1KC81

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8100
3CCSZ 1YHQ1 1VQNZ 1K8A2 3CCQZ 1KQSY 1W2BZ 3CC7Z 1YJNZ 2QEXZ 1YIJ1 3OW2Y 3CPWZ 1S72Z 1YHQZ 1YI2Z 1K731 3CCU1 1VQ51 3G711 1VQ91 3CCJ1 1JJ2Y 1K732 1VQP1 1QVGZ 1Q7Y1 1VQL1 1Q811 3CD61 1VQM1 1M1K1 1KD11 1VQ6Z 2QA4Z 1Q7Y2 1W2BY 3CCRZ 1Q812 1M1K2 3CCUZ 1VQ5Z 3G71Z 1VQ9Z 1KD12 1N8R1 3CCMZ 3CCJZ 3CPWY 1Q821 3CCE1 1VQPZ 1N8R2 1VQLZ 1VQ71 1Q822 3CD6Z 3G4S1 1VQMZ 3I551 1YJ91 3CME1 1Q861 2OTJ1 3I561 1YJW1 3CCV1 1VQ41 1Q862 1YIJZ 1VQO1 3CMA1 3CCS1 1QVGY 1VQN1 1NJI1 3CCEZ 1VQ81 3CC21 1VQK1 1QVFZ 3CXCZ 3CC71 3G6E1 1YJN1 3G4SZ 2OTL1 1NJI2 3I56Z 3CCVZ 3CC41 1S721 1M901 1KQSZ 1YI21 1YIT1 1VQ8Z 3CC2Z 1VQKZ 1M902 1K9M1 3G6EZ 3CCL1 3OW2Z 2OTLZ 1KC81 1K9M2 3CCQ1 1KC82 1VQ7Z 3CC4Z 1VQ61 2QA41 1QVFY 3I55Z 3CMEZ 3CCR1 3CXCY 1YITZ 1YJ9Z 2OTJZ 2QEX1 1JJ2Z 1YJWZ 1VQ4Z 3CCM1 1K8A1 3CCLZ 1VQOZ 3CMAZ
chains in the Genus database with same CATH superfamily
3CCSZ 1YHQ1 1X0TA 2GU2A 2K5RA 2R93I 3GTKI 4A3BI 2E2JI 3P5JB 2QEXZ 1SIWA 3HOWI 4BBRI 1YUAA 3NH4A 1TWAI 5C44I 1USPA 3NFZA 3I4MI 3CCU1 5IT9b 3GTMI 1QXFA 3GTLI 2PK7A 1VQP1 3RZDI 1SFOI 2V3VA 3GTQI 1Q811 2NVYI 2P28A 3H0GI 1KD11 1W2BY 1DL6A 4XX2A 1Q812 4NBEA 3D6WA 2O53A 4E30A 1KD12 4MD9A 3S2DI 3CPWY 3U50C 1Q821 2RHBA 5IT9f 1VQLZ 2NVQI 3VMGA 1VQ71 1Q822 2VF1A 3I551 1YJ91 2ZAEB 3TDHB 3S1RI 4BY1I 1K83I 3CCV1 4RVHA 2JA5I 1YIJZ 4E33A 3K7AI 4DK1A 3JAMf 3GTMS 1RQFA 3HOUI 1TWHI 1S7MA 2JS4A 3S1MI 4A93I 3CCEZ 1VQK1 4E2WA 3CC71 4A3LI 4E2YA 1AA6A 3BG1B 3VB9A 3RZOI 4RV9A 2RT9A 1L1OC 1RO4A 4MRIA 4NB8A 4BXXI 1S721 1M901 1NUIA 1YI21 2W03A 3MONA 2Q4ZA 1M902 4DGLA 3HOXI 1KC81 2JA7I 2RBLA 1KC82 3HOZI 5AN9F 2JMOA 1Q16A 2AKLA 1QVFY 3CMEZ 2R7ZI 3S1NI 1VQOZ 3CMAZ 2P3YA 2JIRA 3T4NB 2JNYA 5IP7I 4A3EI 3J7A4 2IZ3A 5T6BA 1W2BZ 2E7ZA 3Q87A 1QF8A 4QTTA 3OW2Y 3CPWZ 2V8IA 2E9HA 