1KC81

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8100
3CD6Z 1VQ8Z 1VQ5Z 1VQ61 3CME1 1VQMZ 1VQ91 3CCU1 1VQ7Z 1N8R1 1M1K1 3CD61 1M902 1S721 1Q821 1VQ9Z 1VQLZ 3CC2Z 1K8A1 3CPWZ 1VQK1 1KD11 1KQSY 1Q822 3I561 2OTLZ 1YJ91 1VQOZ 1KC81 1NJI1 1Q7Y2 1YJ9Z 1Q811 3CC21 1YJNZ 1VQPZ 1VQ51 1Q812 2OTL1 3G4SZ 3CCRZ 1VQO1 1K8A2 1QVFY 1VQL1 1Q861 1K731 1VQKZ 3CCSZ 3CC4Z 2QEXZ 3I55Z 1KQSZ 1K9M2 2OTJZ 1YI21 3CCS1 1NJI2 1KC82 1QVGY 3I551 1YIJZ 3CCVZ 1M901 1YHQZ 3CCLZ 3G711 3CMAZ 3CCR1 1M1K2 1YIT1 1K9M1 3I56Z 1VQM1 1YI2Z 2QA4Z 1VQ71 3G6E1 3CCV1 1KD12 3G71Z 3CMA1 2QEX1 1VQ4Z 3CC7Z 3G6EZ 3G4S1 1JJ2Z 3CCUZ 3CCQ1 1Q862 1YJN1 1VQ41 3CCE1 1W2BY 1YITZ 1S72Z 1Q7Y1 3CXCZ 3CCJZ 3CC41 1W2BZ 2QA41 1N8R2 3CXCY 3OW2Y 3CCM1 1VQ81 1VQ6Z 3OW2Z 1JJ2Y 1VQNZ 1QVGZ 1YHQ1 1YJWZ 3CCMZ 3CCQZ 3CCEZ 1VQN1 1QVFZ 3CMEZ 1YJW1 2OTJ1 1K732 3CCJ1 3CPWY 1YIJ1 1VQP1 3CC71 3CCL1
chains in the Genus database with same CATH superfamily
3CD6Z 1VQ8Z 2KPIA 2OZKA 3CCU1 1USPA 1VQ7Z 3MZLB 3VTNA 1Q821 3S1NI 1VQ9Z 1VQLZ 3QWUA 3CPWZ 1VQK1 3GTMS 1Y1VS 2HF1A 3IR7A 1Q822 2VPXA 3F3PC 3GCFA 2OTLZ 4DQYB 2RIQA 2JIQA 1WW9A 5CM2M 1Q7Y2 4EWCA 1YJ9Z 1Q811 4NH1C 2B63I 1QF8A 3NDJA 1Q812 2I3CA 1YUKA 1WIIA 1I6HI 2JNYA 1VQO1 1QVFY 2M48A 3M3YI 4NBAA 1I3QI 3GKQA 3S14I 4QTTA 5D1PA 1P9NA 2QEXZ 1KQSZ 3J81b 3Q87A 2GTHA 1NJI2 3HOYI 4BBSI 1YIJZ 1SIWA 2JIPA 3CMAZ 1VQM1 1YI2Z 5A2Qb 3BG1B 2JA8I 2E9HA 3S1RI 1YUAA 1K83I 1ML8A 4TNUA 3U50C 3G4S1 1TWHI 2EGTA 4A3GI 4RVDA 4E2WA 4Y7NI 1VQ41 2AKLA 1Z01A 1RO0A 2IZ4A 2NVQI 1W2BZ 3ESWA 3TDHB 4MD8A 1N2FA 2QR1B 4E2XA 2Q51A 2J6AA 1S7MA 1QVGZ 4XX2A 5T67A 4A3DI 4NOZA 2G2KA 5D1OA 2NAPA 2VUMI 1QVFZ 1YJW1 1VLAA 3MONA 5IT9b 3S17I 1VQMZ 2QRCB 4A3EI 2RBLA 4E31A 4NBHA 2K5RA 1M1K1 1TWAI 3CD61 1M902 3D2LA 4NBDA 3S2HI 5T6BA 3PO2I 3D9XA 1TWFI 3NH5A 3T4NB 4NBGA 3I561 2BJOA 3H0GI 4RVFA 2GTIA 4MD7A 2P3YA 2WB1A 2PK7A 1JWHC 1NJI1 4BXXI 2LIYA 3P5JB 2NVTI 5D1OB 1VQPZ 2IZ3A 2V8IA 2PMZA 4NBCA 2OOXB 5IT9f 3PO3S 3FQMA 4HGZA 3GTJI 1FDIA 4BY1I 2E2JI 1Q861 3GTPI 4AYBA 3I55Z 2YADA 3IF8A 3VMGA 2KI7B 2QREB 1K9M2 4NFRA 4DK1A 4HGYA 4Y52I 3EEDA 1Z02A 1YHQZ 4A3MI 