1KC81

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8100
3CC7Z 1VQ9Z 3I551 1YJW1 1VQOZ 3G4SZ 1VQ4Z 1YIT1 1K9M2 1YIJZ 1KC81 1YI2Z 1QVGZ 1JJ2Y 1VQN1 3CCE1 3CCV1 1VQK1 1YHQ1 1K8A1 1Q821 3I56Z 1VQ51 1W2BY 3CCM1 1QVFY 1VQ61 3CMAZ 2OTJZ 1Q812 3G6E1 1VQ71 1M1K2 3CC71 1VQLZ 3CCQZ 2OTLZ 1VQO1 1YIJ1 1YI21 3CCLZ 1VQPZ 3CCR1 1K9M1 1NJI2 3CCSZ 3I561 3CCUZ 1JJ2Z 1VQMZ 1M902 3CMA1 3CPWY 3CXCY 1Q7Y2 2OTJ1 1W2BZ 1YJWZ 3CD6Z 1QVFZ 1KQSY 1Q811 1VQ81 2QA4Z 3CC4Z 2QEXZ 3G71Z 3CMEZ 1VQ91 1VQL1 3CCJZ 3CCQ1 2OTL1 1KD12 3G4S1 1S72Z 1VQ41 1M1K1 3CC2Z 1YJNZ 1K732 1VQ6Z 1VQP1 1N8R2 3OW2Y 3CCS1 1VQM1 1YJ9Z 1NJI1 3I55Z 1KC82 1QVGY 1M901 3CD61 3CPWZ 1YITZ 3CXCZ 1Q7Y1 2QA41 1K8A2 3CC41 1Q822 2QEX1 3G711 3CME1 1KQSZ 3CCJ1 1VQNZ 3CCRZ 3CCEZ 3CCVZ 1VQKZ 1YHQZ 1S721 1VQ5Z 3CCMZ 3CC21 1YJN1 1KD11 3CCL1 1Q862 1K731 3CCU1 3G6EZ 1VQ7Z 1VQ8Z 1N8R1 1Q861 3OW2Z 1YJ91
chains in the Genus database with same CATH superfamily
3CC7Z 3S15I 1VQ9Z 3I551 1TWAI 2DE6A 2RIQA 3ESWA 4X6AI 1K9M2 3J81b 1KC81 2P28A 3NDJA 4QTTA 1QVGZ 1JJ2Y 4NBAA 1WCMI 1Y1VI 1YHQ1 1SIWA 5D1PA 1VQ61 3CMAZ 2OTJZ 3J7A4 2V8JA 2JA5I 3G6E1 5T67A 3HOXI 1NP6A 3D6WA 1Q16A 1ZB8A 3J80b 3JAMf 2OTLZ 1N2FA 3U50C 2ZAEB 3PO2I 2VPZA 2KPIA 1K9M1 4MONA 3K7AI 3S1NI 3HOZI 2JA8I 3I561 1JJ2Z 1VQMZ 1M902 3CXCY 2P3YA 2RPRA 1Z02A 3GKQA 2QA4Z 1QF8A 3G71Z 4E33A 3CCJZ 1VQL1 3CCQ1 5IP9I 2E2HI 4A3CI 2PK7A 3QWUA 4RVDA 2K3RA 3F3FC 1KRLA 2VPYA 3GTGI 3IX0A 3GTKI 2M6NA 4HGZA 1SFOI 5A2Qb 3NH8A 1Z01A 4BXXI 4MRIA 2V3VA 3EERA 4RS4A 1I50I 1M901 3VMIA 2RHBA 4E30A 4A3MI 3CXCZ 5LL6f 2E9HA 4E2ZA 5AN9F 5T64A 2V8IA 3CME1 4CL1A 1VQKZ 4HH4A 1S721 4BY7I 2RBLA 3CC21 2WB1A 2OZKA 3HOVI 2IZ4A 3Q87A 3CCU1 2VUMI 3S2HI 1VQ7Z 1ML8A 4NBCA 1S7MA 3BG0B 2IV2X 3KIHA 3FQQA 1VQOZ 1VQ4Z 1Z03A 4A3JI 1YI2Z 1FDIA 3BG1B 2RT9A 1QXFA 3CCV1 3HKZA 3GTPI 2Q4ZA 3RZOI 4A3GI 2DE5A 3GTMI 1QVFY 4E2XA 2O53A 1FDOA 1Q812 2JIRA 1RO2A 5FLXf 4E32A 1M1K2 4A3II 3CC71 2YADA 4NBBA 5D1OA 3H0GI 2PMZA 3TE5B 4DK1A 3S17I 2OOXB 1I3QI 3MONA 2M48A 3VB9A 2B63I 1USPA 4NOZA 2Y0SA 3D9XA 3S16I 4NBFA 5D1OB 2NAPA 2E7ZA 4BBSI 3CMA1 2F4MA 5C4XI 3VMGA 2OTJ1 