1YHQZ 1K731 4E31A 3G711 1ZB8A 1VQ91 2RIQA 2AYDA 1Y1VI 1K732 4NBCA 1TWCI 1JWHC 2JA8I 1Z02A 4Y7NI 1Q7Y1 1VQM1 2IZ4A 2GTIA 1Q7Y2 2OZKA 3KIFA 1Z03A 3CCUZ 5FLMI 2M48A 3EERA 3CCMZ 2PMZA 3HOVI 1I6HI 2E2HI 3FKII 1VQPZ 4BY7I 2VPYA 4A3JI 3G4S1 1Q861 2OTJ1 2K3RA 4A3FI 4DQYB 1Q862 3H3VJ 3J81b 3CCS1 3GTOI 4A3II 5D1OB 3CC21 2QLVB 1QVFZ 3F3PC 2OTL1 1X3ZA 2JIMA 1ZH1A 3GTPI 2QKDA 2JIQA 1RLYA 3CCVZ 3EEDA 3GKQA 1YIT1 5C4JI 1VQKZ 2NVXI 1X3WA 3OW2Z 3D2LA 1FDOA 3CCQ1 2R92I 2KI7B 3MZLB 3S17I 1NP6A 4A3KI 2QREB 2BJOA 3D9XA 2JA6I 1YJWZ 1VQ4Z 5C4XI 3S16I 3IFUA 1VQNZ 1I3QI 1KQSY 4RVFA 4NB9A 4AYBA 3HOYI 1YJNZ 1RO2A 4A3CI 1ZB9A 2VPWA 1YIJ1 2LIYA 2QRDB 2V8JA 1VQ51 4NBBA 1LQLA 3NH8A 3CCJ1 4NBHA 3S14I 2GTHA 1KRLA 2VUGA 3CD61 1M1K1 2DE6A 1VQ6Z 2QA4Z 3FQMA 3CCRZ 1VLAA 2Y0SA 1M1K2 2DE5A 3G71Z 1VQ9Z 1TWGI 5C3EI 1Y1WI 5T64A 4X6AI 3I4NI 3MZKB 2I3CA 1Z01A 2KPIA 1VQMZ 1USPB 2PM9A 4TNUA 3CME1 1WW9A 2W04A 3I561 1TWFI 2V8KA 1VQO1 3CMA1 1Y8CA 2RPRA 1QVGY 5T67A 2DE7A 1ML8A 4RS4A 1NJI1 1VQ81 3NH5A 4RVGA 1N2FA 3NDIA 3G6E1 3G4SZ 1NJI2 4MONA 2B63I 2Q51A 2VPZA 3CQZI 2JR6A 4BBSI 3CC41 3PO2I 1KQSZ 2LFUA 2YU9I 3CC2Z 2V45A 3CCL1 2OTLZ 3PO3I 2G2KA 1Y1VS 4MD7A 3J80b 2H85A 4E32A 1VQ7Z 3NDJA 2F4OA 3I55Z 1YJ9Z 3CXCY 1YITZ 2QEX1 3ESWA 4RVDA 4NBFA 4MXUA 4E2XA 3CCM1 1K8A1 5FLXb 3VMHA 3S15I 1K8A2 3CCQZ 4S1TA 4HGYA 3JAMb 3GTJI 2NVTI 3CC7Z 3J81f 4E2ZA 3FQQA 3HKZA 3J80f 3GCFA 3M4OI 1S72Z 3PO3S 3VTNA 1YI2Z 2J6AA 4MH4A 2JIPA 2O4HA 2F4MA 4MD8A 5CM2M 1JJ2Y 5FLXf 1PFTA 2JIOA 1QVGZ 1I50I 5LL6f 1VQL1 2EGTA 4CL1A 4NBGA 5D1OA 2LEXA 3VMIA 4NFRA 1WJ2A 1RNIA 4EWCA 3TE5B 1WCMI 1VQ5Z 4NBDA 1N8R1 3CCJZ 3IX0A 4QTUA 3CCE1 3KIHA 1N8R2 1P9NA 3CD6Z 2JUBA 5A2Qb 4HH4A 2VPXA 3LUSA 1YJW1 4NH1C 1VQ41 4A3GI 2QR1B 3QWUA 3IR7A 1R9TI 5IP9I 4Y52I 1VQN1 3BG0B 1WIIA 3F3FC 2NAPA 2R6MA 1WZNA 3CXCZ 2HU9A 1YJN1 3I56Z 3S2HI 2VUMI 3M3YI 2IV2X 5D1PA 5A2Qf 4HGZA 2HF1A 4A3DI 1TFIA 1VQ8Z 2WB1A 1YUKA 1K9M1 3G6EZ 2M6NA 3I07A 4A3MI 3IF8A 1K9M2 1RO0A 2OOXB 3S1QI 2OOYB 4NBAA 3CC4Z 2WAQA 2QA41 2YADA 1VQ61 2E2II 2QRCB 3CCR1 2OTJZ 1JJ2Z 1FDIA 4NOZA 3GTGI 3CCLZ 1QYPA
