3CMAZ

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cmaZ00
1K9M1 1JJ2Y 1YI21 1VQOZ 3OW2Y 1VQ8Z 3CPWY 1QVGY 1KC81 3I56Z 1N8R1 1K8A1 1VQP1 3CCE1 3CXCZ 1NJI1 3CCL1 1VQ61 1N8R2 1YHQ1 3CMA1 3CCS1 3CC7Z 1W2BY 2OTL1 3G71Z 3G6EZ 1K732 3CCR1 1VQ71 1VQ81 1VQLZ 1K9M2 1VQKZ 1VQPZ 1YJ91 1NJI2 3CC2Z 3CCLZ 2OTJZ 1QVFY 1Q812 1YHQZ 3CMAZ 3CCV1 3CC71 1VQNZ 3CCU1 2OTLZ 2QA4Z 1QVGZ 1Q821 3CCM1 1VQ51 1VQ7Z 1KC82 1VQL1 1W2BZ 1KD11 3CD61 1VQK1 3CC41 1YJ9Z 1VQ9Z 1QVFZ 1YIT1 3CCQ1 3CC21 2QEXZ 1YJNZ 1YIJZ 1YJW1 2OTJ1 1M901 3CCJ1 1KD12 1Q811 1S72Z 1Q862 3CME1 1VQ41 3CCVZ 1VQN1 3CCUZ 1KQSZ 2QA41 3I55Z 3OW2Z 1Q822 1VQMZ 1Q861 3CCMZ 3G4SZ 1Q7Y1 1VQ5Z 1M902 1YI2Z 1VQO1 3I561 3CD6Z 1K731 1Q7Y2 3CC4Z 3CCEZ 3CPWZ 1VQ91 1M1K1 1YITZ 3CCQZ 1JJ2Z 2QEX1 1YJN1 1YIJ1 1YJWZ 1VQ6Z 3CCJZ 3CXCY 1S721 1KQSY 3CCSZ 3CMEZ 1VQ4Z 3I551 1M1K2 3G711 3G6E1 1VQM1 1K8A2 3CCRZ 3G4S1
chains in the Genus database with same CATH superfamily
1K9M1 1JJ2Y 4A3MI 1VQ8Z 1QVGY 1KC81 1N8R1 2K3RA 1K8A1 2R92I 3CCE1 3IFUA 1NJI1 1VLAA 2EGTA 3S1QI 3CCL1 5C4JI 3GTLI 4QTUA 3D6WA 1Q16A 1DL6A 1WW9A 2PMZA 3GTOI 2LIYA 2P3YA 1VQLZ 5D1OA 2V3VA 2PM9A 5CM2M 1JWHC 1QVFY 1K83I 1YHQZ 2J6AA 2NVYI 3GTKI 2QA4Z 3PO3I 2QR1B 3VTNA 2GTIA 3S1MI 2H85A 3CD61 2NVTI 1YJ9Z 1VQ9Z 1QVFZ 1YIJZ 3GCFA 1RO0A 2OOYB 4Y7NI 3CCJ1 1QYPA 4A3JI 1Z01A 3FQQA 1VQ41 3I55Z 3OW2Z 3J80b 1Q822 3D9XA 4NBAA 3CCMZ 3GTQI 4NFRA 4RVGA 1Q7Y1 4RV9A 1YI2Z 1X3ZA 2LEXA 3I561 4NBEA 1Q7Y2 3CPWZ 1TWAI 3IF8A 4E2YA 1YITZ 1JJ2Z 4HH4A 1YJN1 1YIJ1 5C4XI 3TE5B 1VQ6Z 3K7AI 3JAMf 1KQSY 4A3BI 2ZAEB 3GTMI 3I551 1VQM1 2P28A 2RHBA 1TWHI 3CCRZ 3G4S1 1FDOA 3CPWY 3I56Z 4MONA 3S2HI 4BY1I 2JIPA 2R93I 3JAMb 2WB1A 5C3EI 3M3YI 3VMGA 4NBHA 3VB9A 5IP9I 4NH1C 2VPYA 2JIQA 1YHQ1 3S1RI 2VUMI 5T6BA 3PO2I 4NBCA 1WIIA 3G6EZ 2RT9A 2V8KA 3FKII 2K5RA 3RZOI 3BG0B 1I6HI 1NP6A 1Y1VI 1K9M2 4Y52I 1VQPZ 1I50I 1Z03A 1RO2A 1L1OC 2DE7A 3CCLZ 1RNIA 5FLXb 4MH4A 3CC71 2RPRA 2OTLZ 5T64A 1VQ51 2JIMA 3IX0A 1VQ7Z 3KIFA 4BBRI 1KC82 4DQYB 1VQL1 1W2BZ 1P9NA 3MONA 2F4MA 1ZH1A 2YADA 3S14I 3S1NI 2LFUA 1M901 4XX2A 1KD12 4RVHA 2JA8I 3J81b 1Q862 3S17I 3CCVZ 