1KC81

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8100
3CCRZ 1VQNZ 3CC4Z 1VQO1 1YIT1 1K9M1 1VQOZ 1YITZ 1VQL1 1M1K2 1KQSY 3CCU1 1Q822 1YJNZ 1VQLZ 3G4S1 1M1K1 1Q821 1YIJ1 1K732 3OW2Z 1YHQ1 1YIJZ 3CXCY 3CCS1 1YHQZ 3CCL1 3CCSZ 3CMEZ 3CPWY 3G711 3CCLZ 1S721 3G71Z 1K731 1VQK1 1S72Z 1NJI1 3CC41 1VQKZ 1KD11 3CCM1 3CC21 1Q811 3CCMZ 3I55Z 1YJN1 1QVGZ 1M901 3CC2Z 1QVFY 3OW2Y 1JJ2Z 3I561 3I56Z 1KC82 1W2BY 2QEX1 3CCEZ 1VQM1 1Q7Y1 1VQ91 2QEXZ 1VQMZ 1NJI2 1VQ9Z 1KC81 3CME1 1KD12 1Q812 1VQ61 1M902 1YI21 1VQ6Z 3CC71 1YI2Z 3CC7Z 3G6E1 3I551 1VQ41 3G6EZ 2OTL1 1VQ4Z 1YJW1 1Q7Y2 2OTLZ 2QA41 1YJWZ 1N8R1 1YJ9Z 1K8A1 2QA4Z 3CCQ1 3CCJ1 3CCE1 3CCQZ 3CCJZ 1Q861 1VQ71 1VQ51 1QVGY 1VQ7Z 3CPWZ 1VQ5Z 1JJ2Y 1N8R2 3CCV1 1K8A2 3CCUZ 1VQ81 3CCVZ 1VQ8Z 1VQP1 3G4SZ 1YJ91 1VQPZ 1Q862 1KQSZ 1QVFZ 3CMA1 2OTJ1 3CMAZ 3CD61 2OTJZ 3CD6Z 1K9M2 1W2BZ 3CCR1 1VQN1 3CXCZ
chains in the Genus database with same CATH superfamily
1Z01A 1DL6A 2QRDB 5A2Qf 3MZLB 1K9M1 4QTTA 1VQOZ 1VQL1 2JNYA 5FLXb 1Q822 2KPIA 1QF8A 1Z02A 3HOUI 2OZKA 3VMIA 1Q821 3S14I 1K732 1YHQ1 5FLMI 3CCSZ 1P9NA 4BXXI 2JS4A 3G711 1S721 2JIPA 1K731 1VQK1 2NAPA 3CC41 1RO2A 3S15I 3MONA 1KD11 4DQYB 1QXFA 4A3FI 2GTHA 1FDOA 3CCMZ 2R7ZI 3I55Z 1YJN1 2VPWA 5AN9F 2NVQI 1QVFY 5T64A 3U50C 3S2DI 3J81f 4TNUA 4CL1A 3M4OI 4E2YA 2R6MA 4NB8A 2QEX1 1Q7Y1 5C44I 3IFUA 1NJI2 4MD9A 2E2HI 2JA6I 3S16I 4BY1I 3H3VJ 4RVFA 2JA7I 3EERA 4NFRA 2RPRA 3F3FC 3HOYI 3HOXI 1VQ41 2RHBA 2RBLA 3BG1B 1TFIA 1QYPA 2JA8I 2OTLZ 2EGTA 3VB9A 4MH4A 4XX2A 1YJ9Z 1LQLA 3RZOI 2NVXI 1Q16A 4RS4A 4Y52I 4BBSI 4NBBA 5T67A 2E2JI 2GU2A 4RVHA 1VQ7Z 2WB1A 3GTJI 2E7ZA 3KIFA 3PO2I 4X6AI 2VUMI 4E31A 4A3GI 1N2FA 3CCVZ 2ZAEB 1VQ8Z 4A3CI 3I07A 1VQPZ 3VTNA 1JWHC 3PO3I 2P28A 2E9HA 3CD61 2OTJZ 1WW9A 3S1RI 3NH4A 3CCR1 3CXCZ 1USPB 3CC4Z 3D9XA 4E33A 1YIT1 1WCMI 4MD7A 1KRLA 1KQSY 1NP6A 4RV9A 4A3II 3K7AI 1YJNZ 3BG0B 2NVYI 3G4S1 2E2II 5IT9f 3OW2Z 1YIJZ 2QKDA 3CCL1 3MZKB 2B63I 3CPWY 1R9TI 3FQMA 3GTKI 2DE6A 5C4JI 2AKLA 2R93I 5IP7I 2JMOA 3QWUA 4BBRI 1M901 2Y0SA 1QVGZ 2OOYB 3CC2Z 4A3JI 4MRIA 1JJ2Z 1RO0A 3I56Z 1Y1VS 2JIRA 2JIQA 3EEDA 4NBDA 