3HOUI 3M4OI 2Y0SA 1QVFZ 1KQSY 2QA4Z 3CCSZ 3ESWA 3HOVI 1YJ9Z 1YJN1 2VUGA 1KC81 5C4XI 1VQ7Z 1ZH1A 1I6HI 2KI7B 1JJ2Y 2IZ3A 3CC2Z 5T64A 5C4JI 1N2FA 3I4NI 1VQNZ 2DE6A 3H0GI 4MONA 1RQFA 1VQ4Z 1YIJ1 1TFIA 2QREB 3J80b 4BY1I 1KD11 1N8R1 4HGZA 3CMEZ 1YI2Z 4RVDA 1Q861 4RVGA 1VQOZ 1S721 4XX2A 1VQ8Z 2R93I 1ML8A 1QVFY 1YHQ1 1VQ91 1USPA 3Q87A 4E2YA 1YUAA 1W2BZ 3GTQI 1Y1VI 3CCUZ 4DK1A 2V8KA 1VQLZ 1K9M2 2BJOA 2OOYB 2RHBA 3GTMI 4NH1C 3CQZI 5AN9F 1RO4A 4QTTA 5FLMI 1ZB9A 3G711 3QWUA 3S15I 3GCFA 3NFZA 4NBEA 4NOZA 2F4OA 2LIYA 2VUMI 2GTHA 2O4HA 4DGLA 2JA7I 2NVQI 1Y1WI 1QYPA 3F3FC 3NH4A 2PK7A 2HU9A 4NBFA 3VMHA 4NBBA 1Q822 3CXCZ 2ZAEB 1TWGI 4NB8A 2RPRA 3I551 2JA5I 3MZKB 1I3QI 1W2BY 3S1QI 3MONA 1YJNZ 3GTGI 3J80f 3I4MI 2M48A 4DQYB 3FQQA 5C44I 4BY7I 1Z03A 4CL1A 3T4NB 2F4MA 2JS4A 3NH8A 1YIJZ 4E33A 5T67A 1M1K1 1NP6A 5FLXf 3I561 1M901 4A3EI 1K8A2 3U50C 2IZ4A 1Q812 3CXCY 1S72Z 3M3YI 2M6NA 4AYBA 1YHQZ 2GTIA 5IT9f 1KRLA 1VQ9Z 4X6AI 1YIT1 3CD61 1RNIA 3HOXI 1Q7Y2 3CCV1 2B63I 3D6WA 2KPIA 3VB9A 3HOYI 3G71Z 2QEX1 4RS4A 4NBHA 3OW2Z 1TWAI 5IP9I 3CC41 1TWFI 1VQK1 2OTL1 4HH4A 4A3BI 2DE5A 1K731 3CCE1 2YADA 2JMOA 3S17I 1NJI2 2PMZA 4Y7NI 5A2Qb 1WCMI 2H85A 3GTJI 4NBGA 3IFUA 3TE5B 3I55Z 5FLXb 2LFUA 2O53A 2V8IA 5IT9b 4BBSI 3JAMb 4MXUA 4NB9A 3PO3S 3EERA 3GTOI 4TNUA 3FQMA 3OW2Y 2V8JA 1TWCI 3HOZI 1X3WA 2WAQA 3CCJ1 3NDJA 3I56Z 4QTUA 2QR1B 3BG0B 2OOXB 1K83I 4NBDA 4NBCA 1VQP1 2YU9I 5IP7I 2JNYA 3GTKI 3EEDA 3CCR1 1DL6A 1VQM1 2RIQA 3I07A 1YITZ 3CD6Z 2NVXI 3CCVZ 4A3KI 2W04A 1K9M1 2K5RA 3J81b 2OTJ1 2VF1A 1KC82 4HGYA 4Y52I 1VQ61 2JA8I 2QEXZ 5A2Qf 3VMGA 2I3CA 3CC4Z 3KIHA 1VQKZ 2OTLZ 4S1TA 5D1OB 3CCEZ 3G4S1 1JWHC 4A3MI 2K3RA 3CCM1 2R6MA 3J7A4 3PO2I 4RVFA 4RVHA 4BBRI 1S7MA 1KD12 1QF8A 1N8R2 3GTPI 1QVGZ 3JAMf 1YJW1 1Q862 3CCQ1 1Q821 3MZLB 3HOWI 2RBLA 3KIFA 3CCL1 1VLAA 1TWHI 1VQ51 2G2KA 3CMA1 2NVYI 5D1PA 4MD8A 2PM9A 3GKQA 3S1NI 2QLVB 3CC71 1WW9A 1L1OC 3NDIA 2AKLA 2QRDB 2Q51A 2E2HI 4EWCA 2E9HA 4NFRA 3CCJZ 4A3FI 3VTNA 3TDHB 1WIIA 4A3II 1P9NA 1VQPZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E 1;  1K8A 1;  1QVF Z;  1KQS Y;  2QA4 Z;  1QVG Y;  3CCS Z;  3CCJ 1;  1Q81 1;  3I56 Z;  3CCR Z;  1VQM Z;  1VQP 1;  1YJ9 Z;  1YJN 1;  1KC8 1;  1VQ7 Z;  1YIJ Z;  3CPW Z;  1M1K 1;  1JJ2 Y;  2QA4 1;  3CC2 Z;  3CCS 1;  3I56 1;  2OTJ Z;  1Q7Y 1;  3CCR 1;  1M90 1;  1VQN Z;  1VQ6 Z;  1VQM 1;  1K8A 2;  1YJ9 1;  1YIT Z;  1VQ7 1;  3CD6 Z;  1VQ4 Z;  1Q81 2;  1YIJ 1;  3CXC Y;  1S72 Z;  3CCV Z;  1KD1 1;  3CC2 1;  1K9M 1;  1YHQ Z;  3G4S Z;  1N8R 1;  2OTJ 1;  3CCM Z;  1KC8 2;  1VQ9 Z;  3CME Z;  1YI2 Z;  1VQN 1;  1VQ6 1;  2QEX Z;  1Q86 1;  1M1K 2;  1YIT 1;  1NJI 1;  3CD6 1;  3CC4 Z;  1VQ4 1;  1VQK Z;  1VQO Z;  2OTL Z;  1S72 1;  1Q7Y 2;  1VQ8 Z;  3CCV 1;  1M90 2;  1QVF Y;  3CCE Z;  3G4S 1;  1YHQ 1;  1YJW Z;  3CCM 1;  3CCQ Z;  1VQ9 1;  3CME 1;  1YI2 1;  1W2B Z;  3G71 Z;  2QEX 1;  3CCU Z;  3CCL Z;  3OW2 Z;  1KD1 2;  3CC4 1;  1VQL Z;  1K9M 2;  1VQK 1;  1N8R 2;  1VQO 1;  2OTL 1;  1VQ8 1;  1VQ5 Z;  1K73 1;  3CPW Y;  3CMA Z;  1KQS Z;  3CCE 1;  1QVG Z;  1YJW 1;  1Q86 2;  3CCQ 1;  1Q82 1;  1NJI 2;  3G71 1;  3CCL 1;  3CCU 1;  3CC7 Z;  1VQL 1;  1VQ5 1;  1JJ2 Z;  3CMA 1;  3I55 Z;  1K73 2;  3CC7 1;  3G6E Z;  1Q82 2;  3CXC Z;  3I55 1;  3CCJ Z;  1W2B Y;  1VQP Z;  3OW2 Y;  1YJN Z; 
#chains in the Genus database with same CATH topology
 3NH5 A;  3G6E 1;  3RZO I;  1X0T A;  3GTL I;  3K7A I;  3VMI A;  1K8A 1;  4A3C I;  1QVG Y;  3J81 f;  3S16 I;  1Q81 1;  2E2J I;  1X3Z A;  2JIR A;  3S2D I;  3CCR Z;  4A3L I;  2R7Z I;  3IF8 A;  1VQM Z;  5C3E I;  2QRC B;  3CPW Z;  2RT9 A;  2JIM A;  4MD7 A;  2QA4 1;  3CCS 1;  4E31 A;  4MD9 A;  2OTJ Z;  1Q7Y 1;  3PO3 I;  5LL6 f;  2W03 A;  1VQ6 Z;  4A3G I;  1Y1V S;  3IX0 A;  1YJ9 1;  1VQ7 1;  4E2Z A;  5T6B A;  3S1M I;  4E2W A;  3GTM S;  2J6A A;  3CC2 1;  2JUB A;  3G4S Z;  2E2I I;  3CCM Z;  2LEX A;  3BG1 B;  2JA6 I;  2V45 A;  1RLY A;  1VQN 1;  2NVT I;  4E32 A;  3S14 I;  1M1K 2;  2JR6 A;  1NJI 1;  3RZD I;  1VQ4 1;  2WB1 A;  3S1R I;  5D1O A;  1M90 2;  4MH4 A;  2HF1 A;  