2QRCB 3CCUZ 1KQSZ 3HOUI 2WAQA 3H3VJ 5C44I 3MZKB 2I3CA 2R6MA 3RZDI 3GTPI 4S1TA 3CD6Z 1X3WA 1K731 3F3FC 1Z02A 4RVFA 1M1K1 1YUAA 3VMIA 2QEX1 2KPIA 3IR7A 4BY7I 3VMHA 1S721 2PK7A 3HKZA 4HGYA 3CCSZ 4A3GI 3NFZA 4HGZA 1M1K2 1ML8A 1S7MA 2QRDB 5D1PA 3OW2Y 2W03A 2NVQI 1Y8CA 1RO4A 4MD7A 3EEDA 3F3PC 3ESWA 4X6AI 3CMA1 3CCS1 2O4HA 3CC7Z 1W2BY 2OTL1 5FLMI 2KI7B 2VPZA 2R7ZI 2NVXI 1K732 4EWCA 1SIWA 2QKDA 1TWFI 4NBDA 3I4MI 1RLYA 2JMOA 1QXFA 4MD9A 4RS4A 1YJ91 4BXXI 3GKQA 2NAPA 1NJI2 3CC2Z 2OTJZ 3BG1B 3HOYI 1LQLA 5A2Qf 2HU9A 2Q51A 4NBFA 3CMAZ 2V8IA 1RQFA 4E2ZA 4QTTA 4NB8A 1VQNZ 2E2II 3T4NB 1Q821 5AN9F 2O53A 5IT9b 3CCM1 2E2JI 2IZ3A 1SFOI 4BBSI 4A3KI 1KD11 1VQK1 3CC41 2BJOA 2Q4ZA 2QEXZ 1YJNZ 1QF8A 4DK1A 1YJW1 4NBBA 4DGLA 3KIHA 2YU9I 3J7A4 5IT9f 3CME1 1TFIA 3PO3S 2QA41 2E2HI 2RIQA 3QWUA 2GTHA 2HF1A 1VQO1 4A3DI 5FLXf 1WJ2A 4A3II 4CL1A 3CCEZ 3P5JB 3M4OI 3NH4A 4AYBA 3CCQZ 1ZB8A 4TNUA 2GU2A 1WCMI 4E33A 1N2FA 4E32A 1YJWZ 3CCJZ 3CXCY 3I4NI 3Q87A 3NDJA 4NOZA 5IP7I 4E2XA 2JA5I 3EERA 3G6E1 2V45A 4MXUA 2VPWA 2VUGA 3NDIA 1USPB 1YI21 1VQOZ 2JA7I 2RBLA 3NH5A 1VQP1 2OZKA 1PFTA 3TDHB 3CXCZ 1TWCI 4E30A 1VQ61 1N8R2 2VPXA 2AKLA 3NH8A 1WZNA 3D2LA 5A2Qb 3G71Z 2JR6A 3HOZI 2JNYA 3CCR1 2F4OA 1VQ71 1I3QI 1VQ81 1VQKZ 5D1OB 2JUBA 3S2DI 2M6NA 1AA6A 4MRIA 2B63I 2W04A 1TWGI 2QLVB 1Q812 2E7ZA 1Y1WI 3CCV1 3GTGI 3CCU1 3LUSA 1QVGZ 3J81f 4A3LI 2G2KA 2JA6I 4NBGA 3HOXI 4NB9A 4A3EI 3S15I 4MD8A 3I07A 4A3CI 1X0TA 3CCQ1 1YIT1 3CC21 3HOWI 3S16I 2OTJ1 2VF1A 3H0GI 1Q811 4RVDA 1S72Z 2IV2X 4E2WA 2QREB 2OOXB 1Y1VS 1VQN1 3GTMS 2Y0SA 2AYDA 1VQMZ 1Q861 4E31A 3G4SZ 1VQ5Z 1M902 2IZ4A 2JIRA 3U50C 2M48A 3MZLB 3CC4Z 5T67A 2JIOA 1VQ91 2V8JA 1KRLA 4A3FI 1YUKA 3CQZI 2JS4A 4A93I 2E9HA 3J80f 3CMEZ 1VQ4Z 2DE5A 1FDIA 3FQMA 3HOVI 1NUIA 2DE6A 3GTJI 3G711 1ZB9A 5LL6f 1USPA 1K8A2 1R9TI
chains in the Genus database with same CATH topology
