3CMAZ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmaZ00
1QVGY 3G4SZ 1M901 2OTJZ 1YHQ1 1QVFY 1VQO1 3CCUZ 1YIJZ 1YJNZ 1N8R2 1VQ41 3G71Z 1VQNZ 1VQ81 3CPWY 2QA4Z 1JJ2Y 3CMA1 3CCS1 1W2BZ 1S721 3CCQ1 1VQKZ 3I551 3CC71 1VQLZ 3CCV1 1YITZ 3CD6Z 3CC4Z 3I561 1K8A1 3CCRZ 1VQMZ 1VQ5Z 1QVFZ 3G6EZ 3CC21 1YI21 1QVGZ 3CCJZ 3CCE1 1VQ7Z 1YJ91 3CPWZ 1YIJ1 1YJN1 3CME1 1N8R1 3CCVZ 1VQ61 1VQ91 1YJW1 1VQPZ 2QEX1 3CCL1 3CMAZ 2OTL1 1Q7Y1 3CCM1 3CCU1 1Q821 2OTJ1 1VQ8Z 3CD61 1VQOZ 1M1K1 3G4S1 3OW2Z 3CCR1 3CCQZ 2QA41 3CCJ1 1Q861 1JJ2Z 1Q822 3G711 1NJI1 1KC82 1VQL1 3I56Z 1VQN1 1Q811 1YIT1 1M1K2 1S72Z 1VQK1 1VQ9Z 1YJWZ 1M902 1KQSZ 1NJI2 1K731 1YJ9Z 3CC41 1VQM1 1KC81 3CCMZ 1VQ4Z 1KD12 1Q812 3CXCY 1VQ6Z 1KQSY 1K9M1 3CCSZ 1YHQZ 2OTLZ 3CC7Z 1K732 1Q7Y2 1VQ51 1W2BY 1VQ71 3CC2Z 1KD11 1VQP1 1K8A2 3CCEZ 1K9M2 3I55Z 3CXCZ 2QEXZ 3CCLZ 3CMEZ 1Q862 3OW2Y 3G6E1 1YI2Z
chains in the Genus database with same CATH superfamily
2RPRA 2E2II 1QVGY 3G4SZ 3Q87A 1QVFY 1N8R2 1QF8A 1YJNZ 1VQ41 1TWCI 2ZAEB 2I3CA 2QA4Z 2WB1A 3JAMb 3NDIA 1W2BZ 3HOYI 1S7MA 4XX2A 1RO0A 1YUKA 2PM9A 2V8JA 5IT9f 4NBAA 4A3II 1QXFA 1K8A1 3CCRZ 4A3LI 4E33A 2V8KA 4E2XA 1Z03A 5C3EI 3CC21 3VMGA 1Q16A 4NBDA 3GTOI 1TFIA 1YJ91 3TDHB 3CME1 1VQ61 4MONA 1VQ91 1YJW1 3J7A4 3S16I 1WCMI 3RZDI 2LIYA 4EWCA 2P3YA 4A3FI 2AKLA 3D9XA 1M1K1 2QRCB 2JUBA 1Q861 3GTGI 2O4HA 3H0GI 3G711 2P28A 4A3MI 1VQN1 3GTJI 1USPB 3VB9A 2DE5A 4HH4A 4QTUA 1NJI2 2LFUA 3CC41 3CCMZ 2QLVB 1I50I 3QWUA 3ESWA 1Q812 4BY1I 1K9M1 3CCSZ 1I3QI 4MD7A 5D1PA 2OTLZ 1VQ51 2QKDA 1KD11 5LL6f 1VQP1 2O53A 5C4XI 2M48A 3CXCZ 1FDOA 3CMEZ 3J81b 2W03A 1Y1WI 3GKQA 3RZOI 5IP7I 4E31A 4NBCA 2JIPA 1YHQ1 2RBLA 3CCUZ 1YIJZ 3HOWI 1WIIA 3G71Z 3S15I 1VQ81 4NOZA 5T64A 1YUAA 2PK7A 2R92I 4HGZA 2RIQA 3VTNA 3CC71 3PO3S 3GTPI 3HOUI 3CD6Z 1RLYA 1Z02A 3CC4Z 3S14I 3I561 2R7ZI 1K83I 1TWFI 3IFUA 3D6WA 2LEXA 1TWAI 2VF1A 3S1QI 2JS4A 5FLXb 2V3VA 3EEDA 3G6EZ 1YI21 2QREB 1ZB9A 3S1RI 1RO4A 2EGTA 2JIOA 4DQYB 1YJN1 3CCVZ 5A2Qb 4RVDA 3J80f 3GTMI 2RT9A 1KRLA 3P5JB 3CCM1 1DL6A 2JIRA 1LQLA 4A93I 3S1NI 3CCJ1 5FLMI 3VMHA 1NJI1 2Q4ZA 2BJOA 3GTKI 4E2ZA 1KC82 