4S1TA 1WIIA 3JAMb 1VQ91 1VQMZ 1AA6A 1TWGI 2VUGA 3NH5A 3CME1 1KD12 3IR7A 1VQ61 1YI21 3CC7Z 3I4NI 2PMZA 3G6EZ 1I50I 5A2Qb 1YJW1 1Q7Y2 3GTMI 2QA41 4MONA 1ZB9A 1K8A1 2QLVB 4RVDA 4E30A 3CCJ1 2DE5A 3CCE1 3CCQZ 4A3BI 2IZ3A 1PFTA 1VQ51 1WJ2A 2OOXB 2YADA 2V8KA 2V3VA 2V45A 2O4HA 3IX0A 4MXUA 1ZB8A 2V8JA 4QTUA 1Y8CA 3G4SZ 2AYDA 4NBFA 1QVFZ 5D1PA 3I4MI 1TWFI 3ESWA 3J81b 1I6HI 2GTIA 2IV2X 3CMAZ 2PM9A 2Q4ZA 2F4OA 1S7MA 4Y7NI 1VLAA 2KI7B 1VQNZ 5CM2M 1VQO1 3D6WA 1M1K2 3CCU1 1VQLZ 3RZDI 4A3DI 1X0TA 1M1K1 3S2HI 2G2KA 3CXCY 3CCS1 1YHQZ 3CMEZ 3IF8A 3G71Z 4NBEA 2LFUA 4E32A 1S72Z 1VQKZ 3S1NI 3TDHB 3CQZI 3CCM1 3F3PC 1Q811 3HOZI 3GKQA 3OW2Y 4HGYA 2VPXA 4E2WA 2JIOA 1W2BY 3T4NB 3CCEZ 3FKII 2QEXZ 3J80f 1YUKA 2K5RA 5D1OA 4A93I 3NDJA 3HOVI 2JA5I 1M902 5FLXf 4HGZA 2J6AA 1K83I 2VPZA 4DGLA 2QR1B 4A3EI 1VQ4Z 2OTL1 3GCFA 4RVGA 3PO3S 4E2ZA 2F4MA 1N8R1 3LUSA 2V8IA 3GTOI 1Q861 3NH8A 4NBGA 5IT9b 2Q51A 4NH1C 3GTLI 1VQ71 1FDIA 3CPWZ 2WAQA 1K8A2 3CCV1 3VMHA 3CCUZ 1VQ81 1VQP1 3KIHA 3NDIA 4NBAA 2M48A 2VPYA 2QRCB 2OTJ1 3VMGA 2R92I 3CD6Z 2HF1A 2BJOA 1NUIA 2P3YA 1TWHI 1TWCI 3CCRZ 3S1QI 4AYBA 2W03A 3NFZA 1YITZ 2I3CA 1TWAI 2O53A 1WZNA 3GTGI 4A3MI 2NVTI 1YIJ1 5C3EI 3TE5B 3H0GI 1RNIA 2LEXA 3CCLZ 2LIYA 3M3YI 1NJI1 1X3WA 2JUBA 4NBCA 1Z03A 3CC21 3GTMS 2VF1A 3GTPI 3I561 3Q87A 1ZH1A 1SIWA 3P5JB 1KC82 4NB9A 5IP9I 4MD8A 1I3QI 4A3LI 1VQM1 2IZ4A 3GTQI 4HH4A 1VQ9Z 2JR6A 1KC81 3FQQA 3D2LA 1Q812 1L1OC 1X3ZA 1ML8A 1VQ6Z 4NOZA 3CC71 2PK7A 4EWCA 2DE7A 1YI2Z 3G6E1 3S1MI 3I551 1USPA 3J7A4 1YJWZ 3HOWI 2QA4Z 2JIMA 3CCQ1 2HU9A 2RT9A 1Y1VI 2M6NA 3CCJZ 1RQFA 5LL6f 4BY7I 1RO4A 2K3RA 3S17I 1QVGY 1VQ5Z 1JJ2Y 3HKZA 1Y1WI 2YU9I 1N8R2 4DK1A 5C4XI 1SFOI 3JAMf 1YJ91 1Q862 2H85A 5T6BA 1KQSZ 2QREB 4E2XA 2RIQA 3CMA1 1YUAA 1RLYA 5D1OB 2W04A 4A3KI 4NBHA 1K9M2 1W2BZ 1VQN1 3J80b
chains in the Genus database with same CATH topology