2E2JI 2NVXI 3CD6Z 1QVFZ 2K5RA 3D2LA 3M4OI 1YUKA 1Q811 1VQ81 3JAMb 1WIIA 2KI7B 2EGTA 2OTL1 3LUSA 2GTIA 3G4S1 1M1K1 3S2DI 1VQ6Z 2QREB 1K732 3NDIA 1JWHC 2V8KA 1N8R2 3OW2Y 2Q51A 1X0TA 4S1TA 1WW9A 4DQYB 1VQM1 3NH4A 1YJ9Z 2O4HA 4NBDA 4Y7NI 1YITZ 2R92I 2R93I 2QA41 5T6BA 3G711 4A3LI 3CCJ1 1VQNZ 3CCEZ 1X3ZA 3PO3S 1VQ5Z 3CCMZ 1K83I 2QRCB 3CCL1 3VTNA 1RO0A 4MD9A 3F3PC 1K731 2WAQA 3T4NB 1N8R1 2W03A 4RVFA 3I07A 3CQZI 3OW2Z 2NVQI 2QR1B 1YJW1 1P9NA 1YIJZ 2JNYA 3S1MI 2JIOA 2LIYA 2VUGA 1VQK1 1RNIA 1NUIA 1W2BY 1VLAA 3GTLI 4E31A 2NVTI 3S1RI 2R6MA 1VQ71 1RQFA 2E2II 1VQO1 3FQMA 4A3KI 3MZLB 1YI21 1VQPZ 3CCR1 3I4NI 2JIPA 4E2WA 3TDHB 3CCSZ 3GTOI 2R7ZI 1L1OC 2AKLA 3CCUZ 4DGLA 3CPWY 2VF1A 5FLXb 1W2BZ 4HGYA 1KQSY 5IP7I 2JIMA 2BJOA 3KIFA 3CC4Z 2QEXZ 1TWFI 1VQ91 2W04A 1Y1VS 4RV9A 3IF8A 2GTHA 2HU9A 2JUBA 4MD8A 3NFZA 1RO4A 1YJNZ 2J6AA 2F4OA 3GTJI 4Y52I 4BY1I 1Y8CA 2LEXA 2DE7A 3I55Z 2YU9I 1USPB 3CD61 3CPWZ 4XX2A 1QYPA 3H3VJ 1X3WA 1TWCI 1K8A2 1Q822 5CM2M 3J81f 4MD7A 3VMHA 1KQSZ 3P5JB 1YHQZ 1PFTA 4A3EI 4NFRA 2JMOA 4NBEA 1TWHI 4MXUA 3G6EZ 2G2KA 2HF1A 4QTUA 1VQ8Z 1Q861 1YJ91 3NH5A 2NVYI 3GCFA 3S14I 3G4SZ 3J80f 1YIT1 2QRDB 5C4JI 1AA6A 4MH4A 4A3BI 1VQN1 3CCE1 2OOYB 4A93I 1K8A1 1Q821 3I56Z 3IFUA 1VQ51 4TNUA 3CCM1 3MZKB 2JR6A 4RVHA 3S1QI 2QKDA 3FKII 1Y1WI 3HOWI 2I3CA 1VQLZ 3CCQZ 3EEDA 1ZB9A 1YIJ1 3M3YI 4E2YA 2JS4A 2VPWA 3CCLZ 4AYBA 1NJI2 2IZ3A 3PO3I 1WZNA 4A3DI 1TWGI 4NBGA 1Q7Y2 5FLMI 5A2Qf 1YJWZ 3HOUI 2PM9A 1YUAA 4BBRI 3GTQI 3CMEZ 1LQLA 1TFIA 2H85A 1KD12 1S72Z 1VQ41 3HOYI 2GU2A 3GTMS 3CC2Z 1WJ2A 2VPXA 2AYDA 1VQP1 2JIQA 4NH1C 5C3EI 2QLVB 2JA6I 3CCS1 1I6HI 4NB9A 1ZH1A 1NJI1 4NBHA 1KC82 1QVGY 1Q7Y1 1DL6A 4A3FI 2LFUA 4NB8A 3CC41 2QEX1 4RVGA 3CCRZ 1RLYA 3CCVZ 5C44I 3I4MI 2JA7I 1YJN1 4EWCA 1KD11 3IR7A 3RZDI 1Q862 5IT9b 2V45A 5IT9f 1R9TI
chains in the Genus database with same CATH topology