4MRIA 4E2WA 1VQL1 2PMZA 4A3EI 1X0TA 1YIT1 3F3PC 1Q811 5AN9F 1TWHI 1TWGI 2IZ3A 2K3RA 2GTHA 1X3ZA 1VQM1 1KC81 2JMOA 2WAQA 2VPZA 3J81f 2GU2A 3CXCY 2JR6A 1SIWA 1KQSY 3HOVI 2E2HI 3HOZI 1W2BY 3HOXI 3H3VJ 2JA7I 4NB8A 2G2KA 1K8A2 4RVFA 2V45A 1K9M2 4A3GI 3FQMA 2QEXZ 3VMIA 2OZKA 4S1TA 4BY7I 4NB9A 4NFRA 3HKZA 2OOYB 2J6AA 3I4MI 4NBBA 2W04A 3NH8A 2VUMI 2AYDA 3D2LA 3U50C 3S17I 2GTIA 1VQNZ 5T6BA 1WJ2A 2F4OA 1JJ2Y 3CMA1 1S721 3CCQ1 3I551 2JA6I 1VQLZ 2YADA 1YITZ 4Y52I 2NVQI 4A3CI 4TNUA 3MONA 1Y1VS 1JWHC 1VQMZ 3M4OI 4BBRI 5IT9b 1VQ5Z 3KIHA 5IP9I 3IR7A 4A3BI 3JAMf 2RHBA 4MD9A 1USPA 1R9TI 3CCJZ 3CCE1 1NUIA 2E7ZA 4X6AI 3CPWZ 1YIJ1 1N8R1 3MZLB 5T67A 2QEX1 4RVHA 1ML8A 1Z01A 4CL1A 3IX0A 3M3YI 1X3WA 3CCU1 3J80b 1Q821 2OTJ1 1FDIA 1VQ8Z 3CD61 4Y7NI 2KI7B 4DGLA 1RO2A 3CCR1 3OW2Z 1JJ2Z 4AYBA 2V8IA 3I56Z 1WW9A 4BXXI 1S72Z 1VQ9Z 1YJWZ 4NBFA 3T4NB 1M902 4E32A 1RNIA 1YJ9Z 3S1MI 4NBEA 1VQ4Z 2M6NA 2H85A 1KD12 1VQ6Z 1ZB8A 2NVYI 5CM2M 1YHQZ 3S2HI 3CC7Z 3FQQA 1Q7Y2 2QR1B 1VQ71 3CCEZ 2JA8I 1P9NA 3CCLZ 2KPIA 3NH4A 2Y0SA 1NP6A 3K7AI 1RQFA 3G6E1 2DE7A 3F3FC 3GTLI 2NAPA 2JA5I 2R93I 1M901 2OTJZ 1ZH1A 1VQO1 3KIFA 1I6HI 3CPWY 3I07A 2E2JI 2E9HA 2QRDB 3CCS1 1VQKZ 3GTQI 1QYPA 1Y8CA 3CCV1 1L1OC 2HF1A 2K5RA 4NH1C 1WZNA 3NFZA 2JIQA 2YU9I 3FKII 2F4MA 1QVFZ 2VPXA 4BBSI 2IZ4A 3TE5B 5C4JI 1QVGZ 4HGYA 2HU9A 2OOXB 4QTTA 1VQ7Z 3GTMS 3EERA 4E30A 5C44I 1Y1VI 1PFTA 1VQPZ 3CCL1 4A3DI 2Q51A 3CMAZ 5A2Qf 2OTL1 1Q7Y1 1SFOI 1AA6A 1VQOZ 3GCFA 3G4S1 3LUSA 3CCQZ 2QA41 3BG0B 4MXUA 3S2DI 4A3KI 1Q822 3BG1B 3PO2I 4MD8A 3MZKB 1N2FA 4RV9A 2IV2X 1M1K2 1VQK1 2NVXI 4RS4A 4MH4A 2JNYA 2VPWA 1KQSZ 2NVTI 2VUGA 1K731 3I4NI 3NDJA 2B63I 3IF8A 3CQZI 3NH5A 5D1OB 2DE6A 4E2YA 2VPYA 1K732 2JIMA 4RVGA 4NBHA 4A3JI 5FLXf 3CC2Z 3I55Z 1Q862 2R6MA 5D1OA 3OW2Y 1VLAA 4DK1A 1YI2Z 3PO3I 4NBGA
chains in the Genus database with same CATH topology