1Z01A 1DL6A 2QRDB 5A2Qf 3MZLB 1K9M1 4QTTA 1VQOZ 1VQL1 2JNYA 5FLXb 1Q822 2KPIA 1QF8A 1Z02A 3HOUI 2OZKA 3VMIA 1Q821 3S14I 1K732 1YHQ1 5FLMI 3CCSZ 1P9NA 4BXXI 2JS4A 3G711 1S721 1K731 1VQK1 3CC41 1RO2A 3S15I 3MONA 1KD11 4DQYB 4A3FI 2GTHA 3CCMZ 2R7ZI 3I55Z 1YJN1 5AN9F 2NVQI 1QVFY 5T64A 3U50C 3S2DI 3J81f 4TNUA 4CL1A 3M4OI 4E2YA 2R6MA 4NB8A 2QEX1 1Q7Y1 5C44I 3IFUA 1NJI2 4MD9A 2E2HI 2JA6I 3S16I 4BY1I 3H3VJ 4RVFA 2JA7I 3EERA 4NFRA 2RPRA 3F3FC 3HOYI 3HOXI 1VQ41 2RHBA 2RBLA 3BG1B 1TFIA 1QYPA 2JA8I 2OTLZ 2EGTA 3VB9A 4MH4A 4XX2A 1YJ9Z 1LQLA 3RZOI 2NVXI 4RS4A 4Y52I 4BBSI 4NBBA 5T67A 2E2JI 2GU2A 4RVHA 1VQ7Z 2WB1A 3GTJI 3KIFA 3PO2I 4X6AI 2VUMI 4E31A 4A3GI 1N2FA 3CCVZ 2ZAEB 1VQ8Z 4A3CI 3I07A 1VQPZ 3VTNA 1JWHC 3PO3I 2P28A 2E9HA 3CD61 2OTJZ 1WW9A 3S1RI 3NH4A 3CCR1 3CXCZ 1USPB 3CC4Z 3D9XA 4E33A 1YIT1 1WCMI 4MD7A 1KRLA 1KQSY 1NP6A 4RV9A 4A3II 3K7AI 1YJNZ 3BG0B 2NVYI 3G4S1 2E2II 5IT9f 3OW2Z 1YIJZ 2QKDA 3CCL1 3MZKB 2B63I 3CPWY 1R9TI 3FQMA 3GTKI 2DE6A 5C4JI 2AKLA 2R93I 5IP7I 2JMOA 3QWUA 4BBRI 1M901 2Y0SA 1QVGZ 2OOYB 3CC2Z 4A3JI 4MRIA 1JJ2Z 1RO0A 3I56Z 1Y1VS 3EEDA 4NBDA 4S1TA 1WIIA 3JAMb 1VQ91 1VQMZ 1TWGI 2VUGA 3NH5A 3CME1 1KD12 1VQ61 1YI21 3CC7Z 3I4NI 2PMZA 3G6EZ 1I50I 5A2Qb 1YJW1 1Q7Y2 3GTMI 2QA41 4MONA 1ZB9A 1K8A1 2QLVB 4RVDA 4E30A 3CCJ1 2DE5A 3CCE1 3CCQZ 4A3BI 2IZ3A 1PFTA 1VQ51 2OOXB 2YADA 2V8KA 2O4HA 3IX0A 4MXUA 1ZB8A 2V8JA 4QTUA 3G4SZ 4NBFA 1QVFZ 5D1PA 3I4MI 1TWFI 3ESWA 3J81b 1I6HI 2GTIA 3CMAZ 2PM9A 2Q4ZA 2F4OA 1S7MA 4Y7NI 1VLAA 2KI7B 1VQNZ 5CM2M 1VQO1 3D6WA 1M1K2 3CCU1 1VQLZ 3RZDI 4A3DI 1X0TA 1M1K1 3S2HI 2G2KA 3CXCY 3CCS1 1YHQZ 3CMEZ 3IF8A 3G71Z 4NBEA 2LFUA 4E32A 1S72Z 1VQKZ 3S1NI 3TDHB 3CQZI 3CCM1 3F3PC 1Q811 3HOZI 3GKQA 3OW2Y 4HGYA 4E2WA 1W2BY 3T4NB 3CCEZ 3FKII 2QEXZ 3J80f 1YUKA 2K5RA 5D1OA 4A93I 3NDJA 3HOVI 2JA5I 1M902 5FLXf 4HGZA 2J6AA 1K83I 4DGLA 2QR1B 4A3EI 1VQ4Z 2OTL1 3GCFA 4RVGA 3PO3S 4E2ZA 2F4MA 1N8R1 3LUSA 2V8IA 3GTOI 1Q861 3NH8A 4NBGA 5IT9b 2Q51A 4NH1C 3GTLI 1VQ71 3CPWZ 2WAQA 1K8A2 3CCV1 3VMHA 3CCUZ 1VQ81 1VQP1 3KIHA 3NDIA 4NBAA 2M48A 2QRCB 2OTJ1 3VMGA 2R92I 3CD6Z 2HF1A 2BJOA 1NUIA 2P3YA 1TWHI 1TWCI 3CCRZ 3S1QI 4AYBA 2W03A 3NFZA 1YITZ 2I3CA 1TWAI 2O53A 3GTGI 4A3MI 2NVTI 1YIJ1 5C3EI 3TE5B 3H0GI 1RNIA 3CCLZ 2LIYA 3M3YI 1NJI1 1X3WA 2JUBA 4NBCA 1Z03A 3CC21 3GTMS 2VF1A 3GTPI 3I561 3Q87A 1ZH1A 3P5JB 1KC82 4NB9A 5IP9I 4MD8A 