3CCR1 1K9M1 4S1TA 3I56Z 1Y8CA 2IV2X 3JAMb 1VQ71 3CCV1 3PO3I 3CMA1 4MH4A 3LUSA 3H3VJ 2E2II 4NB9A 2RPRA 1TFIA 2JMOA 3RZOI 3CCQ1 1YJN1 1PFTA 1S72Z 3RZDI 1TWGI 3HKZA 3CCJZ 2QA41 5FLXf 1N8R2 4E30A 3CXCY 3K7AI 1R9TI 2JUBA 1VQ81 1VQ6Z 3J80b 3OW2Z 3S1QI 1YHQ1 1YJWZ 3CCMZ 1Y1VI 3CCEZ 2Y0SA 3I4NI 3CMEZ 2NVYI 4RVGA 3CCJ1 2YU9I 3S2DI 2NVXI 3JAMf 2DE6A 3CC71 1FDOA 1VQ5Z 1VQ61 2OOYB 1N8R1 1Q16A 5IP9I 4A93I 4NBFA 4E32A 3J80f 1S721 3CC2Z 3GTKI 4BBRI 4X6AI 1KQSY 2JIRA 2VPZA 3I07A 4E2YA 2QKDA 3I4MI 3GTQI 2R93I 2ZAEB 2V3VA 4A3CI 1VQOZ 2JIOA 1QXFA 3CC21 2W04A 3HOZI 4RVHA 1RNIA 1VQ51 2JR6A 2F4OA 2E7ZA 2V8KA 2VF1A 4MONA 3FKII 5T64A 2P28A 2OTL1 3G4SZ 4MXUA 3IX0A 1K8A2 3VB9A 3NH8A 1USPB 1VQL1 4HH4A 3NFZA 3VMIA 3HOXI 1VQKZ 3CC4Z 3KIFA 2W03A 2WAQA 1KC82 3CCS1 1QVGY 3I551 3CCVZ 5FLXb 1M901 2R7ZI 2JS4A 2LFUA 3CCLZ 3G711 1YIT1 5C3EI 1KD12 1X3WA 2QEX1 5C4XI 3TE5B 3G6EZ 3M4OI 3CQZI 1Q862 1WZNA 2GU2A 1RLYA 5AN9F 1ZB8A 2RT9A 1W2BY 1YITZ 1Q7Y1 1I50I 2VPWA 3CC41 3J7A4 3MZKB 3CCM1 3GTMI 4A3LI 5A2Qf 1RO2A 1VQNZ 2R6MA 5LL6f 1WJ2A 2JA5I 4A3II 1NUIA 3VMHA 1YIJ1 4A3KI 1VQP1 3CCL1 3CME1 2QRDB 3NH4A 2PM9A 1VQ91 1ZB9A 5C44I 3HOWI 1QYPA 1L1OC 4RV9A 3GTGI 2F4MA 1AA6A 3IFUA 1K8A1 4QTUA 1KD11 3HOUI 4MD9A 1RO4A 1ZH1A 1LQLA 1YJ91 4A3BI 2QLVB 1KC81 2DE5A 1WCMI 3FQQA 4CL1A 2RHBA 3S16I 1YJNZ 1TWCI 4NB8A 4A3JI 3S15I 2V45A 1Y1WI 3CCRZ 2Q4ZA 4MRIA 2AYDA 1K731 1SFOI 4A3FI 3CCSZ 3EERA 2H85A 3D6WA 3GTLI 2OTJZ 1YI21 3S1MI 2JA7I 1RQFA 3NDIA 2VUGA 1M1K2 1NP6A 2VPYA 2QA4Z 3G6E1 1X3ZA 1KRLA 3G71Z 4RS4A 2V8JA 5IP7I 1VQ4Z 3CC7Z 1JJ2Z 5FLMI 3HOVI 3CCUZ 4NBEA 2LEXA 2E2HI 3CCE1 3J81f 3GTOI 1X0TA 3CXCZ 1Z03A 5C4JI 4E33A 3OW2Y 2O4HA 2DE7A 1JJ2Y 4NBBA 4DGLA 3BG0B 2JIMA 3F3FC 3CCQZ 2R92I 4BY7I 1VQN1 2O53A 4E2ZA 1DL6A 2OTJ1 1K732 3CPWY 3KIHA 2M6NA 2HU9A 2JA6I 2K3RA
chains in the Genus database with same CATH topology