3CC7Z 3S15I 1VQ9Z 3I551 1TWAI 2DE6A 2RIQA 3ESWA 4X6AI 1K9M2 3J81b 1KC81 2P28A 3NDJA 4QTTA 1QVGZ 1JJ2Y 4NBAA 1WCMI 1Y1VI 1YHQ1 5D1PA 1VQ61 3CMAZ 2OTJZ 3J7A4 2V8JA 2JA5I 3G6E1 5T67A 3HOXI 1NP6A 3D6WA 1ZB8A 3J80b 3JAMf 2OTLZ 1N2FA 3U50C 2ZAEB 3PO2I 2KPIA 1K9M1 4MONA 3K7AI 3S1NI 3HOZI 2JA8I 3I561 1JJ2Z 1VQMZ 1M902 3CXCY 2P3YA 2RPRA 1Z02A 3GKQA 2QA4Z 1QF8A 3G71Z 4E33A 3CCJZ 1VQL1 3CCQ1 5IP9I 2E2HI 4A3CI 2PK7A 3QWUA 4RVDA 2K3RA 3F3FC 1KRLA 3GTGI 3IX0A 3GTKI 2M6NA 4HGZA 1SFOI 5A2Qb 3NH8A 1Z01A 4BXXI 4MRIA 3EERA 4RS4A 1I50I 1M901 3VMIA 2RHBA 4A3MI 4E30A 3CXCZ 5LL6f 2E9HA 4E2ZA 5AN9F 5T64A 2V8IA 3CME1 4CL1A 1VQKZ 4HH4A 1S721 4BY7I 2RBLA 3CC21 2WB1A 2OZKA 3HOVI 2IZ4A 3Q87A 3CCU1 2VUMI 3S2HI 1VQ7Z 1ML8A 4NBCA 1S7MA 3BG0B 3KIHA 3FQQA 1VQOZ 1VQ4Z 1Z03A 4A3JI 1YI2Z 3BG1B 2RT9A 3CCV1 3HKZA 3GTPI 2Q4ZA 3RZOI 4A3GI 2DE5A 3GTMI 1QVFY 4E2XA 2O53A 1Q812 1RO2A 5FLXf 4E32A 1M1K2 4A3II 3CC71 2YADA 4NBBA 5D1OA 3H0GI 2PMZA 3TE5B 4DK1A 3S17I 2OOXB 1I3QI 3MONA 2M48A 3VB9A 2B63I 1USPA 4NOZA 2Y0SA 3D9XA 3S16I 4NBFA 5D1OB 4BBSI 3CMA1 2F4MA 5C4XI 3VMGA 2OTJ1 2E2JI 2NVXI 3CD6Z 1QVFZ 2K5RA 3M4OI 1YUKA 1Q811 1VQ81 3JAMb 1WIIA 2KI7B 2EGTA 2OTL1 3LUSA 2GTIA 3G4S1 1M1K1 3S2DI 1VQ6Z 2QREB 1K732 3NDIA 1JWHC 2V8KA 1N8R2 3OW2Y 2Q51A 1X0TA 4S1TA 1WW9A 4DQYB 1VQM1 3NH4A 1YJ9Z 2O4HA 4NBDA 4Y7NI 1YITZ 2R92I 2R93I 2QA41 5T6BA 3G711 4A3LI 3CCJ1 1VQNZ 3CCEZ 1X3ZA 3PO3S 1VQ5Z 3CCMZ 1K83I 2QRCB 3CCL1 3VTNA 1RO0A 4MD9A 3F3PC 1K731 2WAQA 3T4NB 1N8R1 2W03A 4RVFA 3OW2Z 3I07A 3CQZI 2NVQI 2QR1B 1YJW1 1P9NA 1YIJZ 2JNYA 3S1MI 2LIYA 2VUGA 1VQK1 1RNIA 1NUIA 1W2BY 1VLAA 3GTLI 4E31A 2NVTI 3S1RI 2R6MA 1VQ71 1RQFA 2E2II 1VQO1 3FQMA 4A3KI 3MZLB 1YI21 1VQPZ 3CCR1 3I4NI 4E2WA 3GTOI 3TDHB 3CCSZ 2R7ZI 1L1OC 2AKLA 3CCUZ 4DGLA 3CPWY 2VF1A 5FLXb 1W2BZ 4HGYA 1KQSY 5IP7I 2BJOA 3KIFA 3CC4Z 2QEXZ 1TWFI 1VQ91 2W04A 1Y1VS 4RV9A 3IF8A 2GTHA 2HU9A 2JUBA 4MD8A 3NFZA 1RO4A 1YJNZ 2J6AA 2F4OA 3GTJI 4Y52I 4BY1I 2DE7A 3I55Z 2YU9I 1USPB 3CD61 3CPWZ 4XX2A 1QYPA 3H3VJ 1X3WA 1TWCI 1K8A2 1Q822 5CM2M 3J81f 4MD7A 3VMHA 1KQSZ 3P5JB 1YHQZ 1PFTA 4A3EI 4NFRA 2JMOA 4NBEA 1TWHI 4MXUA 3G6EZ 2G2KA 2HF1A 4QTUA 1VQ8Z 1Q861 1YJ91 3NH5A 2NVYI 3GCFA 3S14I 3G4SZ 3J80f 1YIT1 2QRDB 5C4JI 4MH4A 4A3BI 1VQN1 3CCE1 2OOYB 4A93I 1K8A1 1Q821 3I56Z 3IFUA 1VQ51 4TNUA 3CCM1 3MZKB 2JR6A 4RVHA 3S1QI 2QKDA 3FKII 1Y1WI 3HOWI 2I3CA 