1I3QI 4A3LI 1VQM1 2IZ4A 3GTQI 4HH4A 1VQ9Z 2JR6A 1KC81 3FQQA 1Q812 1L1OC 1X3ZA 1ML8A 1VQ6Z 4NOZA 3CC71 2PK7A 4EWCA 2DE7A 1YI2Z 3G6E1 3S1MI 3I551 1USPA 3J7A4 1YJWZ 3HOWI 2QA4Z 3CCQ1 2HU9A 2RT9A 1Y1VI 2M6NA 3CCJZ 1RQFA 5LL6f 4BY7I 1RO4A 2K3RA 3S17I 1QVGY 1VQ5Z 1JJ2Y 3HKZA 1Y1WI 2YU9I 1N8R2 4DK1A 5C4XI 1SFOI 3JAMf 1YJ91 1Q862 2H85A 5T6BA 1KQSZ 2QREB 4E2XA 2RIQA 3CMA1 1YUAA 1RLYA 5D1OB 2W04A 4A3KI 4NBHA 1K9M2 1W2BZ 1VQN1 3J80b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR Z;  1VQN Z;  3CC4 Z;  1VQO 1;  1YIT 1;  1K9M 1;  1VQO Z;  1YIT Z;  1VQL 1;  1M1K 2;  1KQS Y;  3CCU 1;  1Q82 2;  1YJN Z;  1VQL Z;  3G4S 1;  1M1K 1;  1Q82 1;  1YIJ 1;  1K73 2;  3OW2 Z;  1YHQ 1;  1YIJ Z;  3CXC Y;  3CCS 1;  1YHQ Z;  3CCL 1;  3CCS Z;  3CME Z;  3CPW Y;  3G71 1;  3CCL Z;  1S72 1;  3G71 Z;  1K73 1;  1VQK 1;  1S72 Z;  1NJI 1;  3CC4 1;  1VQK Z;  1KD1 1;  3CCM 1;  3CC2 1;  1Q81 1;  3CCM Z;  3I55 Z;  1YJN 1;  1QVG Z;  1M90 1;  3CC2 Z;  1QVF Y;  3OW2 Y;  1JJ2 Z;  3I56 1;  3I56 Z;  1KC8 2;  1W2B Y;  2QEX 1;  3CCE Z;  1VQM 1;  1Q7Y 1;  1VQ9 1;  2QEX Z;  1VQM Z;  1NJI 2;  1VQ9 Z;  1KC8 1;  3CME 1;  1KD1 2;  1Q81 2;  1VQ6 1;  1M90 2;  1YI2 1;  1VQ6 Z;  3CC7 1;  1YI2 Z;  3CC7 Z;  3G6E 1;  3I55 1;  1VQ4 1;  3G6E Z;  2OTL 1;  1VQ4 Z;  1YJW 1;  1Q7Y 2;  2OTL Z;  2QA4 1;  1YJW Z;  1N8R 1;  1YJ9 Z;  1K8A 1;  2QA4 Z;  3CCQ 1;  3CCJ 1;  3CCE 1;  3CCQ Z;  3CCJ Z;  1Q86 1;  1VQ7 1;  1VQ5 1;  1QVG Y;  1VQ7 Z;  3CPW Z;  1VQ5 Z;  1JJ2 Y;  1N8R 2;  3CCV 1;  1K8A 2;  3CCU Z;  1VQ8 1;  3CCV Z;  1VQ8 Z;  1VQP 1;  3G4S Z;  1YJ9 1;  1VQP Z;  1Q86 2;  1KQS Z;  1QVF Z;  3CMA 1;  2OTJ 1;  3CMA Z;  3CD6 1;  2OTJ Z;  3CD6 Z;  1K9M 2;  1W2B Z;  3CCR 1;  1VQN 1;  3CXC Z; 
#chains in the Genus database with same CATH topology
 1Z01 A;  1DL6 A;  2QRD B;  5A2Q f;  3MZL B;  1K9M 1;  4QTT A;  1VQO Z;  1VQL 1;  2JNY A;  5FLX b;  1Q82 2;  2KPI A;  1QF8 A;  1Z02 A;  3HOU I;  2OZK A;  3VMI A;  1Q82 1;  3S14 I;  1K73 2;  1YHQ 1;  5FLM I;  3CCS Z;  1P9N A;  4BXX I;  2JS4 A;  3G71 1;  1S72 1;  2JIP A;  1K73 1;  1VQK 1;  2NAP A;  3CC4 1;  1RO2 A;  3S15 