3CD6Z 1VQ8Z 2KPIA 2OZKA 3CCU1 1USPA 1VQ7Z 3MZLB 3VTNA 1Q821 3S1NI 1VQ9Z 1VQLZ 3QWUA 3CPWZ 1VQK1 3GTMS 1Y1VS 2HF1A 1Q822 3F3PC 3GCFA 2OTLZ 4DQYB 2RIQA 1WW9A 5CM2M 1Q7Y2 4EWCA 1YJ9Z 1Q811 4NH1C 2B63I 1QF8A 3NDJA 1Q812 2I3CA 1YUKA 1WIIA 1I6HI 2JNYA 1VQO1 1QVFY 2M48A 3M3YI 4NBAA 1I3QI 3GKQA 3S14I 4QTTA 5D1PA 1P9NA 2QEXZ 1KQSZ 3J81b 3Q87A 2GTHA 1NJI2 3HOYI 4BBSI 1YIJZ 3CMAZ 1VQM1 1YI2Z 5A2Qb 3BG1B 2JA8I 2E9HA 3S1RI 1YUAA 1K83I 1ML8A 4TNUA 3U50C 3G4S1 1TWHI 2EGTA 4A3GI 4RVDA 4E2WA 4Y7NI 1VQ41 2AKLA 1Z01A 1RO0A 2IZ4A 2NVQI 1W2BZ 3ESWA 3TDHB 4MD8A 1N2FA 2QR1B 4E2XA 2Q51A 2J6AA 1S7MA 1QVGZ 4XX2A 5T67A 4A3DI 4NOZA 2G2KA 5D1OA 2VUMI 1QVFZ 1YJW1 1VLAA 3MONA 5IT9b 3S17I 1VQMZ 2QRCB 4A3EI 2RBLA 4E31A 4NBHA 2K5RA 1M1K1 1TWAI 3CD61 1M902 4NBDA 3S2HI 5T6BA 3PO2I 3D9XA 1TWFI 3NH5A 3T4NB 4NBGA 3I561 2BJOA 3H0GI 4RVFA 2GTIA 4MD7A 2P3YA 2WB1A 2PK7A 1JWHC 1NJI1 4BXXI 2LIYA 3P5JB 2NVTI 5D1OB 1VQPZ 2IZ3A 2V8IA 2PMZA 4NBCA 2OOXB 5IT9f 3PO3S 3FQMA 4HGZA 3GTJI 4BY1I 2E2JI 1Q861 3GTPI 4AYBA 3I55Z 2YADA 3IF8A 3VMGA 2KI7B 2QREB 1K9M2 4NFRA 4DK1A 4HGYA 4Y52I 3EEDA 1Z02A 1YHQZ 4A3MI 3CCR1 1K9M1 4S1TA 3I56Z 3JAMb 1VQ71 3CCV1 3PO3I 3CMA1 4MH4A 3LUSA 3H3VJ 2E2II 4NB9A 2RPRA 1TFIA 2JMOA 3RZOI 3CCQ1 1YJN1 1PFTA 1S72Z 3RZDI 1TWGI 3HKZA 3CCJZ 2QA41 5FLXf 1N8R2 4E30A 3CXCY 3K7AI 1R9TI 2JUBA 1VQ81 1VQ6Z 3J80b 3OW2Z 3S1QI 1YHQ1 1YJWZ 3CCMZ 1Y1VI 3CCEZ 2Y0SA 3I4NI 3CMEZ 2NVYI 4RVGA 3CCJ1 2YU9I 3S2DI 2NVXI 3JAMf 2DE6A 3CC71 1VQ5Z 1VQ61 2OOYB 1N8R1 5IP9I 4A93I 4NBFA 4E32A 3J80f 1S721 3CC2Z 3GTKI 4BBRI 4X6AI 1KQSY 3I07A 4E2YA 2QKDA 3I4MI 3GTQI 2R93I 2ZAEB 4A3CI 1VQOZ 3CC21 2W04A 3HOZI 4RVHA 1RNIA 1VQ51 2JR6A 2F4OA 2V8KA 2VF1A 4MONA 5T64A 3FKII 2OTL1 2P28A 3G4SZ 4MXUA 3IX0A 1K8A2 3VB9A 3NH8A 1USPB 1VQL1 4HH4A 3NFZA 3VMIA 3HOXI 1VQKZ 3CC4Z 3KIFA 2W03A 2WAQA 1KC82 3CCS1 1QVGY 3I551 3CCVZ 5FLXb 1M901 2R7ZI 2JS4A 2LFUA 3CCLZ 3G711 1YIT1 5C3EI 1KD12 1X3WA 2QEX1 5C4XI 3TE5B 3G6EZ 3M4OI 3CQZI 1Q862 2GU2A 1RLYA 5AN9F 1ZB8A 2RT9A 1W2BY 1YITZ 1Q7Y1 1I50I 3CC41 3J7A4 3MZKB 3CCM1 3GTMI 4A3LI 5A2Qf 1RO2A 1VQNZ 2R6MA 5LL6f 2JA5I 4A3II 1NUIA 3VMHA 1YIJ1 4A3KI 1VQP1 3CCL1 3CME1 2QRDB 3NH4A 2PM9A 1VQ91 1ZB9A 5C44I 3HOWI 1QYPA 1L1OC 4RV9A 3GTGI 2F4MA 3IFUA 1K8A1 4QTUA 1KD11 3HOUI 4MD9A 1RO4A 1ZH1A 1LQLA 1YJ91 4A3BI 2QLVB 1KC81 2DE5A 1WCMI 3FQQA 4CL1A 2RHBA 3S16I 1YJNZ 1TWCI 