chains in the Genus database with same CATH topology
3CCSZ 1YHQ1 1X0TA 2GU2A 2K5RA 2R93I 3GTKI 4A3BI 2E2JI 3P5JB 2QEXZ 3HOWI 4BBRI 1YUAA 3NH4A 1TWAI 5C44I 1USPA 3NFZA 3I4MI 3CCU1 5IT9b 3GTMI 3GTLI 2PK7A 1VQP1 3RZDI 1SFOI 3GTQI 1Q811 2NVYI 2P28A 3H0GI 1KD11 1W2BY 1DL6A 4XX2A 1Q812 4NBEA 3D6WA 2O53A 4E30A 1KD12 4MD9A 3S2DI 3CPWY 3U50C 1Q821 2RHBA 5IT9f 1VQLZ 2NVQI 3VMGA 1VQ71 1Q822 2VF1A 3I551 1YJ91 2ZAEB 3S1RI 3TDHB 4BY1I 1K83I 3CCV1 4RVHA 2JA5I 1YIJZ 4E33A 3K7AI 4DK1A 3JAMf 3GTMS 1RQFA 3HOUI 1TWHI 1S7MA 2JS4A 3S1MI 4A93I 3CCEZ 1VQK1 4E2WA 3CC71 4A3LI 4E2YA 3BG1B 3VB9A 3RZOI 4RV9A 2RT9A 1L1OC 1RO4A 4MRIA 4NB8A 4BXXI 1S721 1M901 1NUIA 1YI21 2W03A 3MONA 2Q4ZA 1M902 4DGLA 3HOXI 1KC81 2JA7I 2RBLA 1KC82 3HOZI 5AN9F 2JMOA 2AKLA 1QVFY 3CMEZ 2R7ZI 3S1NI 1VQOZ 3CMAZ 2P3YA 3T4NB 2JNYA 5IP7I 4A3EI 3J7A4 2IZ3A 5T6BA 1W2BZ 3Q87A 1QF8A 4QTTA 3OW2Y 3CPWZ 2V8IA 2E9HA 1YHQZ 1K731 4E31A 3G711 1ZB8A 1VQ91 2RIQA 1Y1VI 1K732 4NBCA 1TWCI 1JWHC 2JA8I 1Z02A 4Y7NI 1Q7Y1 1VQM1 2IZ4A 2GTIA 1Q7Y2 2OZKA 3KIFA 1Z03A 3CCUZ 5FLMI 2M48A 3EERA 3CCMZ 2PMZA 3HOVI 1I6HI 2E2HI 3FKII 1VQPZ 4BY7I 4A3JI 3G4S1 1Q861 2OTJ1 2K3RA 4A3FI 4DQYB 1Q862 3H3VJ 3J81b 3CCS1 3GTOI 4A3II 5D1OB 3CC21 2QLVB 1QVFZ 3F3PC 2OTL1 1X3ZA 1ZH1A 3GTPI 2QKDA 1RLYA 3CCVZ 3EEDA 3GKQA 1YIT1 5C4JI 1VQKZ 2NVXI 1X3WA 3OW2Z 3CCQ1 2R92I 2KI7B 3MZLB 3S17I 1NP6A 4A3KI 2QREB 2BJOA 3D9XA 2JA6I 1YJWZ 1VQ4Z 5C4XI 3S16I 3IFUA 1VQNZ 1I3QI 1KQSY 4RVFA 4NB9A 4AYBA 3HOYI 1YJNZ 1RO2A 4A3CI 1ZB9A 1YIJ1 2LIYA 2QRDB 2V8JA 1VQ51 4NBBA 1LQLA 3NH8A 3CCJ1 4NBHA 3S14I 2GTHA 1KRLA 2VUGA 3CD61 1M1K1 