I;  3MON A;  1KD1 1;  4DQY B;  1QXF A;  4A3F I;  2GTH A;  1FDO A;  3CCM Z;  2R7Z I;  3I55 Z;  1YJN 1;  2VPW A;  5AN9 F;  2NVQ I;  1QVF Y;  5T64 A;  3U50 C;  3S2D I;  3J81 f;  4TNU A;  4CL1 A;  3M4O I;  4E2Y A;  2R6M A;  4NB8 A;  2QEX 1;  1Q7Y 1;  5C44 I;  3IFU A;  1NJI 2;  4MD9 A;  2E2H I;  2JA6 I;  3S16 I;  4BY1 I;  3H3V J;  4RVF A;  2JA7 I;  3EER A;  4NFR A;  2RPR A;  3F3F C;  3HOY I;  3HOX I;  1VQ4 1;  2RHB A;  2RBL A;  3BG1 B;  1TFI A;  1QYP A;  2JA8 I;  2OTL Z;  2EGT A;  3VB9 A;  4MH4 A;  4XX2 A;  1YJ9 Z;  1LQL A;  3RZO I;  2NVX I;  1Q16 A;  4RS4 A;  4Y52 I;  4BBS I;  4NBB A;  5T67 A;  2E2J I;  2GU2 A;  4RVH A;  1VQ7 Z;  2WB1 A;  3GTJ I;  2E7Z A;  3KIF A;  3PO2 I;  4X6A I;  2VUM I;  4E31 A;  4A3G I;  1N2F A;  3CCV Z;  2ZAE B;  1VQ8 Z;  4A3C I;  3I07 A;  1VQP Z;  3VTN A;  1JWH C;  3PO3 I;  2P28 A;  2E9H A;  3CD6 1;  2OTJ Z;  1WW9 A;  3S1R I;  3NH4 A;  3CCR 1;  3CXC Z;  1USP B;  3CC4 Z;  3D9X A;  4E33 A;  1YIT 1;  1WCM I;  4MD7 A;  1KRL A;  1KQS Y;  1NP6 A;  4RV9 A;  4A3I I;  3K7A I;  1YJN Z;  3BG0 B;  2NVY I;  3G4S 1;  2E2I I;  5IT9 f;  3OW2 Z;  1YIJ Z;  2QKD A;  3CCL 1;  3MZK B;  2B63 I;  3CPW Y;  1R9T I;  3FQM A;  3GTK I;  2DE6 A;  5C4J I;  2AKL A;  2R93 I;  5IP7 I;  2JMO A;  3QWU A;  4BBR I;  1M90 1;  2Y0S A;  1QVG Z;  2OOY B;  3CC2 Z;  4A3J I;  4MRI A;  1JJ2 Z;  1RO0 A;  3I56 Z;  1Y1V S;  2JIR A;  2JIQ A;  3EED A;  4NBD A;  4S1T A;  1WII A;  3JAM b;  1VQ9 1;  1VQM Z;  1AA6 A;  1TWG I;  2VUG A;  3NH5 A;  3CME 1;  1KD1 2;  3IR7 A;  1VQ6 1;  1YI2 1;  3CC7 Z;  3I4N I;  2PMZ A;  3G6E Z;  1I50 I;  5A2Q b;  1YJW 1;  1Q7Y 2;  3GTM I;  2QA4 1;  4MON A;  1ZB9 A;  1K8A 1;  2QLV B;  4RVD A;  4E30 A;  3CCJ 1;  2DE5 A;  3CCE 1;  3CCQ Z;  4A3B I;  2IZ3 A;  1PFT A;  1VQ5 1;  1WJ2 A;  2OOX B;  2YAD A;  2V8K A;  2V3V A;  2V45 A;  2O4H A;  3IX0 A;  4MXU A;  1ZB8 A;  2V8J A;  4QTU A;  1Y8C A;  3G4S Z;  2AYD A;  4NBF A;  1QVF Z;  5D1P A;  3I4M I;  1TWF I;  3ESW A;  3J81 b;  1I6H I;  2GTI A;  2IV2 X;  3CMA Z;  2PM9 A;  2Q4Z A;  2F4O A;  1S7M A;  4Y7N I;  1VLA A;  2KI7 B;  1VQN Z;  5CM2 M;  