4NB8A 4A3JI 3S15I 1Y1WI 3CCRZ 2Q4ZA 4MRIA 1K731 1SFOI 4A3FI 3CCSZ 3EERA 2H85A 3D6WA 3GTLI 2OTJZ 1YI21 3S1MI 2JA7I 1RQFA 3NDIA 2VUGA 1M1K2 1NP6A 2QA4Z 3G6E1 1X3ZA 1KRLA 3G71Z 4RS4A 2V8JA 5IP7I 1VQ4Z 3CC7Z 1JJ2Z 5FLMI 3HOVI 3CCUZ 4NBEA 2E2HI 3CCE1 3J81f 3GTOI 1X0TA 3CXCZ 1Z03A 5C4JI 4E33A 3OW2Y 2O4HA 2DE7A 1JJ2Y 4NBBA 4DGLA 3BG0B 3F3FC 3CCQZ 2R92I 4BY7I 1VQN1 2O53A 4E2ZA 1DL6A 2OTJ1 1K732 3CPWY 3KIHA 2M6NA 2HU9A 2JA6I 2K3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Z;  1VQ8 Z;  1VQ5 Z;  1VQ6 1;  3CME 1;  1VQM Z;  1VQ9 1;  3CCU 1;  1VQ7 Z;  1N8R 1;  1M1K 1;  3CD6 1;  1M90 2;  1S72 1;  1Q82 1;  1VQ9 Z;  1VQL Z;  3CC2 Z;  1K8A 1;  3CPW Z;  1VQK 1;  1KD1 1;  1KQS Y;  1Q82 2;  3I56 1;  2OTL Z;  1YJ9 1;  1VQO Z;  1KC8 1;  1NJI 1;  1Q7Y 2;  1YJ9 Z;  1Q81 1;  3CC2 1;  1YJN Z;  1VQP Z;  1VQ5 1;  1Q81 2;  2OTL 1;  3G4S Z;  3CCR Z;  1VQO 1;  1K8A 2;  1QVF Y;  1VQL 1;  1Q86 1;  1K73 1;  1VQK Z;  3CCS Z;  3CC4 Z;  2QEX Z;  3I55 Z;  1KQS Z;  1K9M 2;  2OTJ Z;  1YI2 1;  3CCS 1;  1NJI 2;  1KC8 2;  1QVG Y;  3I55 1;  1YIJ Z;  3CCV Z;  1M90 1;  1YHQ Z;  3CCL Z;  3G71 1;  3CMA Z;  3CCR 1;  1M1K 2;  1YIT 1;  1K9M 1;  3I56 Z;  1VQM 1;  1YI2 Z;  2QA4 Z;  1VQ7 1;  3G6E 1;  3CCV 1;  1KD1 2;  3G71 Z;  3CMA 1;  2QEX 1;  1VQ4 Z;  3CC7 Z;  3G6E Z;  3G4S 1;  1JJ2 Z;  3CCU Z;  3CCQ 1;  1Q86 2;  1YJN 1;  1VQ4 1;  3CCE 1;  1W2B Y;  1YIT Z;  1S72 Z;  1Q7Y 1;  3CXC Z;  3CCJ Z;  3CC4 1;  1W2B Z;  2QA4 1;  1N8R 2;  3CXC Y;  3OW2 Y;  3CCM 1;  1VQ8 1;  1VQ6 Z;  3OW2 Z;  1JJ2 Y;  1VQN Z;  1QVG Z;  1YHQ 1;  1YJW Z;  3CCM Z;  3CCQ Z;  3CCE Z;  1VQN 1;  1QVF Z;  3CME Z;  1YJW 1;  2OTJ 1;  1K73 2;  3CCJ 1;  3CPW Y;  1YIJ 1;  1VQP 1;  3CC7 1;  3CCL 1; 
#chains in the Genus database with same CATH topology
 3CD6 Z;  1VQ8 Z;  2KPI A;  2OZK A;  3CCU 1;  1USP A;  1VQ7 Z;  3MZL B;  3VTN A;  1Q82 1;  3S1N I;  1VQ9 Z;  1VQL Z;  3QWU A;  3CPW Z;  1VQK 1;  3GTM S;  1Y1V S;  2HF1 A;  3IR7 A;  1Q82 2;  2VPX A;  3F3P C;  3GCF A;  2OTL Z;  4DQY B;  2RIQ A;  2JIQ A;  1WW9 A;  5CM2 M;  1Q7Y 2;  4EWC A;  1YJ9 Z;  1Q81 1;  4NH1 C;  2B63 