1VQLZ 3CCQZ 3EEDA 1ZB9A 1YIJ1 3M3YI 4E2YA 2JS4A 3CCLZ 4AYBA 1NJI2 2IZ3A 3PO3I 4A3DI 1TWGI 4NBGA 1Q7Y2 5FLMI 5A2Qf 1YJWZ 3HOUI 2PM9A 1YUAA 4BBRI 3GTQI 3CMEZ 1LQLA 1TFIA 2H85A 1KD12 1S72Z 1VQ41 3HOYI 2GU2A 3GTMS 3CC2Z 1VQP1 4NH1C 5C3EI 2QLVB 2JA6I 3CCS1 1I6HI 4NB9A 1ZH1A 1NJI1 4NBHA 1KC82 1QVGY 1Q7Y1 1DL6A 4A3FI 2LFUA 4NB8A 3CC41 2QEX1 4RVGA 3CCRZ 1RLYA 3CCVZ 5C44I 3I4MI 2JA7I 1YJN1 4EWCA 1KD11 3RZDI 1Q862 5IT9b 5IT9f 1R9TI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 Z;  1VQ9 Z;  3I55 1;  1YJW 1;  1VQO Z;  3G4S Z;  1VQ4 Z;  1YIT 1;  1K9M 2;  1YIJ Z;  1KC8 1;  1YI2 Z;  1QVG Z;  1JJ2 Y;  1VQN 1;  3CCE 1;  3CCV 1;  1VQK 1;  1YHQ 1;  1K8A 1;  1Q82 1;  3I56 Z;  1VQ5 1;  1W2B Y;  3CCM 1;  1QVF Y;  1VQ6 1;  3CMA Z;  2OTJ Z;  1Q81 2;  3G6E 1;  1VQ7 1;  1M1K 2;  3CC7 1;  1VQL Z;  3CCQ Z;  2OTL Z;  1VQO 1;  1YIJ 1;  1YI2 1;  3CCL Z;  1VQP Z;  3CCR 1;  1K9M 1;  1NJI 2;  3CCS Z;  3I56 1;  3CCU Z;  1JJ2 Z;  1VQM Z;  1M90 2;  3CMA 1;  3CPW Y;  3CXC Y;  1Q7Y 2;  2OTJ 1;  1W2B Z;  1YJW Z;  3CD6 Z;  1QVF Z;  1KQS Y;  1Q81 1;  1VQ8 1;  2QA4 Z;  3CC4 Z;  2QEX Z;  3G71 Z;  3CME Z;  1VQ9 1;  1VQL 1;  3CCJ Z;  3CCQ 1;  2OTL 1;  1KD1 2;  3G4S 1;  1S72 Z;  1VQ4 1;  1M1K 1;  3CC2 Z;  1YJN Z;  1K73 2;  1VQ6 Z;  1VQP 1;  1N8R 2;  3OW2 Y;  3CCS 1;  1VQM 1;  1YJ9 Z;  1NJI 1;  3I55 Z;  1KC8 2;  1QVG Y;  1M90 1;  3CD6 1;  3CPW Z;  1YIT Z;  3CXC Z;  1Q7Y 1;  2QA4 1;  1K8A 2;  3CC4 1;  1Q82 2;  2QEX 1;  3G71 1;  3CME 1;  1KQS Z;  3CCJ 1;  1VQN Z;  3CCR Z;  3CCE Z;  3CCV Z;  1VQK Z;  1YHQ Z;  1S72 1;  1VQ5 Z;  3CCM Z;  3CC2 1;  1YJN 1;  1KD1 1;  3CCL 1;  1Q86 2;  1K73 1;  3CCU 1;  3G6E Z;  1VQ7 Z;  1VQ8 Z;  1N8R 1;  1Q86 1;  3OW2 Z;  1YJ9 1; 
#chains in the Genus database with same CATH topology
 3CC7 Z;  3S15 I;  1VQ9 Z;  3I55 1;  1TWA I;  2DE6 A;  2RIQ A;  3ESW A;  4X6A I;  1K9M 2;  3J81 b;  1KC8 1;  2P28 A;  3NDJ A;  4QTT A;  1QVG Z;  1JJ2 Y;  4NBA A;  1WCM I;  1Y1V I;  1YHQ 1;  1SIW A;  5D1P A;  1VQ6 1;  3CMA Z;  2OTJ Z;  3J7A 4;  2V8J A;  2JA5 I;  3G6E 1;  5T67 A;  3HOX I;  1NP6 A;  3D6W A;  1Q16 A;  1ZB8 