1VQO 1;  3D6W A;  1M1K 2;  3CCU 1;  1VQL Z;  3RZD I;  4A3D I;  1X0T A;  1M1K 1;  3S2H I;  2G2K A;  3CXC Y;  3CCS 1;  1YHQ Z;  3CME Z;  3IF8 A;  3G71 Z;  4NBE A;  2LFU A;  4E32 A;  1S72 Z;  1VQK Z;  3S1N I;  3TDH B;  3CQZ I;  3CCM 1;  3F3P C;  1Q81 1;  3HOZ I;  3GKQ A;  3OW2 Y;  4HGY A;  2VPX A;  4E2W A;  2JIO A;  1W2B Y;  3T4N B;  3CCE Z;  3FKI I;  2QEX Z;  3J80 f;  1YUK A;  2K5R A;  5D1O A;  4A93 I;  3NDJ A;  3HOV I;  2JA5 I;  1M90 2;  5FLX f;  4HGZ A;  2J6A A;  1K83 I;  2VPZ A;  4DGL A;  2QR1 B;  4A3E I;  1VQ4 Z;  2OTL 1;  3GCF A;  4RVG A;  3PO3 S;  4E2Z A;  2F4M A;  1N8R 1;  3LUS A;  2V8I A;  3GTO I;  1Q86 1;  3NH8 A;  4NBG A;  5IT9 b;  2Q51 A;  4NH1 C;  3GTL I;  1VQ7 1;  1FDI A;  3CPW Z;  2WAQ A;  1K8A 2;  3CCV 1;  3VMH A;  3CCU Z;  1VQ8 1;  1VQP 1;  3KIH A;  3NDI A;  4NBA A;  2M48 A;  2VPY A;  2QRC B;  2OTJ 1;  3VMG A;  2R92 I;  3CD6 Z;  2HF1 A;  2BJO A;  1NUI A;  2P3Y A;  1TWH I;  1TWC I;  3CCR Z;  3S1Q I;  4AYB A;  2W03 A;  3NFZ A;  1YIT Z;  2I3C A;  1TWA I;  2O53 A;  1WZN A;  3GTG I;  4A3M I;  2NVT I;  1YIJ 1;  5C3E I;  3TE5 B;  3H0G I;  1RNI A;  2LEX A;  3CCL Z;  2LIY A;  3M3Y I;  1NJI 1;  1X3W A;  2JUB A;  4NBC A;  1Z03 A;  3CC2 1;  3GTM S;  2VF1 A;  3GTP I;  3I56 1;  3Q87 A;  1ZH1 A;  1SIW A;  3P5J B;  1KC8 2;  4NB9 A;  5IP9 I;  4MD8 A;  1I3Q I;  4A3L I;  1VQM 1;  2IZ4 A;  3GTQ I;  4HH4 A;  1VQ9 Z;  2JR6 A;  1KC8 1;  3FQQ A;  3D2L A;  1Q81 2;  1L1O C;  1X3Z A;  1ML8 A;  1VQ6 Z;  4NOZ A;  3CC7 1;  2PK7 A;  4EWC A;  2DE7 A;  1YI2 Z;  3G6E 1;  3S1M I;  3I55 1;  1USP A;  3J7A 4;  1YJW Z;  3HOW I;  2QA4 Z;  2JIM A;  3CCQ 1;  2HU9 A;  2RT9 A;  1Y1V I;  2M6N A;  3CCJ Z;  1RQF A;  5LL6 f;  4BY7 I;  1RO4 A;  2K3R A;  3S17 I;  1QVG Y;  1VQ5 Z;  1JJ2 Y;  3HKZ A;  1Y1W I;  2YU9 I;  1N8R 2;  4DK1 A;  5C4X I;  1SFO I;  3JAM f;  1YJ9 1;  1Q86 2;  2H85 A;  5T6B A;  1KQS Z;  2QRE B;  4E2X A;  2RIQ A;  3CMA 1;  1YUA A;  1RLY A;  5D1O B;  2W04 A;  4A3K I;  4NBH A;  1K9M 2;  1W2B Z;  1VQN 1;  3J80 b; 
#chains in the Genus database with same CATH homology