I;  1QF8 A;  3NDJ A;  1Q81 2;  2I3C A;  1YUK A;  1WII A;  1I6H I;  2JNY A;  1VQO 1;  1QVF Y;  2M48 A;  3M3Y I;  4NBA A;  1I3Q I;  3GKQ A;  3S14 I;  4QTT A;  5D1P A;  1P9N A;  2QEX Z;  1KQS Z;  3J81 b;  3Q87 A;  2GTH A;  1NJI 2;  3HOY I;  4BBS I;  1YIJ Z;  1SIW A;  2JIP A;  3CMA Z;  1VQM 1;  1YI2 Z;  5A2Q b;  3BG1 B;  2JA8 I;  2E9H A;  3S1R I;  1YUA A;  1K83 I;  1ML8 A;  4TNU A;  3U50 C;  3G4S 1;  1TWH I;  2EGT A;  4A3G I;  4RVD A;  4E2W A;  4Y7N I;  1VQ4 1;  2AKL A;  1Z01 A;  1RO0 A;  2IZ4 A;  2NVQ I;  1W2B Z;  3ESW A;  3TDH B;  4MD8 A;  1N2F A;  2QR1 B;  4E2X A;  2Q51 A;  2J6A A;  1S7M A;  1QVG Z;  4XX2 A;  5T67 A;  4A3D I;  4NOZ A;  2G2K A;  5D1O A;  2NAP A;  2VUM I;  1QVF Z;  1YJW 1;  1VLA A;  3MON A;  5IT9 b;  3S17 I;  1VQM Z;  2QRC B;  4A3E I;  2RBL A;  4E31 A;  4NBH A;  2K5R A;  1M1K 1;  1TWA I;  3CD6 1;  1M90 2;  3D2L A;  4NBD A;  3S2H I;  5T6B A;  3PO2 I;  3D9X A;  1TWF I;  3NH5 A;  3T4N B;  4NBG A;  3I56 1;  2BJO A;  3H0G I;  4RVF A;  2GTI A;  4MD7 A;  2P3Y A;  2WB1 A;  2PK7 A;  1JWH C;  1NJI 1;  4BXX I;  2LIY A;  3P5J B;  2NVT I;  5D1O B;  1VQP Z;  2IZ3 A;  2V8I A;  2PMZ A;  4NBC A;  2OOX B;  5IT9 f;  3PO3 S;  3FQM A;  4HGZ A;  3GTJ I;  1FDI A;  4BY1 I;  2E2J I;  1Q86 1;  3GTP I;  4AYB A;  3I55 Z;  2YAD A;  3IF8 A;  3VMG A;  2KI7 B;  2QRE B;  1K9M 2;  4NFR A;  4DK1 A;  4HGY A;  4Y52 I;  3EED A;  1Z02 A;  1YHQ Z;  4A3M I;  3CCR 1;  1K9M 1;  4S1T A;  3I56 Z;  1Y8C A;  2IV2 X;  3JAM b;  1VQ7 1;  3CCV 1;  3PO3 I;  3CMA 1;  4MH4 A;  3LUS A;  3H3V J;  2E2I I;  4NB9 A;  2RPR A;  1TFI A;  2JMO A;  3RZO I;  3CCQ 1;  1YJN 1;  1PFT A;  1S72 Z;  3RZD I;  1TWG I;  3HKZ A;  3CCJ Z;  2QA4 1;  5FLX f;  1N8R 2;  4E30 A;  3CXC Y;  3K7A I;  1R9T I;  2JUB A;  1VQ8 1;  1VQ6 Z;  3J80 b;  3OW2 Z;  3S1Q I;  1YHQ 1;  1YJW Z;  3CCM Z;  1Y1V I;  3CCE Z;  2Y0S A;  3I4N I;  3CME Z;  2NVY I;  4RVG A;  3CCJ 1;  2YU9 I;  3S2D I;  2NVX I;  3JAM f;  2DE6 A;  3CC7 1;  1FDO A;  1VQ5 Z;  1VQ6 1;  2OOY B;  1N8R 1;  1Q16 A;  5IP9 I;  4A93 I;  4NBF A;  4E32 A;  3J80 f;  1S72 1;  3CC2 Z;  3GTK I;  4BBR I;  