2DE6A 1VQ6Z 2QA4Z 3FQMA 3CCRZ 1VLAA 2Y0SA 1M1K2 2DE5A 3G71Z 1VQ9Z 1TWGI 5C3EI 1Y1WI 5T64A 4X6AI 3I4NI 3MZKB 2I3CA 1Z01A 2KPIA 1VQMZ 1USPB 2PM9A 4TNUA 3CME1 1WW9A 2W04A 3I561 1TWFI 2V8KA 1VQO1 3CMA1 2RPRA 1QVGY 5T67A 2DE7A 1ML8A 4RS4A 1NJI1 1VQ81 3NH5A 4RVGA 1N2FA 3NDIA 3G6E1 3G4SZ 1NJI2 4MONA 2B63I 2Q51A 3CQZI 2JR6A 4BBSI 3CC41 3PO2I 1KQSZ 2LFUA 2YU9I 3CC2Z 3CCL1 2OTLZ 3PO3I 2G2KA 1Y1VS 4MD7A 3J80b 2H85A 4E32A 1VQ7Z 3NDJA 2F4OA 3I55Z 1YJ9Z 3CXCY 1YITZ 2QEX1 3ESWA 4RVDA 4NBFA 4MXUA 4E2XA 3CCM1 1K8A1 5FLXb 3VMHA 3S15I 1K8A2 3CCQZ 4S1TA 4HGYA 3JAMb 3GTJI 2NVTI 3CC7Z 3J81f 4E2ZA 3FQQA 3HKZA 3J80f 3GCFA 3M4OI 1S72Z 3PO3S 3VTNA 1YI2Z 2J6AA 4MH4A 2O4HA 2F4MA 4MD8A 5CM2M 1JJ2Y 5FLXf 1PFTA 1QVGZ 1I50I 5LL6f 1VQL1 2EGTA 4CL1A 4NBGA 5D1OA 3VMIA 4NFRA 1RNIA 4EWCA 3TE5B 1WCMI 1VQ5Z 4NBDA 1N8R1 3CCJZ 3IX0A 4QTUA 3CCE1 3KIHA 1N8R2 1P9NA 3CD6Z 2JUBA 5A2Qb 4HH4A 3LUSA 1YJW1 4NH1C 1VQ41 4A3GI 2QR1B 3QWUA 1R9TI 5IP9I 4Y52I 1VQN1 3BG0B 1WIIA 3F3FC 2R6MA 3CXCZ 2HU9A 1YJN1 3I56Z 3S2HI 2VUMI 3M3YI 5D1PA 5A2Qf 4HGZA 2HF1A 4A3DI 1TFIA 1VQ8Z 2WB1A 1YUKA 1K9M1 3G6EZ 2M6NA 3I07A 4A3MI 3IF8A 1K9M2 1RO0A 2OOXB 3S1QI 2OOYB 4NBAA 3CC4Z 2WAQA 2QA41 2YADA 1VQ61 2E2II 2QRCB 3CCR1 2OTJZ 1JJ2Z 4NOZA 3GTGI 3CCLZ 1QYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Z;  1YHQ 1;  1VQN Z;  1K8A 2;  3CCQ Z;  1KQS Y;  1W2B Z;  3CC7 Z;  1YJN Z;  2QEX Z;  1YIJ 1;  3OW2 Y;  3CPW Z;  1S72 Z;  1YHQ Z;  1YI2 Z;  1K73 1;  3CCU 1;  1VQ5 1;  3G71 1;  1VQ9 1;  3CCJ 1;  1JJ2 Y;  1K73 2;  1VQP 1;  1QVG Z;  1Q7Y 1;  1VQL 1;  1Q81 1;  3CD6 1;  1VQM 1;  1M1K 1;  1KD1 1;  1VQ6 Z;  2QA4 Z;  1Q7Y 2;  1W2B Y;  3CCR Z;  1Q81 2;  1M1K 2;  3CCU Z;  1VQ5 Z;  3G71 Z;  1VQ9 Z;  1KD1 2;  1N8R 1;  3CCM Z;  3CCJ Z;  3CPW Y;  1Q82 1;  3CCE 1;  1VQP Z;  1N8R 2;  1VQL Z;  1VQ7 1;  1Q82 2;  3CD6 