 1Z01 A;  1DL6 A;  2QRD B;  5A2Q f;  3MZL B;  1K9M 1;  4QTT A;  1VQO Z;  1VQL 1;  2JNY A;  5FLX b;  1Q82 2;  2KPI A;  1QF8 A;  1Z02 A;  3HOU I;  2OZK A;  3VMI A;  1Q82 1;  3S14 I;  1K73 2;  1YHQ 1;  5FLM I;  3CCS Z;  1P9N A;  4BXX I;  2JS4 A;  3G71 1;  1S72 1;  1K73 1;  1VQK 1;  3CC4 1;  1RO2 A;  3S15 I;  3MON A;  1KD1 1;  4DQY B;  4A3F I;  2GTH A;  3CCM Z;  2R7Z I;  3I55 Z;  1YJN 1;  5AN9 F;  2NVQ I;  1QVF Y;  5T64 A;  3U50 C;  3S2D I;  3J81 f;  4TNU A;  4CL1 A;  3M4O I;  4E2Y A;  2R6M A;  4NB8 A;  2QEX 1;  1Q7Y 1;  5C44 I;  3IFU A;  1NJI 2;  4MD9 A;  2E2H I;  2JA6 I;  3S16 I;  4BY1 I;  3H3V J;  4RVF A;  2JA7 I;  3EER A;  4NFR A;  2RPR A;  3F3F C;  3HOY I;  3HOX I;  1VQ4 1;  2RHB A;  2RBL A;  3BG1 B;  1TFI A;  1QYP A;  2JA8 I;  2OTL Z;  2EGT A;  3VB9 A;  4MH4 A;  4XX2 A;  1YJ9 Z;  1LQL A;  3RZO I;  2NVX I;  4RS4 A;  4Y52 I;  4BBS I;  4NBB A;  5T67 A;  2E2J I;  2GU2 A;  4RVH A;  1VQ7 Z;  2WB1 A;  3GTJ I;  3KIF A;  3PO2 I;  4X6A I;  2VUM I;  4E31 A;  4A3G I;  1N2F A;  3CCV Z;  2ZAE B;  1VQ8 Z;  4A3C I;  3I07 A;  1VQP Z;  3VTN A;  1JWH C;  3PO3 I;  2P28 A;  2E9H A;  3CD6 1;  2OTJ Z;  1WW9 A;  3S1R I;  3NH4 A;  3CCR 1;  3CXC Z;  1USP B;  3CC4 Z;  3D9X A;  4E33 A;  1YIT 1;  1WCM I;  4MD7 A;  1KRL A;  1KQS Y;  1NP6 A;  4RV9 A;  4A3I I;  3K7A I;  1YJN Z;  3BG0 B;  2NVY I;  3G4S 1;  2E2I I;  5IT9 f;  3OW2 Z;  1YIJ Z;  2QKD A;  3CCL 1;  3MZK B;  2B63 I;  3CPW Y;  1R9T I;  3FQM A;  3GTK I;  2DE6 A;  5C4J I;  2AKL A;  2R93 I;  5IP7 I;  2JMO A;  3QWU A;  4BBR I;  1M90 1;  2Y0S A;  1QVG Z;  2OOY B;  3CC2 Z;  4A3J I;  4MRI A;  1JJ2 Z;  1RO0 A;  3I56 Z;  1Y1V S;  3EED A;  4NBD A;  4S1T A;  1WII A;  3JAM b;  1VQ9 1;  1VQM Z;  1TWG I;  2VUG A;  3NH5 A;  3CME 1;  1KD1 2;  1VQ6 1;  1YI2 1;  3CC7 Z;  3I4N I;  2PMZ A;  3G6E Z;  1I50 I;  5A2Q b;  1YJW 1;  1Q7Y 2;  3GTM I;  2QA4 1;  4MON A;  1ZB9 A;  1K8A 1;  2QLV B;  4RVD A;  4E30 A;  3CCJ 1;  2DE5 A;  3CCE 1;  3CCQ Z;  4A3B I;  2IZ3 A;  1PFT A;  1VQ5 1;  2OOX B;  2YAD A;  2V8K A;  2O4H A;  3IX0 A;  4MXU A;  1ZB8 A;  2V8J A;  4QTU A;  3G4S Z;  4NBF A;  1QVF Z;  5D1P A;  3I4M I;  1TWF I;  