4X6A I;  1KQS Y;  2JIR A;  2VPZ A;  3I07 A;  4E2Y A;  2QKD A;  3I4M I;  3GTQ I;  2R93 I;  2ZAE B;  2V3V A;  4A3C I;  1VQO Z;  2JIO A;  1QXF A;  3CC2 1;  2W04 A;  3HOZ I;  4RVH A;  1RNI A;  1VQ5 1;  2JR6 A;  2F4O A;  2E7Z A;  2V8K A;  2VF1 A;  4MON A;  3FKI I;  5T64 A;  2P28 A;  2OTL 1;  3G4S Z;  4MXU A;  3IX0 A;  1K8A 2;  3VB9 A;  3NH8 A;  1USP B;  1VQL 1;  4HH4 A;  3NFZ A;  3VMI A;  3HOX I;  1VQK Z;  3CC4 Z;  3KIF A;  2W03 A;  2WAQ A;  1KC8 2;  3CCS 1;  1QVG Y;  3I55 1;  3CCV Z;  5FLX b;  1M90 1;  2R7Z I;  2JS4 A;  2LFU A;  3CCL Z;  3G71 1;  1YIT 1;  5C3E I;  1KD1 2;  1X3W A;  2QEX 1;  5C4X I;  3TE5 B;  3G6E Z;  3M4O I;  3CQZ I;  1Q86 2;  1WZN A;  2GU2 A;  1RLY A;  5AN9 F;  1ZB8 A;  2RT9 A;  1W2B Y;  1YIT Z;  1Q7Y 1;  1I50 I;  2VPW A;  3CC4 1;  3J7A 4;  3MZK B;  3CCM 1;  3GTM I;  4A3L I;  5A2Q f;  1RO2 A;  1VQN Z;  2R6M A;  5LL6 f;  1WJ2 A;  2JA5 I;  4A3I I;  1NUI A;  3VMH A;  1YIJ 1;  4A3K I;  1VQP 1;  3CCL 1;  3CME 1;  2QRD B;  3NH4 A;  2PM9 A;  1VQ9 1;  1ZB9 A;  5C44 I;  3HOW I;  1QYP A;  1L1O C;  4RV9 A;  3GTG I;  2F4M A;  1AA6 A;  3IFU A;  1K8A 1;  4QTU A;  1KD1 1;  3HOU I;  4MD9 A;  1RO4 A;  1ZH1 A;  1LQL A;  1YJ9 1;  4A3B I;  2QLV B;  1KC8 1;  2DE5 A;  1WCM I;  3FQQ A;  4CL1 A;  2RHB A;  3S16 I;  1YJN Z;  1TWC I;  4NB8 A;  4A3J I;  3S15 I;  2V45 A;  1Y1W I;  3CCR Z;  2Q4Z A;  4MRI A;  2AYD A;  1K73 1;  1SFO I;  4A3F I;  3CCS Z;  3EER A;  2H85 A;  3D6W A;  3GTL I;  2OTJ Z;  1YI2 1;  3S1M I;  2JA7 I;  1RQF A;  3NDI A;  2VUG A;  1M1K 2;  1NP6 A;  2VPY A;  2QA4 Z;  3G6E 1;  1X3Z A;  1KRL A;  3G71 Z;  4RS4 A;  2V8J A;  5IP7 I;  1VQ4 Z;  3CC7 Z;  1JJ2 Z;  5FLM I;  3HOV I;  3CCU Z;  4NBE A;  2LEX A;  2E2H I;  3CCE 1;  3J81 f;  3GTO I;  1X0T A;  3CXC Z;  1Z03 A;  5C4J I;  4E33 A;  3OW2 Y;  2O4H A;  2DE7 A;  1JJ2 Y;  4NBB A;  4DGL A;  3BG0 B;  2JIM A;  3F3F C;  3CCQ Z;  2R92 I;  4BY7 I;  1VQN 1;  2O53 A;  4E2Z A;  1DL6 A;  2OTJ 1;  1K73 2;  3CPW Y;  3KIH A;  2M6N A;  2HU9 A;  2JA6 I;  2K3R A; 
#chains in the Genus database with same CATH homology