2P28 A;  2OZK A;  1YJW Z;  4A3J I;  3CCQ Z;  3CME 1;  1YI2 1;  2QKD A;  1R9T I;  1PFT A;  1USP B;  1Z02 A;  2GU2 A;  3CCL Z;  3F3P C;  1VQO 1;  1VQ8 1;  4RV9 A;  1SFO I;  1VQ5 Z;  3CPW Y;  3CMA Z;  4BXX I;  1KQS Z;  3H3V J;  2P3Y A;  3LUS A;  2DE7 A;  3CCU 1;  3P5J B;  3CC7 Z;  1I50 I;  1NUI A;  1VQL 1;  4E2X A;  2Q4Z A;  1JJ2 Z;  1RO2 A;  4MRI A;  1Q16 A;  1K73 2;  4NBA A;  5CM2 M;  3S2H I;  3G6E Z;  1YUK A;  1WJ2 A;  1QXF A;  3FKI I;  1ZB8 A;  2EGT A;  4A93 I;  1Y8C A;  4E30 A;  3HKZ A;  2R92 I;  3D9X A;  1LQL A;  2VPY A;  1Z01 A;  4A3D I;  1RO0 A;  3HOU I;  3M4O I;  2Y0S A;  1QVF Z;  1KQS Y;  2QA4 Z;  3CCS Z;  1SIW A;  3ESW A;  3HOV I;  1YJ9 Z;  1YJN 1;  2VUG A;  1KC8 1;  5C4X I;  1VQ7 Z;  1ZH1 A;  1I6H I;  2KI7 B;  1JJ2 Y;  2IZ3 A;  3CC2 Z;  2JIP A;  5T64 A;  5C4J I;  1N2F A;  3I4N I;  1VQN Z;  2DE6 A;  3H0G I;  4MON A;  1RQF A;  1VQ4 Z;  1YIJ 1;  1TFI A;  2QRE B;  3J80 b;  4BY1 I;  1KD1 1;  1N8R 1;  2V3V A;  4HGZ A;  3CME Z;  1YI2 Z;  4RVD A;  1Q86 1;  4RVG A;  1VQO Z;  1S72 1;  4XX2 A;  1VQ8 Z;  2R93 I;  1ML8 A;  1QVF Y;  1YHQ 1;  1VQ9 1;  1USP A;  3Q87 A;  4E2Y A;  1YUA A;  1W2B Z;  3GTQ I;  1Y1V I;  3CCU Z;  4DK1 A;  1FDO A;  2V8K A;  1VQL Z;  1K9M 2;  2BJO A;  2OOY B;  2RHB A;  2IV2 X;  4NH1 C;  3GTM I;  3CQZ I;  5AN9 F;  1RO4 A;  4QTT A;  5FLM I;  1ZB9 A;  3G71 1;  3QWU A;  3S15 I;  3GCF A;  3NFZ A;  3IR7 A;  4NBE A;  4NOZ A;  2F4O A;  2LIY A;  2VUM I;  2GTH A;  2O4H A;  4DGL A;  2JA7 I;  2NVQ I;  1Y1W I;  2VPW A;  1QYP A;  3F3F C;  3NH4 A;  2PK7 A;  2HU9 A;  4NBF A;  3VMH A;  4NBB A;  1Q82 2;  3CXC Z;  2ZAE B;  1TWG I;  4NB8 A;  2RPR A;  3I55 1;  2JA5 I;  3MZK B;  1I3Q I;  1W2B Y;  3S1Q I;  3MON A;  1YJN Z;  3GTG I;  3J80 f;  2JIO A;  3I4M I;  2M48 A;  4DQY B;  3FQQ A;  5C44 I;  2NAP A;  4BY7 I;  1Z03 A;  4CL1 A;  3T4N B;  2F4M A;  2JS4 A;  3NH8 A;  1YIJ Z;  4E33 A;  5T67 A;  1M1K 1;  1NP6 A;  5FLX f;  3I56 1;  1M90 1;  4A3E I;  1K8A 2;  3U50 C;  2IZ4 A;  1Q81 2;  3CXC Y;  1S72 Z;  