1K9M1 1JJ2Y 4A3MI 1VQ8Z 1QVGY 1KC81 1N8R1 2K3RA 1K8A1 2R92I 3CCE1 3IFUA 1NJI1 1VLAA 2EGTA 3S1QI 3CCL1 5C4JI 3GTLI 4QTUA 3D6WA 1DL6A 1WW9A 2PMZA 3GTOI 2LIYA 2P3YA 1VQLZ 5D1OA 2PM9A 5CM2M 1JWHC 1QVFY 1K83I 1YHQZ 2J6AA 2NVYI 3GTKI 2QA4Z 3PO3I 2QR1B 3VTNA 2GTIA 3S1MI 2H85A 3CD61 2NVTI 1YJ9Z 1VQ9Z 1QVFZ 1YIJZ 3GCFA 1RO0A 2OOYB 4Y7NI 3CCJ1 1QYPA 4A3JI 1Z01A 3FQQA 1VQ41 3I55Z 1Q822 3J80b 3OW2Z 3D9XA 4NBAA 3CCMZ 3GTQI 4NFRA 4RVGA 1Q7Y1 4RV9A 1YI2Z 1X3ZA 3I561 4NBEA 1Q7Y2 1TWAI 3IF8A 4E2YA 3CPWZ 1YITZ 1JJ2Z 4HH4A 1YJN1 1YIJ1 5C4XI 3TE5B 1VQ6Z 3K7AI 3JAMf 1KQSY 4A3BI 2ZAEB 3GTMI 3I551 1VQM1 2P28A 2RHBA 1TWHI 3CCRZ 3G4S1 3CPWY 3I56Z 4MONA 3S2HI 4BY1I 2R93I 3JAMb 2WB1A 5C3EI 3M3YI 3VMGA 4NBHA 3VB9A 5IP9I 4NH1C 1YHQ1 3S1RI 2VUMI 5T6BA 3PO2I 4NBCA 1WIIA 3G6EZ 2RT9A 2V8KA 3FKII 2K5RA 3RZOI 3BG0B 1I6HI 1NP6A 1Y1VI 1K9M2 4Y52I 1VQPZ 1I50I 1Z03A 1RO2A 1L1OC 2DE7A 3CCLZ 1RNIA 5FLXb 4MH4A 3CC71 2RPRA 2OTLZ 5T64A 1VQ51 3IX0A 1VQ7Z 3KIFA 4BBRI 1KC82 4DQYB 1VQL1 1W2BZ 1P9NA 3MONA 2F4MA 1ZH1A 2YADA 3S14I 3S1NI 2LFUA 1M901 4XX2A 1KD12 4RVHA 2JA8I 3J81b 1Q862 3S17I 3CCVZ 2QRCB 3CCUZ 1KQSZ 3HOUI 2WAQA 3H3VJ 5C44I 3MZKB 2I3CA 2R6MA 3RZDI 3GTPI 4S1TA 3CD6Z 1X3WA 1K731 3F3FC 1Z02A 4RVFA 1M1K1 1YUAA 3VMIA 2QEX1 2KPIA 4BY7I 3VMHA 1S721 2PK7A 3HKZA 4HGYA 3CCSZ 4A3GI 3NFZA 4HGZA 1M1K2 1ML8A 1S7MA 2QRDB 5D1PA 3OW2Y 2W03A 2NVQI 1RO4A 4MD7A 3EEDA 3F3PC 3ESWA 4X6AI 3CMA1 3CCS1 2O4HA 3CC7Z 1W2BY 2OTL1 5FLMI 2KI7B 2R7ZI 2NVXI 1K732 4EWCA 2QKDA 1TWFI 4NBDA 3I4MI 1RLYA 2JMOA 4MD9A 4RS4A 1YJ91 4BXXI 3GKQA 1NJI2 3CC2Z 2OTJZ 3BG1B 3HOYI 1LQLA 5A2Qf 2HU9A 2Q51A 4NBFA 3CMAZ 2V8IA 1RQFA 4E2ZA 4QTTA 4NB8A 1VQNZ 2E2II 3T4NB 1Q821 5AN9F 2O53A 5IT9b 3CCM1 2E2JI 2IZ3A 1SFOI 4BBSI 4A3KI 1KD11 1VQK1 3CC41 2BJOA 2Q4ZA 2QEXZ 1YJNZ 1QF8A 4DK1A 1YJW1 4NBBA 4DGLA 3KIHA 2YU9I 3J7A4 5IT9f 3CME1 1TFIA 3PO3S 2QA41 2E2HI 2RIQA 3QWUA 2GTHA 2HF1A 1VQO1 4A3DI 5FLXf 4A3II 4CL1A 3CCEZ 3P5JB 3M4OI 3NH4A 4AYBA 3CCQZ 1ZB8A 4TNUA 2GU2A 1WCMI 4E33A 1N2FA 4E32A 1YJWZ 3CCJZ 3CXCY 3I4NI 3Q87A 3NDJA 4NOZA 5IP7I 4E2XA 2JA5I 3EERA 3G6E1 4MXUA 1USPB 2VUGA 3NDIA 1YI21 1VQOZ 2JA7I 2RBLA 3NH5A 1VQP1 2OZKA 1PFTA 3TDHB 3CXCZ 1TWCI 4E30A 1VQ61 1N8R2 2AKLA 3NH8A 5A2Qb 3G71Z 2JR6A 3HOZI 2JNYA 3CCR1 2F4OA 1VQ71 1I3QI 1VQ81 1VQKZ 5D1OB 2JUBA 3S2DI 2M6NA 4MRIA 2B63I 2W04A 1TWGI 2QLVB 1Q812 1Y1WI 3CCV1 3GTGI 3CCU1 3LUSA 1QVGZ 3J81f 4A3LI 2G2KA 2JA6I 4NBGA 3HOXI 4NB9A 4A3EI 3S15I 4MD8A 3I07A 4A3CI 1X0TA 3CCQ1 1YIT1 3CC21 3HOWI 3S16I 2OTJ1 2VF1A 3H0GI 1Q811 4RVDA 1S72Z 4E2WA 2QREB 2OOXB 1Y1VS 1VQN1 3GTMS 2Y0SA 1VQMZ 1Q861 4E31A 3G4SZ 1VQ5Z 1M902 2IZ4A 3U50C 2M48A 3MZLB 3CC4Z 5T67A 1VQ91 2V8JA 1KRLA 4A3FI 1YUKA 3CQZI 2JS4A 4A93I 2E9HA 3J80f 3CMEZ 1VQ4Z 2DE5A 3HOVI 3FQMA 1NUIA 2DE6A 3GTJI 3G711 1ZB9A 5LL6f 1USPA 1K8A2 1R9TI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 1;  1JJ2 Y;  1YI2 1;  1VQO Z;  3OW2 Y;  1VQ8 Z;  3CPW Y;  1QVG Y;  1KC8 1;  3I56 Z;  1N8R 1;  1K8A 1;  1VQP 1;  3CCE 1;  3CXC Z;  1NJI 1;  3CCL 1;  1VQ6 1;  1N8R 2;  1YHQ 1;  3CMA 1;  3CCS 1;  3CC7 Z;  1W2B Y;  2OTL 1;  3G71 Z;  3G6E Z;  1K73 2;  3CCR 1;  1VQ7 1;  1VQ8 1;  1VQL Z;  1K9M 2;  1VQK Z;  1VQP Z;  1YJ9 1;  1NJI 2;  3CC2 Z;  3CCL Z;  2OTJ Z;  1QVF Y;  1Q81 2;  1YHQ Z;  3CMA Z;  3CCV 1;  3CC7 1;  1VQN Z;  3CCU 1;  2OTL Z;  2QA4 Z;  1QVG Z;  1Q82 1;  3CCM 1;  1VQ5 1;  1VQ7 Z;  1KC8 2;  1VQL 1;  1W2B Z;  1KD1 1;  3CD6 1;  1VQK 1;  3CC4 1;  1YJ9 Z;  1VQ9 Z;  1QVF Z;  1YIT 1;  3CCQ 1;  3CC2 1;  2QEX Z;  1YJN Z;  1YIJ Z;  1YJW 1;  2OTJ 1;  1M90 1;  3CCJ 1;  1KD1 2;  1Q81 1;  1S72 Z;  1Q86 2;  3CME 1;  1VQ4 1;  3CCV Z;  1VQN 1;  3CCU Z;  1KQS Z;  2QA4 1;  3I55 Z;  3OW2 Z;  1Q82 2;  1VQM Z;  1Q86 1;  3CCM Z;  3G4S Z;  1Q7Y 1;  1VQ5 Z;  1M90 2;  1YI2 Z;  1VQO 1;  3I56 1;  3CD6 Z;  1K73 1;  1Q7Y 2;  3CC4 Z;  3CCE Z;  3CPW Z;  1VQ9 1;  1M1K 1;  1YIT Z;  3CCQ Z;  1JJ2 Z;  2QEX 1;  1YJN 1;  1YIJ 1;  1YJW Z;  1VQ6 Z;  3CCJ Z;  3CXC Y;  1S72 1;  1KQS Y;  3CCS Z;  3CME Z;  1VQ4 Z;  3I55 1;  1M1K 2;  3G71 1;  3G6E 1;  1VQM 1;  1K8A 2;  3CCR Z;  3G4S 1; 
#chains in the Genus database with same CATH topology
 1K9M 1;  1JJ2 Y;  4A3M I;  1VQ8 Z;  1QVG Y;  1KC8 1;  1N8R 1;  2K3R A;  1K8A 1;  2R92 I;  3CCE 1;  3IFU A;  1NJI 1;  1VLA A;  2EGT A;  3S1Q I;  3CCL 1;  5C4J I;  3GTL I;  4QTU A;  3D6W A;  1Q16 A;  1DL6 A;  1WW9 A;  2PMZ A;  3GTO I;  2LIY A;  2P3Y A;  1VQL Z;  5D1O A;  2V3V A;  2PM9 A;  5CM2 M;  1JWH C;  1QVF Y;  1K83 