Z;  3G4S 1;  1VQM Z;  3I55 1;  1YJ9 1;  3CME 1;  1Q86 1;  2OTJ 1;  3I56 1;  1YJW 1;  3CCV 1;  1VQ4 1;  1Q86 2;  1YIJ Z;  1VQO 1;  3CMA 1;  3CCS 1;  1QVG Y;  1VQN 1;  1NJI 1;  3CCE Z;  1VQ8 1;  3CC2 1;  1VQK 1;  1QVF Z;  3CXC Z;  3CC7 1;  3G6E 1;  1YJN 1;  3G4S Z;  2OTL 1;  1NJI 2;  3I56 Z;  3CCV Z;  3CC4 1;  1S72 1;  1M90 1;  1KQS Z;  1YI2 1;  1YIT 1;  1VQ8 Z;  3CC2 Z;  1VQK Z;  1M90 2;  1K9M 1;  3G6E Z;  3CCL 1;  3OW2 Z;  2OTL Z;  1KC8 1;  1K9M 2;  3CCQ 1;  1KC8 2;  1VQ7 Z;  3CC4 Z;  1VQ6 1;  2QA4 1;  1QVF Y;  3I55 Z;  3CME Z;  3CCR 1;  3CXC Y;  1YIT Z;  1YJ9 Z;  2OTJ Z;  2QEX 1;  1JJ2 Z;  1YJW Z;  1VQ4 Z;  3CCM 1;  1K8A 1;  3CCL Z;  1VQO Z;  3CMA Z; 
#chains in the Genus database with same CATH topology
 3CCS Z;  1YHQ 1;  1X0T A;  2GU2 A;  2K5R A;  2R93 I;  3GTK I;  4A3B I;  2E2J I;  3P5J B;  2QEX Z;  1SIW A;  3HOW I;  4BBR I;  1YUA A;  3NH4 A;  1TWA I;  5C44 I;  1USP A;  3NFZ A;  3I4M I;  3CCU 1;  5IT9 b;  3GTM I;  1QXF A;  3GTL I;  2PK7 A;  1VQP 1;  3RZD I;  1SFO I;  2V3V A;  3GTQ I;  1Q81 1;  2NVY I;  2P28 A;  3H0G I;  1KD1 1;  1W2B Y;  1DL6 A;  4XX2 A;  1Q81 2;  4NBE A;  3D6W A;  2O53 A;  4E30 A;  1KD1 2;  4MD9 A;  3S2D I;  3CPW Y;  3U50 C;  1Q82 1;  2RHB A;  5IT9 f;  1VQL Z;  2NVQ I;  3VMG A;  1VQ7 1;  1Q82 2;  2VF1 A;  3I55 1;  1YJ9 1;  2ZAE B;  3TDH B;  3S1R I;  4BY1 I;  1K83 I;  3CCV 1;  4RVH A;  2JA5 I;  1YIJ Z;  4E33 A;  3K7A I;  4DK1 A;  3JAM f;  3GTM S;  1RQF A;  3HOU I;  1TWH I;  1S7M A;  2JS4 A;  3S1M I;  4A93 I;  3CCE Z;  1VQK 1;  4E2W A;  3CC7 1;  4A3L I;  4E2Y A;  1AA6 A;  3BG1 B;  3VB9 A;  3RZO I;  4RV9 A;  2RT9 A;  1L1O C;  1RO4 A;  4MRI A;  4NB8 A;  4BXX I;  1S72 1;  1M90 1;  1NUI A;  1YI2 1;  2W03 A;  3MON A;  2Q4Z A;  1M90 2;  4DGL A;  3HOX I;  1KC8 1;  2JA7 I;  2RBL A;  1KC8 2;  3HOZ I;  5AN9 F;  2JMO