3M3Y I;  2M6N A;  4AYB A;  1YHQ Z;  2GTI A;  5IT9 f;  1KRL A;  1VQ9 Z;  4X6A I;  1YIT 1;  1FDI A;  3CD6 1;  1RNI A;  3HOX I;  1Q7Y 2;  3CCV 1;  2B63 I;  3D6W A;  2KPI A;  3VB9 A;  3HOY I;  3G71 Z;  2QEX 1;  4RS4 A;  4NBH A;  3OW2 Z;  1TWA I;  5IP9 I;  3CC4 1;  2AYD A;  1TWF I;  1VQK 1;  2OTL 1;  4HH4 A;  4A3B I;  2DE5 A;  1K73 1;  3CCE 1;  2YAD A;  2JMO A;  3S17 I;  1NJI 2;  2PMZ A;  4Y7N I;  5A2Q b;  1WCM I;  2H85 A;  3GTJ I;  4NBG A;  3IFU A;  3TE5 B;  3I55 Z;  5FLX b;  1AA6 A;  2LFU A;  2O53 A;  2V8I A;  5IT9 b;  4BBS I;  3JAM b;  4MXU A;  4NB9 A;  3PO3 S;  3EER A;  2VPZ A;  3GTO I;  4TNU A;  3FQM A;  3OW2 Y;  2V8J A;  1TWC I;  3HOZ I;  1X3W A;  2WAQ A;  3CCJ 1;  3NDJ A;  3I56 Z;  4QTU A;  2QR1 B;  3BG0 B;  2OOX B;  1K83 I;  4NBD A;  4NBC A;  1VQP 1;  2YU9 I;  5IP7 I;  2JNY A;  3GTK I;  3D2L A;  3EED A;  3CCR 1;  2E7Z A;  1DL6 A;  1VQM 1;  2RIQ A;  3I07 A;  1YIT Z;  3CD6 Z;  2NVX I;  3CCV Z;  4A3K I;  2W04 A;  1K9M 1;  2K5R A;  3J81 b;  2OTJ 1;  2VF1 A;  1KC8 2;  4HGY A;  4Y52 I;  1VQ6 1;  2JA8 I;  2QEX Z;  5A2Q f;  3VMG A;  2I3C A;  3CC4 Z;  3KIH A;  1VQK Z;  2OTL Z;  4S1T A;  5D1O B;  3CCE Z;  3G4S 1;  1JWH C;  2VPX A;  4A3M I;  2K3R A;  3CCM 1;  2R6M A;  3J7A 4;  1WZN A;  3PO2 I;  4RVF A;  4RVH A;  4BBR I;  1S7M A;  1KD1 2;  1QF8 A;  1N8R 2;  3GTP I;  1QVG Z;  3JAM f;  1YJW 1;  1Q86 2;  3CCQ 1;  1Q82 1;  3MZL B;  3HOW I;  2RBL A;  3KIF A;  3CCL 1;  1VLA A;  1TWH I;  1VQ5 1;  2G2K A;  3CMA 1;  2NVY I;  5D1P A;  4MD8 A;  2PM9 A;  3GKQ A;  3S1N I;  2QLV B;  3CC7 1;  1WW9 A;  1L1O C;  3NDI A;  2AKL A;  2QRD B;  2Q51 A;  2E2H I;  4EWC A;  2E9H A;  4NFR A;  3CCJ Z;  4A3F I;  2JIQ A;  3VTN A;  3TDH B;  1WII A;  4A3I I;  1P9N A;  1VQP Z; 
#chains in the Genus database with same CATH homology