A;  3J80 b;  3JAM f;  2OTL Z;  1N2F A;  3U50 C;  2ZAE B;  3PO2 I;  2VPZ A;  2KPI A;  1K9M 1;  4MON A;  3K7A I;  3S1N I;  3HOZ I;  2JA8 I;  3I56 1;  1JJ2 Z;  1VQM Z;  1M90 2;  3CXC Y;  2P3Y A;  2RPR A;  1Z02 A;  3GKQ A;  2QA4 Z;  1QF8 A;  3G71 Z;  4E33 A;  3CCJ Z;  1VQL 1;  3CCQ 1;  5IP9 I;  2E2H I;  4A3C I;  2PK7 A;  3QWU A;  4RVD A;  2K3R A;  3F3F C;  1KRL A;  2VPY A;  3GTG I;  3IX0 A;  3GTK I;  2M6N A;  4HGZ A;  1SFO I;  5A2Q b;  3NH8 A;  1Z01 A;  4BXX I;  4MRI A;  2V3V A;  3EER A;  4RS4 A;  1I50 I;  1M90 1;  3VMI A;  2RHB A;  4E30 A;  4A3M I;  3CXC Z;  5LL6 f;  2E9H A;  4E2Z A;  5AN9 F;  5T64 A;  2V8I A;  3CME 1;  4CL1 A;  1VQK Z;  4HH4 A;  1S72 1;  4BY7 I;  2RBL A;  3CC2 1;  2WB1 A;  2OZK A;  3HOV I;  2IZ4 A;  3Q87 A;  3CCU 1;  2VUM I;  3S2H I;  1VQ7 Z;  1ML8 A;  4NBC A;  1S7M A;  3BG0 B;  2IV2 X;  3KIH A;  3FQQ A;  1VQO Z;  1VQ4 Z;  1Z03 A;  4A3J I;  1YI2 Z;  1FDI A;  3BG1 B;  2RT9 A;  1QXF A;  3CCV 1;  3HKZ A;  3GTP I;  2Q4Z A;  3RZO I;  4A3G I;  2DE5 A;  3GTM I;  1QVF Y;  4E2X A;  2O53 A;  1FDO A;  1Q81 2;  2JIR A;  1RO2 A;  5FLX f;  4E32 A;  1M1K 2;  4A3I I;  3CC7 1;  2YAD A;  4NBB A;  5D1O A;  3H0G I;  2PMZ A;  3TE5 B;  4DK1 A;  3S17 I;  2OOX B;  1I3Q I;  3MON A;  2M48 A;  3VB9 A;  2B63 I;  1USP A;  4NOZ A;  2Y0S A;  3D9X A;  3S16 I;  4NBF A;  5D1O B;  2NAP A;  2E7Z A;  4BBS I;  3CMA 1;  2F4M A;  5C4X I;  3VMG A;  2OTJ 1;  2E2J I;  2NVX I;  3CD6 Z;  1QVF Z;  2K5R A;  3D2L A;  3M4O I;  1YUK A;  1Q81 1;  1VQ8 1;  3JAM b;  1WII A;  2KI7 B;  2EGT A;  2OTL 1;  3LUS A;  2GTI A;  3G4S 1;  1M1K 1;  3S2D I;  1VQ6 Z;  2QRE B;  1K73 2;  3NDI A;  1JWH C;  2V8K A;  1N8R 2;  3OW2 Y;  2Q51 A;  1X0T A;  4S1T A;  1WW9 A;  4DQY B;  1VQM 1;  3NH4 A;  1YJ9 Z;  2O4H A;  4NBD A;  4Y7N I;  1YIT Z;  2R92 I;  2R93 I;  2QA4 1;  5T6B A;  3G71 1;  4A3L I;  3CCJ 1;  1VQN Z;  3CCE Z;  1X3Z A;  3PO3 S;  1VQ5 Z;  3CCM Z;  1K83 I;  2QRC B;  3CCL 1;  3VTN A;  1RO0 A;  4MD9 A;  3F3P C;  1K73 1;  2WAQ A;  3T4N B;  1N8R 1;  2W03 A;  4RVF A;  3I07 A;  3CQZ I;  3OW2 Z;  2NVQ I;  2QR1 B;  1YJW 1;  1P9N A;  1YIJ Z;  2JNY A;  3S1M I;  2JIO A;  2LIY A;  2VUG A;  1VQK 1;  1RNI A;  1NUI A;  1W2B Y;  1VLA A;  3GTL I;  4E31 A;  2NVT I;  3S1R I;  2R6M A;  1VQ7 1;  1RQF A;  2E2I I;  1VQO 1;  3FQM A;  4A3K I;  3MZL B;  1YI2 1;  1VQP Z;  3CCR 1;  3I4N I;  2JIP A;  4E2W A;  3TDH B;  3CCS Z;  3GTO I;  2R7Z I;  1L1O C;  2AKL A;  3CCU Z;  4DGL A;  3CPW Y;  2VF1 A;  5FLX b;  1W2B Z;  4HGY A;  1KQS Y;  5IP7 I;  2JIM A;  2BJO A;  3KIF A;  3CC4 Z;  2QEX Z;  1TWF I;  1VQ9 1;  2W04 A;  1Y1V S;  4RV9 A;  3IF8 A;  2GTH A;  2HU9 A;  2JUB A;  4MD8 A;  3NFZ A;  1RO4 A;  1YJN Z;  2J6A A;  2F4O A;  3GTJ I;  4Y52 I;  4BY1 I;  1Y8C A;  2LEX A;  2DE7 A;  3I55 Z;  2YU9 I;  1USP B;  3CD6 1;  3CPW Z;  4XX2 A;  1QYP A;  3H3V J;  1X3W A;  1TWC I;  1K8A 2;  1Q82 2;  5CM2 M;  3J81 f;  4MD7 A;  3VMH A;  1KQS Z;  3P5J B;  1YHQ Z;  1PFT A;  4A3E I;  4NFR A;  2JMO A;  4NBE A;  1TWH I;  4MXU A;  3G6E Z;  2G2K A;  2HF1 A;  4QTU A;  1VQ8 Z;  1Q86 1;  1YJ9 1;  3NH5 A;  2NVY I;  3GCF A;  3S14 I;  3G4S Z;  3J80 f;  1YIT 1;  2QRD B;  5C4J I;  1AA6 A;  4MH4 A;  4A3B I;  1VQN 1;  3CCE 1;  2OOY B;  4A93 I;  1K8A 1;  1Q82 1;  3I56 Z;  3IFU A;  1VQ5 1;  4TNU A;  3CCM 1;  3MZK B;  2JR6 A;  4RVH A;  3S1Q I;  2QKD A;  3FKI I;  1Y1W I;  3HOW I;  2I3C A;  1VQL Z;  3CCQ Z;  3EED A;  1ZB9 A;  1YIJ 1;  3M3Y I;  4E2Y A;  2JS4 A;  2VPW A;  3CCL Z;  4AYB A;  1NJI 2;  2IZ3 A;  3PO3 I;  1WZN A;  4A3D I;  1TWG I;  4NBG A;  1Q7Y 2;  5FLM I;  5A2Q f;  1YJW Z;  3HOU I;  2PM9 A;  1YUA A;  4BBR I;  3GTQ I;  3CME Z;  1LQL A;  1TFI A;  2H85 A;  1KD1 2;  1S72 Z;  1VQ4 1;  3HOY I;  2GU2 A;  3GTM S;  3CC2 Z;  1WJ2 A;  2VPX A;  2AYD A;  1VQP 1;  2JIQ A;  4NH1 C;  5C3E I;  2QLV B;  2JA6 I;  3CCS 1;  1I6H I;  4NB9 A;  1ZH1 A;  1NJI 1;  4NBH A;  1KC8 2;  1QVG Y;  1Q7Y 1;  1DL6 A;  4A3F I;  2LFU A;  4NB8 A;  3CC4 1;  2QEX 1;  4RVG A;  3CCR Z;  1RLY A;  3CCV Z;  5C44 I;  3I4M I;  2JA7 I;  1YJN 1;  4EWC A;  1KD1 1;  3IR7 A;  3RZD I;  1Q86 2;  5IT9 b;  2V45 A;  5IT9 f;  1R9T I; 
#chains in the Genus database with same CATH homology