I;  1YHQ Z;  2J6A A;  2NVY I;  3GTK I;  2QA4 Z;  3PO3 I;  2QR1 B;  3VTN A;  2GTI A;  3S1M I;  2H85 A;  3CD6 1;  2NVT I;  1YJ9 Z;  1VQ9 Z;  1QVF Z;  1YIJ Z;  3GCF A;  1RO0 A;  2OOY B;  4Y7N I;  3CCJ 1;  1QYP A;  4A3J I;  1Z01 A;  3FQQ A;  1VQ4 1;  3I55 Z;  3OW2 Z;  3J80 b;  1Q82 2;  3D9X A;  4NBA A;  3CCM Z;  3GTQ I;  4NFR A;  4RVG A;  1Q7Y 1;  4RV9 A;  1YI2 Z;  1X3Z A;  2LEX A;  3I56 1;  4NBE A;  1Q7Y 2;  3CPW Z;  1TWA I;  3IF8 A;  4E2Y A;  1YIT Z;  1JJ2 Z;  4HH4 A;  1YJN 1;  1YIJ 1;  5C4X I;  3TE5 B;  1VQ6 Z;  3K7A I;  3JAM f;  1KQS Y;  4A3B I;  2ZAE B;  3GTM I;  3I55 1;  1VQM 1;  2P28 A;  2RHB A;  1TWH I;  3CCR Z;  3G4S 1;  1FDO A;  3CPW Y;  3I56 Z;  4MON A;  3S2H I;  4BY1 I;  2JIP A;  2R93 I;  3JAM b;  2WB1 A;  5C3E I;  3M3Y I;  3VMG A;  4NBH A;  3VB9 A;  5IP9 I;  4NH1 C;  2VPY A;  2JIQ A;  1YHQ 1;  3S1R I;  2VUM I;  5T6B A;  3PO2 I;  4NBC A;  1WII A;  3G6E Z;  2RT9 A;  2V8K A;  3FKI I;  2K5R A;  3RZO I;  3BG0 B;  1I6H I;  1NP6 A;  1Y1V I;  1K9M 2;  4Y52 I;  1VQP Z;  1I50 I;  1Z03 A;  1RO2 A;  1L1O C;  2DE7 A;  3CCL Z;  1RNI A;  5FLX b;  4MH4 A;  3CC7 1;  2RPR A;  2OTL Z;  5T64 A;  1VQ5 1;  2JIM A;  3IX0 A;  1VQ7 Z;  3KIF A;  4BBR I;  1KC8 2;  4DQY B;  1VQL 1;  1W2B Z;  1P9N A;  3MON A;  2F4M A;  1ZH1 A;  2YAD A;  3S14 I;  3S1N I;  2LFU A;  1M90 1;  4XX2 A;  1KD1 2;  4RVH A;  2JA8 I;  3J81 b;  1Q86 2;  3S17 I;  3CCV Z;  2QRC B;  3CCU Z;  1KQS Z;  3HOU I;  2WAQ A;  3H3V J;  5C44 I;  3MZK B;  2I3C A;  2R6M A;  3RZD I;  3GTP I;  4S1T A;  3CD6 Z;  1X3W A;  1K73 1;  3F3F C;  1Z02 A;  4RVF A;  1M1K 1;  1YUA A;  3VMI A;  2QEX 1;  2KPI A;  3IR7 A;  4BY7 I;  3VMH A;  1S72 1;  2PK7 A;  3HKZ A;  4HGY A;  3CCS Z;  4A3G I;  3NFZ A;  4HGZ A;  1M1K 2;  1ML8 A;  1S7M A;  2QRD B;  5D1P A;  3OW2 Y;  2W03 A;  2NVQ I;  1Y8C A;  1RO4 A;  4MD7 A;  3EED A;  3F3P C;  3ESW A;  4X6A I;  3CMA 1;  3CCS 1;  2O4H A;  3CC7 Z;  1W2B Y;  2OTL 1;  5FLM I;  2KI7 B;  2VPZ A;  2R7Z I;  2NVX I;  1K73 2;  4EWC A;  1SIW A;  2QKD A;  1TWF I;  4NBD A;  3I4M I;  1RLY A;  2JMO A;  1QXF A;  4MD9 A;  4RS4 A;  1YJ9 1;  