 3CD6 Z;  1VQ8 Z;  2KPI A;  2OZK A;  3CCU 1;  1USP A;  1VQ7 Z;  3MZL B;  3VTN A;  1Q82 1;  3S1N I;  1VQ9 Z;  1VQL Z;  3QWU A;  3CPW Z;  1VQK 1;  3GTM S;  1Y1V S;  2HF1 A;  1Q82 2;  3F3P C;  3GCF A;  2OTL Z;  4DQY B;  2RIQ A;  1WW9 A;  5CM2 M;  1Q7Y 2;  4EWC A;  1YJ9 Z;  1Q81 1;  4NH1 C;  2B63 I;  1QF8 A;  3NDJ A;  1Q81 2;  2I3C A;  1YUK A;  1WII A;  1I6H I;  2JNY A;  1VQO 1;  1QVF Y;  2M48 A;  3M3Y I;  4NBA A;  1I3Q I;  3GKQ A;  3S14 I;  4QTT A;  5D1P A;  1P9N A;  2QEX Z;  1KQS Z;  3J81 b;  3Q87 A;  2GTH A;  1NJI 2;  3HOY I;  4BBS I;  1YIJ Z;  3CMA Z;  1VQM 1;  1YI2 Z;  5A2Q b;  3BG1 B;  2JA8 I;  2E9H A;  3S1R I;  1YUA A;  1K83 I;  1ML8 A;  4TNU A;  3U50 C;  3G4S 1;  1TWH I;  2EGT A;  4A3G I;  4RVD A;  4E2W A;  4Y7N I;  1VQ4 1;  2AKL A;  1Z01 A;  1RO0 A;  2IZ4 A;  2NVQ I;  1W2B Z;  3ESW A;  3TDH B;  4MD8 A;  1N2F A;  2QR1 B;  4E2X A;  2Q51 A;  2J6A A;  1S7M A;  1QVG Z;  4XX2 A;  5T67 A;  4A3D I;  4NOZ A;  2G2K A;  5D1O A;  2VUM I;  1QVF Z;  1YJW 1;  1VLA A;  3MON A;  5IT9 b;  3S17 I;  1VQM Z;  2QRC B;  4A3E I;  2RBL A;  4E31 A;  4NBH A;  2K5R A;  1M1K 1;  1TWA I;  3CD6 1;  1M90 2;  4NBD A;  3S2H I;  5T6B A;  3PO2 I;  3D9X A;  1TWF I;  3NH5 A;  3T4N B;  4NBG A;  3I56 1;  2BJO A;  3H0G I;  4RVF A;  2GTI A;  4MD7 A;  2P3Y A;  2WB1 A;  2PK7 A;  1JWH C;  1NJI 1;  4BXX I;  2LIY A;  3P5J B;  2NVT I;  5D1O B;  1VQP Z;  2IZ3 A;  2V8I A;  2PMZ A;  4NBC A;  2OOX B;  5IT9 f;  3PO3 S;  3FQM A;  4HGZ A;  3GTJ I;  4BY1 I;  2E2J I;  1Q86 1;  3GTP I;  4AYB A;  3I55 Z;  2YAD A;  3IF8 A;  3VMG A;  2KI7 B;  2QRE B;  1K9M 2;  4NFR A;  4DK1 A;  4HGY A;  4Y52 I;  3EED A;  1Z02 A;  1YHQ Z;  4A3M I;  3CCR 1;  1K9M 1;  4S1T A;  3I56 Z;  3JAM b;  1VQ7 1;  3CCV 1;  3PO3 I;  3CMA 1;  4MH4 A;  3LUS A;  3H3V J;  2E2I I;  4NB9 A;  2RPR A;  1TFI A;  2JMO A;  3RZO I;  3CCQ 1;  1YJN 1;  1PFT A;  1S72 Z;  3RZD I;  1TWG I;  3HKZ A;  3CCJ Z;  2QA4 1;  5FLX f;  1N8R 2;  4E30 A;  3CXC Y;  3K7A I;  1R9T I;  2JUB A;  1VQ8 1;  1VQ6 Z;  3J80 b;  3OW2 Z;  3S1Q I;  1YHQ 1;  1YJW Z;  3CCM Z;  1Y1V I;  3CCE Z;  2Y0S A;  3I4N I;  3CME Z;  2NVY I;  4RVG A;  3CCJ 