A;  1Q16 A;  2AKL A;  1QVF Y;  3CME Z;  2R7Z I;  3S1N I;  1VQO Z;  3CMA Z;  2P3Y A;  2JIR A;  3T4N B;  2JNY A;  5IP7 I;  4A3E I;  3J7A 4;  2IZ3 A;  5T6B A;  1W2B Z;  2E7Z A;  3Q87 A;  1QF8 A;  4QTT A;  3OW2 Y;  3CPW Z;  2V8I A;  2E9H A;  1YHQ Z;  1K73 1;  4E31 A;  3G71 1;  1ZB8 A;  1VQ9 1;  2RIQ A;  2AYD A;  1Y1V I;  1K73 2;  4NBC A;  1TWC I;  1JWH C;  2JA8 I;  1Z02 A;  4Y7N I;  1Q7Y 1;  1VQM 1;  2IZ4 A;  2GTI A;  1Q7Y 2;  2OZK A;  3KIF A;  1Z03 A;  3CCU Z;  5FLM I;  2M48 A;  3EER A;  3CCM Z;  2PMZ A;  3HOV I;  1I6H I;  2E2H I;  3FKI I;  1VQP Z;  4BY7 I;  2VPY A;  4A3J I;  3G4S 1;  1Q86 1;  2OTJ 1;  2K3R A;  4A3F I;  4DQY B;  1Q86 2;  3H3V J;  3J81 b;  3CCS 1;  3GTO I;  4A3I I;  5D1O B;  3CC2 1;  2QLV B;  1QVF Z;  3F3P C;  2OTL 1;  1X3Z A;  2JIM A;  1ZH1 A;  3GTP I;  2QKD A;  2JIQ A;  1RLY A;  3CCV Z;  3EED A;  3GKQ A;  1YIT 1;  5C4J I;  1VQK Z;  2NVX I;  1X3W A;  3OW2 Z;  3D2L A;  1FDO A;  3CCQ 1;  2R92 I;  2KI7 B;  3MZL B;  3S17 I;  1NP6 A;  4A3K I;  2QRE B;  2BJO A;  3D9X A;  2JA6 I;  1YJW Z;  1VQ4 Z;  5C4X I;  3S16 I;  3IFU A;  1VQN Z;  1I3Q I;  1KQS Y;  4RVF A;  4NB9 A;  4AYB A;  3HOY I;  1YJN Z;  1RO2 A;  4A3C I;  1ZB9 A;  2VPW A;  1YIJ 1;  2LIY A;  2QRD B;  2V8J A;  1VQ5 1;  4NBB A;  1LQL A;  3NH8 A;  3CCJ 1;  4NBH A;  3S14 I;  2GTH A;  1KRL A;  2VUG A;  3CD6 1;  1M1K 1;  2DE6 A;  1VQ6 Z;  2QA4 Z;  3FQM A;  3CCR Z;  1VLA A;  2Y0S A;  1M1K 2;  2DE5 A;  3G71 Z;  1VQ9 Z;  1TWG I;  5C3E I;  1Y1W I;  5T64 A;  4X6A I;  3I4N I;  3MZK B;  2I3C A;  1Z01 A;  2KPI A;  1VQM Z;  1USP B;  2PM9 A;  4TNU A;  3CME 1;  1WW9 A;  2W04 A;  3I56 1;  1TWF I;  2V8K A;  1VQO 1;  3CMA 1;  1Y8C A;  2RPR A;  1QVG Y;  5T67 A;  2DE7 A;  1ML8 A;  4RS4 A;  1NJI 1;  1VQ8 1;  3NH5 A;  4RVG A;  1N2F A;  3NDI A;  3G6E 1;  3G4S Z;  1NJI 2;  4MON A;  2B63 