3ESW A;  3J81 b;  1I6H I;  2GTI A;  3CMA Z;  2PM9 A;  2Q4Z A;  2F4O A;  1S7M A;  4Y7N I;  1VLA A;  2KI7 B;  1VQN Z;  5CM2 M;  1VQO 1;  3D6W A;  1M1K 2;  3CCU 1;  1VQL Z;  3RZD I;  4A3D I;  1X0T A;  1M1K 1;  3S2H I;  2G2K A;  3CXC Y;  3CCS 1;  1YHQ Z;  3CME Z;  3IF8 A;  3G71 Z;  4NBE A;  2LFU A;  4E32 A;  1S72 Z;  1VQK Z;  3S1N I;  3TDH B;  3CQZ I;  3CCM 1;  3F3P C;  1Q81 1;  3HOZ I;  3GKQ A;  3OW2 Y;  4HGY A;  4E2W A;  1W2B Y;  3T4N B;  3CCE Z;  3FKI I;  2QEX Z;  3J80 f;  1YUK A;  2K5R A;  5D1O A;  4A93 I;  3NDJ A;  3HOV I;  2JA5 I;  1M90 2;  5FLX f;  4HGZ A;  2J6A A;  1K83 I;  4DGL A;  2QR1 B;  4A3E I;  1VQ4 Z;  2OTL 1;  3GCF A;  4RVG A;  3PO3 S;  4E2Z A;  2F4M A;  1N8R 1;  3LUS A;  2V8I A;  3GTO I;  1Q86 1;  3NH8 A;  4NBG A;  5IT9 b;  2Q51 A;  4NH1 C;  3GTL I;  1VQ7 1;  3CPW Z;  2WAQ A;  1K8A 2;  3CCV 1;  3VMH A;  3CCU Z;  1VQ8 1;  1VQP 1;  3KIH A;  3NDI A;  4NBA A;  2M48 A;  2QRC B;  2OTJ 1;  3VMG A;  2R92 I;  3CD6 Z;  2HF1 A;  2BJO A;  1NUI A;  2P3Y A;  1TWH I;  1TWC I;  3CCR Z;  3S1Q I;  4AYB A;  2W03 A;  3NFZ A;  1YIT Z;  2I3C A;  1TWA I;  2O53 A;  3GTG I;  4A3M I;  2NVT I;  1YIJ 1;  5C3E I;  3TE5 B;  3H0G I;  1RNI A;  3CCL Z;  2LIY A;  3M3Y I;  1NJI 1;  1X3W A;  2JUB A;  4NBC A;  1Z03 A;  3CC2 1;  3GTM S;  2VF1 A;  3GTP I;  3I56 1;  3Q87 A;  1ZH1 A;  3P5J B;  1KC8 2;  4NB9 A;  5IP9 I;  4MD8 A;  1I3Q I;  4A3L I;  1VQM 1;  2IZ4 A;  3GTQ I;  4HH4 A;  1VQ9 Z;  2JR6 A;  1KC8 1;  3FQQ A;  1Q81 2;  1L1O C;  1X3Z A;  1ML8 A;  1VQ6 Z;  4NOZ A;  3CC7 1;  2PK7 A;  4EWC A;  2DE7 A;  1YI2 Z;  3G6E 1;  3S1M I;  3I55 1;  1USP A;  3J7A 4;  1YJW Z;  3HOW I;  2QA4 Z;  3CCQ 1;  2HU9 A;  2RT9 A;  1Y1V I;  2M6N A;  3CCJ Z;  1RQF A;  5LL6 f;  4BY7 I;  1RO4 A;  2K3R A;  3S17 I;  1QVG Y;  1VQ5 Z;  1JJ2 Y;  3HKZ A;  1Y1W I;  2YU9 I;  1N8R 2;  4DK1 A;  5C4X I;  1SFO I;  3JAM f;  1YJ9 1;  1Q86 2;  2H85 A;  5T6B A;  1KQS Z;  2QRE B;  4E2X A;  2RIQ A;  3CMA 1;  1YUA A;  1RLY A;  5D1O B;  2W04 A;  4A3K I;  4NBH A;  1K9M 2;  1W2B Z;  1VQN 1;  3J80 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...