4BXX I;  3GKQ A;  2NAP A;  1NJI 2;  3CC2 Z;  2OTJ Z;  3BG1 B;  3HOY I;  1LQL A;  5A2Q f;  2HU9 A;  2Q51 A;  4NBF A;  3CMA Z;  2V8I A;  1RQF A;  4E2Z A;  4QTT A;  4NB8 A;  1VQN Z;  2E2I I;  3T4N B;  1Q82 1;  5AN9 F;  2O53 A;  5IT9 b;  3CCM 1;  2E2J I;  2IZ3 A;  1SFO I;  4BBS I;  4A3K I;  1KD1 1;  1VQK 1;  3CC4 1;  2BJO A;  2Q4Z A;  2QEX Z;  1YJN Z;  1QF8 A;  4DK1 A;  1YJW 1;  4NBB A;  4DGL A;  3KIH A;  2YU9 I;  3J7A 4;  5IT9 f;  3CME 1;  1TFI A;  3PO3 S;  2QA4 1;  2E2H I;  2RIQ A;  3QWU A;  2GTH A;  2HF1 A;  1VQO 1;  4A3D I;  5FLX f;  1WJ2 A;  4A3I I;  4CL1 A;  3CCE Z;  3P5J B;  3M4O I;  3NH4 A;  4AYB A;  3CCQ Z;  1ZB8 A;  4TNU A;  2GU2 A;  1WCM I;  4E33 A;  1N2F A;  4E32 A;  1YJW Z;  3CCJ Z;  3CXC Y;  3I4N I;  3Q87 A;  3NDJ A;  4NOZ A;  5IP7 I;  4E2X A;  2JA5 I;  3EER A;  3G6E 1;  2V45 A;  4MXU A;  2VPW A;  2VUG A;  3NDI A;  1USP B;  1YI2 1;  1VQO Z;  2JA7 I;  2RBL A;  3NH5 A;  1VQP 1;  2OZK A;  1PFT A;  3TDH B;  3CXC Z;  1TWC I;  4E30 A;  1VQ6 1;  1N8R 2;  2VPX A;  2AKL A;  3NH8 A;  1WZN A;  3D2L A;  5A2Q b;  3G71 Z;  2JR6 A;  3HOZ I;  2JNY A;  3CCR 1;  2F4O A;  1VQ7 1;  1I3Q I;  1VQ8 1;  1VQK Z;  5D1O B;  2JUB A;  3S2D I;  2M6N A;  1AA6 A;  4MRI A;  2B63 I;  2W04 A;  1TWG I;  2QLV B;  1Q81 2;  2E7Z A;  1Y1W I;  3CCV 1;  3GTG I;  3CCU 1;  3LUS A;  1QVG Z;  3J81 f;  4A3L I;  2G2K A;  2JA6 I;  4NBG A;  3HOX I;  4NB9 A;  4A3E I;  3S15 I;  4MD8 A;  3I07 A;  4A3C I;  1X0T A;  3CCQ 1;  1YIT 1;  3CC2 1;  3HOW I;  3S16 I;  2OTJ 1;  2VF1 A;  3H0G I;  1Q81 1;  4RVD A;  1S72 Z;  2IV2 X;  4E2W A;  2QRE B;  2OOX B;  1Y1V S;  1VQN 1;  3GTM S;  2Y0S A;  2AYD A;  1VQM Z;  1Q86 1;  4E31 A;  3G4S Z;  1VQ5 Z;  1M90 2;  2IZ4 A;  2JIR A;  3U50 C;  2M48 A;  3MZL B;  3CC4 Z;  5T67 A;  2JIO A;  1VQ9 1;  2V8J A;  1KRL A;  4A3F I;  1YUK A;  3CQZ I;  2JS4 A;  4A93 I;  2E9H A;  3J80 f;  3CME Z;  1VQ4 Z;  2DE5 A;  1FDI A;  3FQM A;  3HOV I;  1NUI A;  2DE6 A;  3GTJ I;  3G71 1;  1ZB9 A;  5LL6 f;  1USP A;  1K8A 2;  1R9T I; 
#chains in the Genus database with same CATH homology