I;  2Q51 A;  2VPZ A;  3CQZ I;  2JR6 A;  4BBS I;  3CC4 1;  3PO2 I;  1KQS Z;  2LFU A;  2YU9 I;  3CC2 Z;  2V45 A;  3CCL 1;  2OTL Z;  3PO3 I;  2G2K A;  1Y1V S;  4MD7 A;  3J80 b;  2H85 A;  4E32 A;  1VQ7 Z;  3NDJ A;  2F4O A;  3I55 Z;  1YJ9 Z;  3CXC Y;  1YIT Z;  2QEX 1;  3ESW A;  4RVD A;  4NBF A;  4MXU A;  4E2X A;  3CCM 1;  1K8A 1;  5FLX b;  3VMH A;  3S15 I;  1K8A 2;  3CCQ Z;  4S1T A;  4HGY A;  3JAM b;  3GTJ I;  2NVT I;  3CC7 Z;  3J81 f;  4E2Z A;  3FQQ A;  3HKZ A;  3J80 f;  3GCF A;  3M4O I;  1S72 Z;  3PO3 S;  3VTN A;  1YI2 Z;  2J6A A;  4MH4 A;  2JIP A;  2O4H A;  2F4M A;  4MD8 A;  5CM2 M;  1JJ2 Y;  5FLX f;  1PFT A;  2JIO A;  1QVG Z;  1I50 I;  5LL6 f;  1VQL 1;  2EGT A;  4CL1 A;  4NBG A;  5D1O A;  2LEX A;  3VMI A;  4NFR A;  1WJ2 A;  1RNI A;  4EWC A;  3TE5 B;  1WCM I;  1VQ5 Z;  4NBD A;  1N8R 1;  3CCJ Z;  3IX0 A;  4QTU A;  3CCE 1;  3KIH A;  1N8R 2;  1P9N A;  3CD6 Z;  2JUB A;  5A2Q b;  4HH4 A;  2VPX A;  3LUS A;  1YJW 1;  4NH1 C;  1VQ4 1;  4A3G I;  2QR1 B;  3QWU A;  3IR7 A;  1R9T I;  5IP9 I;  4Y52 I;  1VQN 1;  3BG0 B;  1WII A;  3F3F C;  2NAP A;  2R6M A;  1WZN A;  3CXC Z;  2HU9 A;  1YJN 1;  3I56 Z;  3S2H I;  2VUM I;  3M3Y I;  2IV2 X;  5D1P A;  5A2Q f;  4HGZ A;  2HF1 A;  4A3D I;  1TFI A;  1VQ8 Z;  2WB1 A;  1YUK A;  1K9M 1;  3G6E Z;  2M6N A;  3I07 A;  4A3M I;  3IF8 A;  1K9M 2;  1RO0 A;  2OOX B;  3S1Q I;  2OOY B;  4NBA A;  3CC4 Z;  2WAQ A;  2QA4 1;  2YAD A;  1VQ6 1;  2E2I I;  2QRC B;  3CCR 1;  2OTJ Z;  1JJ2 Z;  1FDI A;  4NOZ A;  3GTG I;  3CCL Z;  1QYP A; 
#chains in the Genus database with same CATH homology