2RPRA 2E2II 1QVGY 3G4SZ 3Q87A 1QVFY 1N8R2 1QF8A 1YJNZ 1VQ41 1TWCI 2ZAEB 2I3CA 2QA4Z 2WB1A 3JAMb 3NDIA 1W2BZ 3HOYI 1S7MA 4XX2A 1RO0A 1YUKA 2PM9A 2V8JA 5IT9f 4NBAA 4A3II 1K8A1 3CCRZ 4A3LI 4E33A 2V8KA 4E2XA 1Z03A 5C3EI 3CC21 3VMGA 4NBDA 3GTOI 1TFIA 1YJ91 3TDHB 3CME1 1VQ61 4MONA 1VQ91 1YJW1 3J7A4 3S16I 1WCMI 3RZDI 2LIYA 4EWCA 2P3YA 4A3FI 2AKLA 3D9XA 1M1K1 2QRCB 2JUBA 1Q861 3GTGI 2O4HA 3H0GI 3G711 2P28A 4A3MI 1VQN1 3GTJI 1USPB 3VB9A 2DE5A 4HH4A 4QTUA 1NJI2 2LFUA 3CC41 3CCMZ 2QLVB 1I50I 3QWUA 3ESWA 1Q812 4BY1I 1K9M1 3CCSZ 1I3QI 4MD7A 5D1PA 2OTLZ 1VQ51 2QKDA 1KD11 5LL6f 1VQP1 2O53A 5C4XI 2M48A 3CXCZ 3CMEZ 3J81b 2W03A 1Y1WI 3GKQA 3RZOI 5IP7I 4E31A 4NBCA 1YHQ1 2RBLA 3CCUZ 1YIJZ 3HOWI 1WIIA 3G71Z 3S15I 1VQ81 4NOZA 5T64A 1YUAA 2PK7A 2R92I 4HGZA 2RIQA 3VTNA 3CC71 3PO3S 3GTPI 3HOUI 3CD6Z 1RLYA 1Z02A 3CC4Z 3S14I 3I561 2R7ZI 1K83I 1TWFI 3IFUA 3D6WA 1TWAI 2VF1A 3S1QI 2JS4A 5FLXb 3EEDA 3G6EZ 1YI21 2QREB 1ZB9A 3S1RI 1RO4A 2EGTA 4DQYB 1YJN1 3CCVZ 5A2Qb 4RVDA 3J80f 3GTMI 2RT9A 1KRLA 3P5JB 3CCM1 1DL6A 1LQLA 4A93I 3S1NI 3CCJ1 5FLMI 3VMHA 1NJI1 2Q4ZA 2BJOA 3GTKI 4E2ZA 1KC82 4MRIA 4E2WA 1VQL1 2PMZA 4A3EI 1X0TA 1YIT1 3F3PC 1Q811 5AN9F 1TWHI 1TWGI 2IZ3A 2K3RA 2GTHA 1X3ZA 1VQM1 1KC81 2JMOA 2WAQA 3J81f 2GU2A 3CXCY 2JR6A 1KQSY 3HOVI 2E2HI 3HOZI 1W2BY 3HOXI 3H3VJ 2JA7I 4NB8A 2G2KA 1K8A2 4RVFA 1K9M2 4A3GI 3FQMA 2QEXZ 3VMIA 2OZKA 4S1TA 4BY7I 4NB9A 4NFRA 3HKZA 2OOYB 2J6AA 3I4MI 4NBBA 2W04A 3NH8A 2VUMI 3U50C 3S17I 2GTIA 1VQNZ 5T6BA 2F4OA 1JJ2Y 3CMA1 1S721 3CCQ1 3I551 2JA6I 1VQLZ 2YADA 1YITZ 4Y52I 2NVQI 4A3CI 4TNUA 3MONA 1Y1VS 1JWHC 1VQMZ 3M4OI 4BBRI 5IT9b 1VQ5Z 3KIHA 5IP9I 4A3BI 3JAMf 2RHBA 4MD9A 1USPA 1R9TI 3CCJZ 3CCE1 1NUIA 4X6AI 3CPWZ 1YIJ1 1N8R1 3MZLB 5T67A 2QEX1 4RVHA 1ML8A 1Z01A 4CL1A 3IX0A 3M3YI 1X3WA 3CCU1 3J80b 1Q821 2OTJ1 1VQ8Z 3CD61 4Y7NI 2KI7B 4DGLA 1RO2A 3CCR1 3OW2Z 1JJ2Z 4AYBA 2V8IA 3I56Z 1WW9A 4BXXI 1S72Z 1VQ9Z 1YJWZ 4NBFA 3T4NB 1M902 4E32A 1RNIA 1YJ9Z 3S1MI 4NBEA 1VQ4Z 2M6NA 2H85A 1KD12 1VQ6Z 1ZB8A 2NVYI 5CM2M 1YHQZ 3S2HI 3CC7Z 1Q7Y2 3FQQA 2QR1B 1VQ71 3CCEZ 2JA8I 1P9NA 3CCLZ 2KPIA 3NH4A 2Y0SA 1NP6A 3K7AI 1RQFA 3G6E1 2DE7A 3F3FC 3GTLI 2JA5I 2R93I 1M901 2OTJZ 1ZH1A 1VQO1 3KIFA 1I6HI 3CPWY 3I07A 2E2JI 2E9HA 2QRDB 3CCS1 1VQKZ 3GTQI 1QYPA 3CCV1 1L1OC 2HF1A 2K5RA 4NH1C 3NFZA 2YU9I 3FKII 2F4MA 1QVFZ 4BBSI 2IZ4A 3TE5B 5C4JI 1QVGZ 4HGYA 