 3NH5 A;  3G6E 1;  3RZO I;  1X0T A;  3GTL I;  3K7A I;  3VMI A;  1K8A 1;  4A3C I;  1QVG Y;  3J81 f;  3S16 I;  1Q81 1;  2E2J I;  1X3Z A;  3S2D I;  3CCR Z;  4A3L I;  2R7Z I;  3IF8 A;  1VQM Z;  5C3E I;  2QRC B;  3CPW Z;  2RT9 A;  4MD7 A;  2QA4 1;  3CCS 1;  4E31 A;  4MD9 A;  2OTJ Z;  1Q7Y 1;  3PO3 I;  5LL6 f;  2W03 A;  1VQ6 Z;  4A3G I;  1Y1V S;  3IX0 A;  1YJ9 1;  1VQ7 1;  4E2Z A;  5T6B A;  3S1M I;  4E2W A;  3GTM S;  2J6A A;  3CC2 1;  2JUB A;  3G4S Z;  2E2I I;  3CCM Z;  2JA6 I;  3BG1 B;  1RLY A;  1VQN 1;  2NVT I;  4E32 A;  3S14 I;  1M1K 2;  2JR6 A;  1NJI 1;  3RZD I;  1VQ4 1;  2WB1 A;  3S1R I;  5D1O A;  1M90 2;  4MH4 A;  2HF1 A;  2P28 A;  2OZK A;  1YJW Z;  4A3J I;  3CCQ Z;  3CME 1;  1YI2 1;  2QKD A;  1R9T I;  1PFT A;  1USP B;  1Z02 A;  2GU2 A;  3CCL Z;  3F3P C;  1VQO 1;  1VQ8 1;  4RV9 A;  1SFO I;  1VQ5 Z;  3CPW Y;  3CMA Z;  4BXX I;  1KQS Z;  3H3V J;  2P3Y A;  3LUS A;  2DE7 A;  3CCU 1;  3P5J B;  3CC7 Z;  1I50 I;  1NUI A;  1VQL 1;  4E2X A;  2Q4Z A;  1JJ2 Z;  1RO2 A;  4MRI A;  1K73 2;  4NBA A;  5CM2 M;  3S2H I;  3G6E Z;  1YUK A;  3FKI I;  1ZB8 A;  2EGT A;  4A93 I;  4E30 A;  2R92 I;  3HKZ A;  3D9X A;  1LQL A;  1Z01 A;  4A3D I;  1RO0 A;  3HOU I;  3M4O I;  2Y0S A;  1QVF Z;  1KQS Y;  2QA4 Z;  3CCS Z;  3ESW A;  3HOV I;  1YJ9 Z;  1YJN 1;  2VUG A;  1KC8 1;  5C4X I;  1VQ7 Z;  1ZH1 A;  1I6H I;  2KI7 B;  1JJ2 Y;  2IZ3 A;  3CC2 Z;  5T64 A;  5C4J I;  1N2F A;  3I4N I;  1VQN Z;  2DE6 A;  3H0G I;  4MON A;  1RQF A;  1VQ4 Z;  1YIJ 1;  1TFI A;  2QRE B;  3J80 b;  4BY1 I;  1KD1 1;  1N8R 1;  4HGZ A;  3CME Z;  1YI2 Z;  4RVD A;  1Q86 1;  4RVG A;  1VQO Z;  1S72 1;  4XX2 A;  1VQ8 Z;  2R93 I;  1ML8 A;  1QVF Y;  1YHQ 1;  1VQ9 1;  1USP A;  3Q87 A;  4E2Y A;  1YUA A;  1W2B Z;  3GTQ I;  1Y1V I;  3CCU Z;  4DK1 A;  2V8K A;  1VQL Z;  1K9M 2;  2BJO A;  2OOY B;  2RHB A;  3GTM I;  4NH1 C;  3CQZ I;  5AN9 F;  1RO4 A;  4QTT A;  5FLM I;  1ZB9 A;  3G71 1;  3QWU A;  3S15 I;  3GCF A;  3NFZ A;  4NBE A;  4NOZ A;  2F4O A;  2LIY A;  2VUM I;  2GTH A;  2O4H A;  4DGL A;  2JA7 I;  2NVQ I;  1Y1W I;  1QYP A;  3F3F C;  3NH4 A;  2PK7 A;  2HU9 A;  4NBF A;  3VMH A;  4NBB A;  1Q82 2;  3CXC Z;  2ZAE B;  1TWG I;  4NB8 A;  2RPR A;  3I55 1;  2JA5 I;  3MZK B;  1I3Q I;  1W2B