 1K9M 1;  1JJ2 Y;  4A3M I;  1VQ8 Z;  1QVG Y;  1KC8 1;  1N8R 1;  2K3R A;  1K8A 1;  2R92 I;  3CCE 1;  3IFU A;  1NJI 1;  1VLA A;  2EGT A;  3S1Q I;  3CCL 1;  5C4J I;  3GTL I;  4QTU A;  3D6W A;  1DL6 A;  1WW9 A;  2PMZ A;  3GTO I;  2LIY A;  2P3Y A;  1VQL Z;  5D1O A;  2PM9 A;  5CM2 M;  1JWH C;  1QVF Y;  1K83 I;  1YHQ Z;  2J6A A;  2NVY I;  3GTK I;  2QA4 Z;  3PO3 I;  2QR1 B;  3VTN A;  2GTI A;  3S1M I;  2H85 A;  3CD6 1;  2NVT I;  1YJ9 Z;  1VQ9 Z;  1QVF Z;  1YIJ Z;  3GCF A;  1RO0 A;  2OOY B;  4Y7N I;  3CCJ 1;  1QYP A;  4A3J I;  1Z01 A;  3FQQ A;  1VQ4 1;  3I55 Z;  1Q82 2;  3J80 b;  3OW2 Z;  3D9X A;  4NBA A;  3CCM Z;  3GTQ I;  4NFR A;  4RVG A;  1Q7Y 1;  4RV9 A;  1YI2 Z;  1X3Z A;  3I56 1;  4NBE A;  1Q7Y 2;  1TWA I;  3IF8 A;  4E2Y A;  3CPW Z;  1YIT Z;  1JJ2 Z;  4HH4 A;  1YJN 1;  1YIJ 1;  5C4X I;  3TE5 B;  1VQ6 Z;  3K7A I;  3JAM f;  1KQS Y;  4A3B I;  2ZAE B;  3GTM I;  3I55 1;  1VQM 1;  2P28 A;  2RHB A;  1TWH I;  3CCR Z;  3G4S 1;  3CPW Y;  3I56 Z;  4MON A;  3S2H I;  4BY1 I;  2R93 I;  3JAM b;  2WB1 A;  5C3E I;  3M3Y I;  3VMG A;  4NBH A;  3VB9 A;  5IP9 I;  4NH1 C;  1YHQ 1;  3S1R I;  2VUM I;  5T6B A;  3PO2 I;  4NBC A;  1WII A;  3G6E Z;  2RT9 A;  2V8K A;  3FKI I;  2K5R A;  3RZO I;  3BG0 B;  1I6H I;  1NP6 A;  1Y1V I;  1K9M 2;  4Y52 I;  1VQP Z;  1I50 I;  1Z03 A;  1RO2 A;  1L1O C;  2DE7 A;  3CCL Z;  1RNI A;  5FLX b;  4MH4 A;  3CC7 1;  2RPR A;  2OTL Z;  5T64 A;  1VQ5 1;  3IX0 A;  1VQ7 Z;  3KIF A;  4BBR I;  1KC8 2;  4DQY B;  1VQL 1;  1W2B Z;  1P9N A;  3MON A;  2F4M A;  1ZH1 A;  2YAD A;  3S14 I;  3S1N I;  2LFU A;  1M90 1;  4XX2 A;  1KD1 2;  4RVH A;  2JA8 I;  3J81 b;  1Q86 2;  3S17 I;  3CCV Z;  2QRC B;  3CCU Z;  1KQS Z;  3HOU I;  2WAQ A;  3H3V J;  5C44 I;  3MZK B;  2I3C A;  2R6M A;  3RZD I;  3GTP I;  4S1T A;  3CD6 Z;  1X3W A;  1K73 1;  3F3F C;  1Z02 A;  4RVF A;  1M1K 1;  1YUA A;  3VMI A;  2QEX 1;  2KPI A;  4BY7 I;  3VMH A;  1S72 1;  2PK7 A;  3HKZ A;  4HGY A;  3CCS Z;  4A3G I;  3NFZ A;  4HGZ A;  1M1K 2;  1ML8 A;  1S7M A;  2QRD B;  5D1P A;  3OW2 Y;  2W03 A;  2NVQ I;  1RO4 A;  4MD7 A;  3EED A;  3F3P C;  3ESW A;  4X6A I;  3CMA 1;  3CCS 1;  2O4H A;  