2HU9A 2OOXB 4QTTA 1VQ7Z 3GTMS 3EERA 4E30A 5C44I 1Y1VI 1PFTA 1VQPZ 3CCL1 4A3DI 2Q51A 3CMAZ 5A2Qf 2OTL1 1Q7Y1 1SFOI 1VQOZ 3GCFA 3G4S1 3LUSA 3CCQZ 2QA41 3BG0B 4MXUA 3S2DI 4A3KI 1Q822 3BG1B 3PO2I 4MD8A 3MZKB 1N2FA 4RV9A 1M1K2 1VQK1 2NVXI 4RS4A 4MH4A 2JNYA 1KQSZ 2NVTI 2VUGA 1K731 3I4NI 3NDJA 2B63I 3IF8A 3CQZI 3NH5A 5D1OB 2DE6A 4E2YA 1K732 4RVGA 4NBHA 4A3JI 5FLXf 3CC2Z 3I55Z 1Q862 2R6MA 5D1OA 3OW2Y 1VLAA 4DK1A 1YI2Z 3PO3I 4NBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG Y;  3G4S Z;  1M90 1;  2OTJ Z;  1YHQ 1;  1QVF Y;  1VQO 1;  3CCU Z;  1YIJ Z;  1YJN Z;  1N8R 2;  1VQ4 1;  3G71 Z;  1VQN Z;  1VQ8 1;  3CPW Y;  2QA4 Z;  1JJ2 Y;  3CMA 1;  3CCS 1;  1W2B Z;  1S72 1;  3CCQ 1;  1VQK Z;  3I55 1;  3CC7 1;  1VQL Z;  3CCV 1;  1YIT Z;  3CD6 Z;  3CC4 Z;  3I56 1;  1K8A 1;  3CCR Z;  1VQM Z;  1VQ5 Z;  1QVF Z;  3G6E Z;  3CC2 1;  1YI2 1;  1QVG Z;  3CCJ Z;  3CCE 1;  1VQ7 Z;  1YJ9 1;  3CPW Z;  1YIJ 1;  1YJN 1;  3CME 1;  1N8R 1;  3CCV Z;  1VQ6 1;  1VQ9 1;  1YJW 1;  1VQP Z;  2QEX 1;  3CCL 1;  3CMA Z;  2OTL 1;  1Q7Y 1;  3CCM 1;  3CCU 1;  1Q82 1;  2OTJ 1;  1VQ8 Z;  3CD6 1;  1VQO Z;  1M1K 1;  3G4S 1;  3OW2 Z;  3CCR 1;  3CCQ Z;  2QA4 1;  3CCJ 1;  1Q86 1;  1JJ2 Z;  1Q82 2;  3G71 1;  1NJI 1;  1KC8 2;  1VQL 1;  3I56 Z;  1VQN 1;  1Q81 1;  1YIT 1;  1M1K 2;  1S72 Z;  1VQK 1;  1VQ9 Z;  1YJW Z;  1M90 2;  1KQS Z;  1NJI 2;  1K73 1;  1YJ9 Z;  3CC4 1;  1VQM 1;  1KC8 1;  3CCM Z;  1VQ4 Z;  1KD1 2;  1Q81 2;  3CXC Y;  1VQ6 Z;  1KQS Y;  1K9M 1;  3CCS Z;  1YHQ Z;  2OTL Z;  3CC7 Z;  1K73 2;  1Q7Y 2;  1VQ5 1;  1W2B Y;  1VQ7 1;  3CC2 Z;  1KD1 1;  1VQP 1;  1K8A 2;  3CCE Z;  1K9M 2;  3I55 Z;  3CXC Z;  2QEX Z;  3CCL Z;  3CME Z;  1Q86 2;  3OW2 Y;  3G6E 1;  1YI2 Z; 
#chains in the Genus database with same CATH topology
 2RPR A;  2E2I I;  1QVG Y;  3G4S Z;  3Q87 A;  1QVF Y;  1N8R 2;  1QF8 A;  1YJN Z;  1VQ4 1;  1TWC I;  2ZAE B;  2I3C A;  2QA4 Z;  2WB1 A;  3JAM b;  3NDI A;  1W2B Z;  3HOY I;  1S7M A;  4XX2 A;  1RO0 A;  1YUK A;  2PM9 A;  2V8J A;  5IT9 f;  4NBA A;  4A3I I;  1QXF A;  1K8A 1;  3CCR Z;  4A3L I;  4E33 A;  2V8K A;  4E2X A;  1Z03 