 3CC7 Z;  3S15 I;  1VQ9 Z;  3I55 1;  1TWA I;  2DE6 A;  2RIQ A;  3ESW A;  4X6A I;  1K9M 2;  3J81 b;  1KC8 1;  2P28 A;  3NDJ A;  4QTT A;  1QVG Z;  1JJ2 Y;  4NBA A;  1WCM I;  1Y1V I;  1YHQ 1;  5D1P A;  1VQ6 1;  3CMA Z;  2OTJ Z;  3J7A 4;  2V8J A;  2JA5 I;  3G6E 1;  5T67 A;  3HOX I;  1NP6 A;  3D6W A;  1ZB8 A;  3J80 b;  3JAM f;  2OTL Z;  1N2F A;  3U50 C;  2ZAE B;  3PO2 I;  2KPI A;  1K9M 1;  4MON A;  3K7A I;  3S1N I;  3HOZ I;  2JA8 I;  3I56 1;  1JJ2 Z;  1VQM Z;  1M90 2;  3CXC Y;  2P3Y A;  2RPR A;  1Z02 A;  3GKQ A;  2QA4 Z;  1QF8 A;  3G71 Z;  4E33 A;  3CCJ Z;  1VQL 1;  3CCQ 1;  5IP9 I;  2E2H I;  4A3C I;  2PK7 A;  3QWU A;  4RVD A;  2K3R A;  3F3F C;  1KRL A;  3GTG I;  3IX0 A;  3GTK I;  2M6N A;  4HGZ A;  1SFO I;  5A2Q b;  3NH8 A;  1Z01 A;  4BXX I;  4MRI A;  3EER A;  4RS4 A;  1I50 I;  1M90 1;  3VMI A;  2RHB A;  4A3M I;  4E30 A;  3CXC Z;  5LL6 f;  2E9H A;  4E2Z A;  5AN9 F;  5T64 A;  2V8I A;  3CME 1;  4CL1 A;  1VQK Z;  4HH4 A;  1S72 1;  4BY7 I;  2RBL A;  3CC2 1;  2WB1 A;  2OZK A;  3HOV I;  2IZ4 A;  3Q87 A;  3CCU 1;  2VUM I;  3S2H I;  1VQ7 Z;  1ML8 A;  4NBC A;  1S7M A;  3BG0 B;  3KIH A;  3FQQ A;  1VQO Z;  1VQ4 Z;  1Z03 A;  4A3J I;  1YI2 Z;  3BG1 B;  2RT9 A;  3CCV 1;  3HKZ A;  3GTP I;  2Q4Z A;  3RZO I;  4A3G I;  2DE5 A;  3GTM I;  1QVF Y;  4E2X A;  2O53 A;  1Q81 2;  1RO2 A;  5FLX f;  4E32 A;  1M1K 2;  4A3I I;  3CC7 1;  2YAD A;  4NBB A;  5D1O A;  3H0G I;  2PMZ A;  3TE5 B;  4DK1 A;  3S17 I;  2OOX B;  1I3Q I;  3MON A;  2M48 A;  3VB9 A;  2B63 I;  1USP A;  4NOZ A;  2Y0S A;  3D9X A;  3S16 I;  4NBF A;  5D1O B;  4BBS I;  3CMA 1;  2F4M A;  5C4X I;  3VMG A;  2OTJ 1;  2E2J I;  2NVX I;  3CD6 Z;  1QVF Z;  2K5R A;  3M4O I;  1YUK A;  1Q81 1;  1VQ8 1;  3JAM b;  1WII A;  2KI7 B;  2EGT A;  2OTL 1;  3LUS A;  2GTI A;  3G4S 1;  1M1K 1;  3S2D I;  1VQ6 Z;  2QRE B;  1K73 2;  3NDI A;  1JWH C;  2V8K A;  1N8R 2;  3OW2 Y;  2Q51 A;  1X0T A;  4S1T A;  1WW9 A;  4DQY B;  1VQM 1;  3NH4 A;  1YJ9 Z;  2O4H A;  4NBD A;  4Y7N I;  1YIT Z;  2R92 I;  2R93 I;  2QA4 1;  5T6B A;  3G71 1;  4A3L I;  3CCJ 1;  1VQN Z;  3CCE Z;  1X3Z A;  3PO3 S;  1VQ5 Z;  3CCM Z;  1K83 I;  2QRC B;  