3CC7 Z;  1W2B Y;  2OTL 1;  5FLM I;  2KI7 B;  2R7Z I;  2NVX I;  1K73 2;  4EWC A;  2QKD A;  1TWF I;  4NBD A;  3I4M I;  1RLY A;  2JMO A;  4MD9 A;  4RS4 A;  1YJ9 1;  4BXX I;  3GKQ A;  1NJI 2;  3CC2 Z;  2OTJ Z;  3BG1 B;  3HOY I;  1LQL A;  5A2Q f;  2HU9 A;  2Q51 A;  4NBF A;  3CMA Z;  2V8I A;  1RQF A;  4E2Z A;  4QTT A;  4NB8 A;  1VQN Z;  2E2I I;  3T4N B;  1Q82 1;  5AN9 F;  2O53 A;  5IT9 b;  3CCM 1;  2E2J I;  2IZ3 A;  1SFO I;  4BBS I;  4A3K I;  1KD1 1;  1VQK 1;  3CC4 1;  2BJO A;  2Q4Z A;  2QEX Z;  1YJN Z;  1QF8 A;  4DK1 A;  1YJW 1;  4NBB A;  4DGL A;  3KIH A;  2YU9 I;  3J7A 4;  5IT9 f;  3CME 1;  1TFI A;  3PO3 S;  2QA4 1;  2E2H I;  2RIQ A;  3QWU A;  2GTH A;  2HF1 A;  1VQO 1;  4A3D I;  5FLX f;  4A3I I;  4CL1 A;  3CCE Z;  3P5J B;  3M4O I;  3NH4 A;  4AYB A;  3CCQ Z;  1ZB8 A;  4TNU A;  2GU2 A;  1WCM I;  4E33 A;  1N2F A;  4E32 A;  1YJW Z;  3CCJ Z;  3CXC Y;  3I4N I;  3Q87 A;  3NDJ A;  4NOZ A;  5IP7 I;  4E2X A;  2JA5 I;  3EER A;  3G6E 1;  4MXU A;  1USP B;  2VUG A;  3NDI A;  1YI2 1;  1VQO Z;  2JA7 I;  2RBL A;  3NH5 A;  1VQP 1;  2OZK A;  1PFT A;  3TDH B;  3CXC Z;  1TWC I;  4E30 A;  1VQ6 1;  1N8R 2;  2AKL A;  3NH8 A;  5A2Q b;  3G71 Z;  2JR6 A;  3HOZ I;  2JNY A;  3CCR 1;  2F4O A;  1VQ7 1;  1I3Q I;  1VQ8 1;  1VQK Z;  5D1O B;  2JUB A;  3S2D I;  2M6N A;  4MRI A;  2B63 I;  2W04 A;  1TWG I;  2QLV B;  1Q81 2;  1Y1W I;  3CCV 1;  3GTG I;  3CCU 1;  3LUS A;  1QVG Z;  3J81 f;  4A3L I;  2G2K A;  2JA6 I;  4NBG A;  3HOX I;  4NB9 A;  4A3E I;  3S15 I;  4MD8 A;  3I07 A;  4A3C I;  1X0T A;  3CCQ 1;  1YIT 1;  3CC2 1;  3HOW I;  3S16 I;  2OTJ 1;  2VF1 A;  3H0G I;  1Q81 1;  4RVD A;  1S72 Z;  4E2W A;  2QRE B;  2OOX B;  1Y1V S;  1VQN 1;  3GTM S;  2Y0S A;  1VQM Z;  1Q86 1;  4E31 A;  3G4S Z;  1VQ5 Z;  1M90 2;  2IZ4 A;  3U50 C;  2M48 A;  3MZL B;  3CC4 Z;  5T67 A;  1VQ9 1;  2V8J A;  1KRL A;  4A3F I;  1YUK A;  3CQZ I;  2JS4 A;  4A93 I;  2E9H A;  3J80 f;  3CME Z;  1VQ4 Z;  2DE5 A;  3HOV I;  3FQM A;  1NUI A;  2DE6 A;  3GTJ I;  3G71 1;  1ZB9 A;  5LL6 f;  1USP A;  1K8A 2;  1R9T I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...