A;  5C3E I;  3CC2 1;  3VMG A;  1Q16 A;  4NBD A;  3GTO I;  1TFI A;  1YJ9 1;  3TDH B;  3CME 1;  1VQ6 1;  4MON A;  1VQ9 1;  1YJW 1;  3J7A 4;  3S16 I;  1WCM I;  3RZD I;  2LIY A;  4EWC A;  2P3Y A;  4A3F I;  2AKL A;  3D9X A;  1M1K 1;  2QRC B;  2JUB A;  1Q86 1;  3GTG I;  2O4H A;  3H0G I;  3G71 1;  2P28 A;  4A3M I;  1VQN 1;  3GTJ I;  1USP B;  3VB9 A;  2DE5 A;  4HH4 A;  4QTU A;  1NJI 2;  2LFU A;  3CC4 1;  3CCM Z;  2QLV B;  1I50 I;  3QWU A;  3ESW A;  1Q81 2;  4BY1 I;  1K9M 1;  3CCS Z;  1I3Q I;  4MD7 A;  5D1P A;  2OTL Z;  1VQ5 1;  2QKD A;  1KD1 1;  5LL6 f;  1VQP 1;  2O53 A;  5C4X I;  2M48 A;  3CXC Z;  1FDO A;  3CME Z;  3J81 b;  2W03 A;  1Y1W I;  3GKQ A;  3RZO I;  5IP7 I;  4E31 A;  4NBC A;  2JIP A;  1YHQ 1;  2RBL A;  3CCU Z;  1YIJ Z;  3HOW I;  1WII A;  3G71 Z;  3S15 I;  1VQ8 1;  4NOZ A;  5T64 A;  1YUA A;  2PK7 A;  2R92 I;  4HGZ A;  2RIQ A;  3VTN A;  3CC7 1;  3PO3 S;  3GTP I;  3HOU I;  3CD6 Z;  1RLY A;  1Z02 A;  3CC4 Z;  3S14 I;  3I56 1;  2R7Z I;  1K83 I;  1TWF I;  3IFU A;  3D6W A;  2LEX A;  1TWA I;  2VF1 A;  3S1Q I;  2JS4 A;  5FLX b;  2V3V A;  3EED A;  3G6E Z;  1YI2 1;  2QRE B;  1ZB9 A;  3S1R I;  1RO4 A;  2EGT A;  2JIO A;  4DQY B;  1YJN 1;  3CCV Z;  5A2Q b;  4RVD A;  3J80 f;  3GTM I;  2RT9 A;  1KRL A;  3P5J B;  3CCM 1;  1DL6 A;  2JIR A;  1LQL A;  4A93 I;  3S1N I;  3CCJ 1;  5FLM I;  3VMH A;  1NJI 1;  2Q4Z A;  2BJO A;  3GTK I;  4E2Z A;  1KC8 2;  4MRI A;  4E2W A;  1VQL 1;  2PMZ A;  4A3E I;  1X0T A;  1YIT 1;  3F3P C;  1Q81 1;  5AN9 F;  1TWH I;  1TWG I;  2IZ3 A;  2K3R A;  2GTH A;  1X3Z A;  1VQM 1;  1KC8 1;  2JMO A;  2WAQ A;  2VPZ A;  3J81 f;  2GU2 A;  3CXC Y;  2JR6 A;  1SIW A;  1KQS Y;  3HOV I;  2E2H I;  3HOZ I;  1W2B Y;  3HOX I;  3H3V J;  2JA7 I;  4NB8 A;  2G2K A;  1K8A 2;  4RVF A;  2V45 A;  1K9M 2;  4A3G I;  3FQM A;  2QEX Z;  3VMI A;  2OZK A;  4S1T A;  4BY7 I;  4NB9 A;  4NFR A;  3HKZ A;  2OOY B;  2J6A A;  3I4M I;  4NBB A;  2W04 A;  3NH8 A;  2VUM I;  2AYD A;  3D2L A;  3U50 C;  3S17 I;  2GTI A;  1VQN Z;  5T6B A;  1WJ2 A;  2F4O A;  1JJ2 Y;  3CMA 1;  1S72 1;  3CCQ 1;  3I55 1;  2JA6 I;  1VQL Z;  