Y;  3S1Q I;  3MON A;  1YJN Z;  3GTG I;  3J80 f;  3I4M I;  2M48 A;  4DQY B;  3FQQ A;  5C44 I;  4BY7 I;  1Z03 A;  4CL1 A;  3T4N B;  2F4M A;  2JS4 A;  3NH8 A;  1YIJ Z;  4E33 A;  5T67 A;  1M1K 1;  1NP6 A;  5FLX f;  3I56 1;  1M90 1;  4A3E I;  1K8A 2;  3U50 C;  2IZ4 A;  1Q81 2;  3CXC Y;  1S72 Z;  3M3Y I;  2M6N A;  4AYB A;  1YHQ Z;  2GTI A;  5IT9 f;  1KRL A;  1VQ9 Z;  4X6A I;  1YIT 1;  3CD6 1;  1RNI A;  3HOX I;  1Q7Y 2;  3CCV 1;  2B63 I;  3D6W A;  2KPI A;  3VB9 A;  3HOY I;  3G71 Z;  2QEX 1;  4RS4 A;  4NBH A;  3OW2 Z;  1TWA I;  5IP9 I;  3CC4 1;  1TWF I;  1VQK 1;  2OTL 1;  4HH4 A;  4A3B I;  2DE5 A;  1K73 1;  3CCE 1;  2YAD A;  2JMO A;  3S17 I;  1NJI 2;  2PMZ A;  4Y7N I;  5A2Q b;  1WCM I;  2H85 A;  3GTJ I;  4NBG A;  3IFU A;  3TE5 B;  3I55 Z;  5FLX b;  2LFU A;  2O53 A;  2V8I A;  5IT9 b;  4BBS I;  3JAM b;  4MXU A;  4NB9 A;  3PO3 S;  3EER A;  3GTO I;  4TNU A;  3FQM A;  3OW2 Y;  2V8J A;  1TWC I;  3HOZ I;  1X3W A;  2WAQ A;  3CCJ 1;  3NDJ A;  3I56 Z;  4QTU A;  2QR1 B;  3BG0 B;  2OOX B;  1K83 I;  4NBD A;  4NBC A;  1VQP 1;  2YU9 I;  5IP7 I;  2JNY A;  3GTK I;  3EED A;  3CCR 1;  1DL6 A;  1VQM 1;  2RIQ A;  3I07 A;  1YIT Z;  3CD6 Z;  2NVX I;  3CCV Z;  4A3K I;  2W04 A;  1K9M 1;  2K5R A;  3J81 b;  2OTJ 1;  2VF1 A;  1KC8 2;  4HGY A;  4Y52 I;  1VQ6 1;  2JA8 I;  2QEX Z;  5A2Q f;  3VMG A;  2I3C A;  3CC4 Z;  3KIH A;  1VQK Z;  2OTL Z;  4S1T A;  5D1O B;  3CCE Z;  3G4S 1;  1JWH C;  4A3M I;  2K3R A;  3CCM 1;  2R6M A;  3J7A 4;  3PO2 I;  4RVF A;  4RVH A;  4BBR I;  1S7M A;  1KD1 2;  1QF8 A;  1N8R 2;  3GTP I;  1QVG Z;  3JAM f;  1YJW 1;  1Q86 2;  3CCQ 1;  1Q82 1;  3MZL B;  3HOW I;  2RBL A;  3KIF A;  3CCL 1;  1VLA A;  1TWH I;  1VQ5 1;  2G2K A;  3CMA 1;  2NVY I;  5D1P A;  4MD8 A;  2PM9 A;  3GKQ A;  3S1N I;  2QLV B;  3CC7 1;  1WW9 A;  1L1O C;  3NDI A;  2AKL A;  2QRD B;  2Q51 A;  2E2H I;  4EWC A;  2E9H A;  4NFR A;  3CCJ Z;  4A3F I;  3VTN A;  3TDH B;  1WII A;  4A3I I;  1P9N A;  1VQP Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...