3CCL 1;  3VTN A;  1RO0 A;  4MD9 A;  3F3P C;  1K73 1;  2WAQ A;  3T4N B;  1N8R 1;  2W03 A;  4RVF A;  3OW2 Z;  3I07 A;  3CQZ I;  2NVQ I;  2QR1 B;  1YJW 1;  1P9N A;  1YIJ Z;  2JNY A;  3S1M I;  2LIY A;  2VUG A;  1VQK 1;  1RNI A;  1NUI A;  1W2B Y;  1VLA A;  3GTL I;  4E31 A;  2NVT I;  3S1R I;  2R6M A;  1VQ7 1;  1RQF A;  2E2I I;  1VQO 1;  3FQM A;  4A3K I;  3MZL B;  1YI2 1;  1VQP Z;  3CCR 1;  3I4N I;  4E2W A;  3GTO I;  3TDH B;  3CCS Z;  2R7Z I;  1L1O C;  2AKL A;  3CCU Z;  4DGL A;  3CPW Y;  2VF1 A;  5FLX b;  1W2B Z;  4HGY A;  1KQS Y;  5IP7 I;  2BJO A;  3KIF A;  3CC4 Z;  2QEX Z;  1TWF I;  1VQ9 1;  2W04 A;  1Y1V S;  4RV9 A;  3IF8 A;  2GTH A;  2HU9 A;  2JUB A;  4MD8 A;  3NFZ A;  1RO4 A;  1YJN Z;  2J6A A;  2F4O A;  3GTJ I;  4Y52 I;  4BY1 I;  2DE7 A;  3I55 Z;  2YU9 I;  1USP B;  3CD6 1;  3CPW Z;  4XX2 A;  1QYP A;  3H3V J;  1X3W A;  1TWC I;  1K8A 2;  1Q82 2;  5CM2 M;  3J81 f;  4MD7 A;  3VMH A;  1KQS Z;  3P5J B;  1YHQ Z;  1PFT A;  4A3E I;  4NFR A;  2JMO A;  4NBE A;  1TWH I;  4MXU A;  3G6E Z;  2G2K A;  2HF1 A;  4QTU A;  1VQ8 Z;  1Q86 1;  1YJ9 1;  3NH5 A;  2NVY I;  3GCF A;  3S14 I;  3G4S Z;  3J80 f;  1YIT 1;  2QRD B;  5C4J I;  4MH4 A;  4A3B I;  1VQN 1;  3CCE 1;  2OOY B;  4A93 I;  1K8A 1;  1Q82 1;  3I56 Z;  3IFU A;  1VQ5 1;  4TNU A;  3CCM 1;  3MZK B;  2JR6 A;  4RVH A;  3S1Q I;  2QKD A;  3FKI I;  1Y1W I;  3HOW I;  2I3C A;  1VQL Z;  3CCQ Z;  3EED A;  1ZB9 A;  1YIJ 1;  3M3Y I;  4E2Y A;  2JS4 A;  3CCL Z;  4AYB A;  1NJI 2;  2IZ3 A;  3PO3 I;  4A3D I;  1TWG I;  4NBG A;  1Q7Y 2;  5FLM I;  5A2Q f;  1YJW Z;  3HOU I;  2PM9 A;  1YUA A;  4BBR I;  3GTQ I;  3CME Z;  1LQL A;  1TFI A;  2H85 A;  1KD1 2;  1S72 Z;  1VQ4 1;  3HOY I;  2GU2 A;  3GTM S;  3CC2 Z;  1VQP 1;  4NH1 C;  5C3E I;  2QLV B;  2JA6 I;  3CCS 1;  1I6H I;  4NB9 A;  1ZH1 A;  1NJI 1;  4NBH A;  1KC8 2;  1QVG Y;  1Q7Y 1;  1DL6 A;  4A3F I;  2LFU A;  4NB8 A;  3CC4 1;  2QEX 1;  4RVG A;  3CCR Z;  1RLY A;  3CCV Z;  5C44 I;  3I4M I;  2JA7 I;  1YJN 1;  4EWC A;  1KD1 1;  3RZD I;  1Q86 2;  5IT9 b;  5IT9 f;  1R9T I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...