2YAD A;  1YIT Z;  4Y52 I;  2NVQ I;  4A3C I;  4TNU A;  3MON A;  1Y1V S;  1JWH C;  1VQM Z;  3M4O I;  4BBR I;  5IT9 b;  1VQ5 Z;  3KIH A;  5IP9 I;  3IR7 A;  4A3B I;  3JAM f;  2RHB A;  4MD9 A;  1USP A;  1R9T I;  3CCJ Z;  3CCE 1;  1NUI A;  2E7Z A;  4X6A I;  3CPW Z;  1YIJ 1;  1N8R 1;  3MZL B;  5T67 A;  2QEX 1;  4RVH A;  1ML8 A;  1Z01 A;  4CL1 A;  3IX0 A;  3M3Y I;  1X3W A;  3CCU 1;  3J80 b;  1Q82 1;  2OTJ 1;  1FDI A;  1VQ8 Z;  3CD6 1;  4Y7N I;  2KI7 B;  4DGL A;  1RO2 A;  3CCR 1;  3OW2 Z;  1JJ2 Z;  4AYB A;  2V8I A;  3I56 Z;  1WW9 A;  4BXX I;  1S72 Z;  1VQ9 Z;  1YJW Z;  4NBF A;  3T4N B;  1M90 2;  4E32 A;  1RNI A;  1YJ9 Z;  3S1M I;  4NBE A;  1VQ4 Z;  2M6N A;  2H85 A;  1KD1 2;  1VQ6 Z;  1ZB8 A;  2NVY I;  5CM2 M;  1YHQ Z;  3S2H I;  3CC7 Z;  3FQQ A;  1Q7Y 2;  2QR1 B;  1VQ7 1;  3CCE Z;  2JA8 I;  1P9N A;  3CCL Z;  2KPI A;  3NH4 A;  2Y0S A;  1NP6 A;  3K7A I;  1RQF A;  3G6E 1;  2DE7 A;  3F3F C;  3GTL I;  2NAP A;  2JA5 I;  2R93 I;  1M90 1;  2OTJ Z;  1ZH1 A;  1VQO 1;  3KIF A;  1I6H I;  3CPW Y;  3I07 A;  2E2J I;  2E9H A;  2QRD B;  3CCS 1;  1VQK Z;  3GTQ I;  1QYP A;  1Y8C A;  3CCV 1;  1L1O C;  2HF1 A;  2K5R A;  4NH1 C;  1WZN A;  3NFZ A;  2JIQ A;  2YU9 I;  3FKI I;  2F4M A;  1QVF Z;  2VPX A;  4BBS I;  2IZ4 A;  3TE5 B;  5C4J I;  1QVG Z;  4HGY A;  2HU9 A;  2OOX B;  4QTT A;  1VQ7 Z;  3GTM S;  3EER A;  4E30 A;  5C44 I;  1Y1V I;  1PFT A;  1VQP Z;  3CCL 1;  4A3D I;  2Q51 A;  3CMA Z;  5A2Q f;  2OTL 1;  1Q7Y 1;  1SFO I;  1AA6 A;  1VQO Z;  3GCF A;  3G4S 1;  3LUS A;  3CCQ Z;  2QA4 1;  3BG0 B;  4MXU A;  3S2D I;  4A3K I;  1Q82 2;  3BG1 B;  3PO2 I;  4MD8 A;  3MZK B;  1N2F A;  4RV9 A;  2IV2 X;  1M1K 2;  1VQK 1;  2NVX I;  4RS4 A;  4MH4 A;  2JNY A;  2VPW A;  1KQS Z;  2NVT I;  2VUG A;  1K73 1;  3I4N I;  3NDJ A;  2B63 I;  3IF8 A;  3CQZ I;  3NH5 A;  5D1O B;  2DE6 A;  4E2Y A;  2VPY A;  1K73 2;  2JIM A;  4RVG A;  4NBH A;  4A3J I;  5FLX f;  3CC2 Z;  3I55 Z;  1Q86 2;  2R6M A;  5D1O A;  3OW2 Y;  1VLA A;  4DK1 A;  1YI2 Z;  3PO3 I;  4NBG A; 
#chains in the Genus database with same CATH homology