1;  2YU9 I;  3S2D I;  2NVX I;  3JAM f;  2DE6 A;  3CC7 1;  1VQ5 Z;  1VQ6 1;  2OOY B;  1N8R 1;  5IP9 I;  4A93 I;  4NBF A;  4E32 A;  3J80 f;  1S72 1;  3CC2 Z;  3GTK I;  4BBR I;  4X6A I;  1KQS Y;  3I07 A;  4E2Y A;  2QKD A;  3I4M I;  3GTQ I;  2R93 I;  2ZAE B;  4A3C I;  1VQO Z;  3CC2 1;  2W04 A;  3HOZ I;  4RVH A;  1RNI A;  1VQ5 1;  2JR6 A;  2F4O A;  2V8K A;  2VF1 A;  4MON A;  5T64 A;  3FKI I;  2OTL 1;  2P28 A;  3G4S Z;  4MXU A;  3IX0 A;  1K8A 2;  3VB9 A;  3NH8 A;  1USP B;  1VQL 1;  4HH4 A;  3NFZ A;  3VMI A;  3HOX I;  1VQK Z;  3CC4 Z;  3KIF A;  2W03 A;  2WAQ A;  1KC8 2;  3CCS 1;  1QVG Y;  3I55 1;  3CCV Z;  5FLX b;  1M90 1;  2R7Z I;  2JS4 A;  2LFU A;  3CCL Z;  3G71 1;  1YIT 1;  5C3E I;  1KD1 2;  1X3W A;  2QEX 1;  5C4X I;  3TE5 B;  3G6E Z;  3M4O I;  3CQZ I;  1Q86 2;  2GU2 A;  1RLY A;  5AN9 F;  1ZB8 A;  2RT9 A;  1W2B Y;  1YIT Z;  1Q7Y 1;  1I50 I;  3CC4 1;  3J7A 4;  3MZK B;  3CCM 1;  3GTM I;  4A3L I;  5A2Q f;  1RO2 A;  1VQN Z;  2R6M A;  5LL6 f;  2JA5 I;  4A3I I;  1NUI A;  3VMH A;  1YIJ 1;  4A3K I;  1VQP 1;  3CCL 1;  3CME 1;  2QRD B;  3NH4 A;  2PM9 A;  1VQ9 1;  1ZB9 A;  5C44 I;  3HOW I;  1QYP A;  1L1O C;  4RV9 A;  3GTG I;  2F4M A;  3IFU A;  1K8A 1;  4QTU A;  1KD1 1;  3HOU I;  4MD9 A;  1RO4 A;  1ZH1 A;  1LQL A;  1YJ9 1;  4A3B I;  2QLV B;  1KC8 1;  2DE5 A;  1WCM I;  3FQQ A;  4CL1 A;  2RHB A;  3S16 I;  1YJN Z;  1TWC I;  4NB8 A;  4A3J I;  3S15 I;  1Y1W I;  3CCR Z;  2Q4Z A;  4MRI A;  1K73 1;  1SFO I;  4A3F I;  3CCS Z;  3EER A;  2H85 A;  3D6W A;  3GTL I;  2OTJ Z;  1YI2 1;  3S1M I;  2JA7 I;  1RQF A;  3NDI A;  2VUG A;  1M1K 2;  1NP6 A;  2QA4 Z;  3G6E 1;  1X3Z A;  1KRL A;  3G71 Z;  4RS4 A;  2V8J A;  5IP7 I;  1VQ4 Z;  3CC7 Z;  1JJ2 Z;  5FLM I;  3HOV I;  3CCU Z;  4NBE A;  2E2H I;  3CCE 1;  3J81 f;  3GTO I;  1X0T A;  3CXC Z;  1Z03 A;  5C4J I;  4E33 A;  3OW2 Y;  2O4H A;  2DE7 A;  1JJ2 Y;  4NBB A;  4DGL A;  3BG0 B;  3F3F C;  3CCQ Z;  2R92 I;  4BY7 I;  1VQN 1;  2O53 A;  4E2Z A;  1DL6 A;  2OTJ 1;  1K73 2;  3CPW Y;  3KIH A;  2M6N A;  2HU9 A;  2JA6 I;  2K3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...