 2RPR A;  2E2I I;  1QVG Y;  3G4S Z;  3Q87 A;  1QVF Y;  1N8R 2;  1QF8 A;  1YJN Z;  1VQ4 1;  1TWC I;  2ZAE B;  2I3C A;  2QA4 Z;  2WB1 A;  3JAM b;  3NDI A;  1W2B Z;  3HOY I;  1S7M A;  4XX2 A;  1RO0 A;  1YUK A;  2PM9 A;  2V8J A;  5IT9 f;  4NBA A;  4A3I I;  1K8A 1;  3CCR Z;  4A3L I;  4E33 A;  2V8K A;  4E2X A;  1Z03 A;  5C3E I;  3CC2 1;  3VMG A;  4NBD A;  3GTO I;  1TFI A;  1YJ9 1;  3TDH B;  3CME 1;  1VQ6 1;  4MON A;  1VQ9 1;  1YJW 1;  3J7A 4;  3S16 I;  1WCM I;  3RZD I;  2LIY A;  4EWC A;  2P3Y A;  4A3F I;  2AKL A;  3D9X A;  1M1K 1;  2QRC B;  2JUB A;  1Q86 1;  3GTG I;  2O4H A;  3H0G I;  3G71 1;  2P28 A;  4A3M I;  1VQN 1;  3GTJ I;  1USP B;  3VB9 A;  2DE5 A;  4HH4 A;  4QTU A;  1NJI 2;  2LFU A;  3CC4 1;  3CCM Z;  2QLV B;  1I50 I;  3QWU A;  3ESW A;  1Q81 2;  4BY1 I;  1K9M 1;  3CCS Z;  1I3Q I;  4MD7 A;  5D1P A;  2OTL Z;  1VQ5 1;  2QKD A;  1KD1 1;  5LL6 f;  1VQP 1;  2O53 A;  5C4X I;  2M48 A;  3CXC Z;  3CME Z;  3J81 b;  2W03 A;  1Y1W I;  3GKQ A;  3RZO I;  5IP7 I;  4E31 A;  4NBC A;  1YHQ 1;  2RBL A;  3CCU Z;  1YIJ Z;  3HOW I;  1WII A;  3G71 Z;  3S15 I;  1VQ8 1;  4NOZ A;  5T64 A;  1YUA A;  2PK7 A;  2R92 I;  4HGZ A;  2RIQ A;  3VTN A;  3CC7 1;  3PO3 S;  3GTP I;  3HOU I;  3CD6 Z;  1RLY A;  1Z02 A;  3CC4 Z;  3S14 I;  3I56 1;  2R7Z I;  1K83 I;  1TWF I;  3IFU A;  3D6W A;  1TWA I;  2VF1 A;  3S1Q I;  2JS4 A;  5FLX b;  3EED A;  3G6E Z;  1YI2 1;  2QRE B;  1ZB9 A;  3S1R I;  1RO4 A;  2EGT A;  4DQY B;  1YJN 1;  3CCV Z;  5A2Q b;  4RVD A;  3J80 f;  3GTM I;  2RT9 A;  1KRL A;  3P5J B;  3CCM 1;  1DL6 A;  1LQL A;  4A93 I;  3S1N I;  3CCJ 1;  5FLM I;  3VMH A;  1NJI 1;  2Q4Z A;  2BJO A;  3GTK I;  4E2Z A;  1KC8 2;  4MRI A;  4E2W A;  1VQL 1;  2PMZ A;  4A3E I;  1X0T A;  1YIT 1;  3F3P C;  1Q81 1;  5AN9 F;  1TWH I;  1TWG I;  2IZ3 A;  2K3R A;  2GTH A;  1X3Z A;  1VQM 1;  1KC8 1;  2JMO A;  2WAQ A;  3J81 f;  2GU2 A;  3CXC Y;  2JR6 A;  1KQS Y;  3HOV I;  2E2H I;  3HOZ I;  1W2B Y;  3HOX I;  3H3V J;  2JA7 I;  4NB8 A;  2G2K A;  1K8A 2;  4RVF A;  1K9M 2;  4A3G I;  3FQM A;  2QEX Z;  3VMI A;  2OZK A;  4S1T A;  4BY7 I;  4NB9 A;  4NFR A;  3HKZ A;  2OOY B;  2J6A A;  3I4M I;  4NBB A;  2W04 A;  3NH8 A;  2VUM I;  3U50 C;  3S17 I;  2GTI A;  1VQN Z;  5T6B A;  2F4O A;  1JJ2 Y;  3CMA 1;  1S72 1;  3CCQ 1;  3I55 1;  2JA6 I;  1VQL Z;  2YAD A;  1YIT Z;  4Y52 I;  2NVQ I;  4A3C I;  4TNU A;  3MON A;  1Y1V S;  1JWH C;  1VQM Z;  3M4O I;  4BBR I;  5IT9 b;  1VQ5 Z;  3KIH A;  5IP9 I;  4A3B I;  3JAM f;  2RHB A;  4MD9 A;  1USP A;  1R9T I;  3CCJ Z;  3CCE 1;  1NUI A;  4X6A I;  3CPW Z;  1YIJ 1;  1N8R 1;  3MZL B;  5T67 A;  2QEX 1;  4RVH A;  1ML8 A;  1Z01 A;  4CL1 A;  3IX0 A;  3M3Y I;  1X3W A;  3CCU 1;  3J80 b;  1Q82 1;  2OTJ 1;  1VQ8 Z;  3CD6 1;  4Y7N I;  2KI7 B;  4DGL A;  1RO2 A;  3CCR 1;  3OW2 Z;  1JJ2 Z;  4AYB A;  2V8I A;  3I56 Z;  1WW9 A;  4BXX I;  1S72 Z;  1VQ9 Z;  1YJW Z;  4NBF A;  3T4N B;  1M90 2;  4E32 A;  1RNI A;  1YJ9 Z;  3S1M I;  4NBE A;  1VQ4 Z;  2M6N A;  2H85 A;  1KD1 2;  1VQ6 Z;  1ZB8 A;  2NVY I;  5CM2 M;  1YHQ Z;  3S2H I;  3CC7 Z;  1Q7Y 2;  3FQQ A;  2QR1 B;  1VQ7 1;  3CCE Z;  2JA8 I;  1P9N A;  3CCL Z;  2KPI A;  3NH4 A;  2Y0S A;  1NP6 A;  3K7A I;  1RQF A;  3G6E 1;  2DE7 A;  3F3F C;  3GTL I;  2JA5 I;  2R93 I;  1M90 1;  2OTJ Z;  1ZH1 A;  1VQO 1;  3KIF A;  1I6H I;  3CPW Y;  3I07 A;  2E2J I;  2E9H A;  2QRD B;  3CCS 1;  1VQK Z;  3GTQ I;  1QYP A;  3CCV 1;  1L1O C;  2HF1 A;  2K5R A;  4NH1 C;  3NFZ A;  2YU9 I;  3FKI I;  2F4M A;  1QVF Z;  4BBS I;  2IZ4 A;  3TE5 B;  5C4J I;  1QVG Z;  4HGY A;  2HU9 A;  2OOX B;  4QTT A;  1VQ7 Z;  3GTM S;  3EER A;  4E30 A;  5C44 I;  1Y1V I;  1PFT A;  1VQP Z;  3CCL 1;  4A3D I;  2Q51 A;  3CMA Z;  5A2Q f;  2OTL 1;  1Q7Y 1;  1SFO I;  1VQO Z;  3GCF A;  3G4S 1;  3LUS A;  3CCQ Z;  2QA4 1;  3BG0 B;  4MXU A;  3S2D I;  4A3K I;  1Q82 2;  3BG1 B;  3PO2 I;  4MD8 A;  3MZK B;  1N2F A;  4RV9 A;  1M1K 2;  1VQK 1;  2NVX I;  4RS4 A;  4MH4 A;  2JNY A;  1KQS Z;  2NVT I;  2VUG A;  1K73 1;  3I4N I;  3NDJ A;  2B63 I;  3IF8 A;  3CQZ I;  3NH5 A;  5D1O B;  2DE6 A;  4E2Y A;  1K73 2;  4RVG A;  4NBH A;  4A3J I;  5FLX f;  3CC2 Z;  3I55 Z;  1Q86 2;  2R6M A;  5D1O A;  3OW2 Y;  1VLA A;  4DK1 A;  1YI2 Z;  3PO3 I;  4NBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...