 3CCS Z;  1YHQ 1;  1X0T A;  2GU2 A;  2K5R A;  2R93 I;  3GTK I;  4A3B I;  2E2J I;  3P5J B;  2QEX Z;  3HOW I;  4BBR I;  1YUA A;  3NH4 A;  1TWA I;  5C44 I;  1USP A;  3NFZ A;  3I4M I;  3CCU 1;  5IT9 b;  3GTM I;  3GTL I;  2PK7 A;  1VQP 1;  3RZD I;  1SFO I;  3GTQ I;  1Q81 1;  2NVY I;  2P28 A;  3H0G I;  1KD1 1;  1W2B Y;  1DL6 A;  4XX2 A;  1Q81 2;  4NBE A;  3D6W A;  2O53 A;  4E30 A;  1KD1 2;  4MD9 A;  3S2D I;  3CPW Y;  3U50 C;  1Q82 1;  2RHB A;  5IT9 f;  1VQL Z;  2NVQ I;  3VMG A;  1VQ7 1;  1Q82 2;  2VF1 A;  3I55 1;  1YJ9 1;  2ZAE B;  3S1R I;  3TDH B;  4BY1 I;  1K83 I;  3CCV 1;  4RVH A;  2JA5 I;  1YIJ Z;  4E33 A;  3K7A I;  4DK1 A;  3JAM f;  3GTM S;  1RQF A;  3HOU I;  1TWH I;  1S7M A;  2JS4 A;  3S1M I;  4A93 I;  3CCE Z;  1VQK 1;  4E2W A;  3CC7 1;  4A3L I;  4E2Y A;  3BG1 B;  3VB9 A;  3RZO I;  4RV9 A;  2RT9 A;  1L1O C;  1RO4 A;  4MRI A;  4NB8 A;  4BXX I;  1S72 1;  1M90 1;  1NUI A;  1YI2 1;  2W03 A;  3MON A;  2Q4Z A;  1M90 2;  4DGL A;  3HOX I;  1KC8 1;  2JA7 I;  2RBL A;  1KC8 2;  3HOZ I;  5AN9 F;  2JMO A;  2AKL A;  1QVF Y;  3CME Z;  2R7Z I;  3S1N I;  1VQO Z;  3CMA Z;  2P3Y A;  3T4N B;  2JNY A;  5IP7 I;  4A3E I;  3J7A 4;  2IZ3 A;  5T6B A;  1W2B Z;  3Q87 A;  1QF8 A;  4QTT A;  3OW2 Y;  3CPW Z;  2V8I A;  2E9H A;  1YHQ Z;  1K73 1;  4E31 A;  3G71 1;  1ZB8 A;  1VQ9 1;  2RIQ A;  1Y1V I;  1K73 2;  4NBC A;  1TWC I;  1JWH C;  2JA8 I;  1Z02 A;  4Y7N I;  1Q7Y 1;  1VQM 1;  2IZ4 A;  2GTI A;  1Q7Y 2;  2OZK A;  3KIF A;  1Z03 A;  3CCU Z;  5FLM I;  2M48 A;  3EER A;  3CCM Z;  2PMZ A;  3HOV I;  1I6H I;  2E2H I;  3FKI I;  1VQP Z;  4BY7 I;  4A3J I;  3G4S 1;  1Q86 1;  2OTJ 1;  2K3R A;  4A3F I;  4DQY B;  1Q86 2;  3H3V J;  3J81 b;  3CCS 1;  3GTO I;  4A3I I;  5D1O B;  3CC2 1;  2QLV B;  1QVF Z;  3F3P C;  2OTL 1;  1X3Z A;  1ZH1 A;  3GTP I;  2QKD A;  1RLY A;  3CCV Z;  3EED A;  3GKQ A;  1YIT 1;  5C4J I;  1VQK Z;  2NVX I;  1X3W A;  3OW2 Z;  3CCQ 1;  2R92 I;  2KI7 B;  3MZL B;  3S17 I;  1NP6 A;  4A3K I;  2QRE B;  2BJO A;  3D9X A;  2JA6 I;  1YJW Z;  1VQ4 Z;  5C4X I;  3S16 I;  3IFU A;  1VQN Z;  1I3Q I;  1KQS Y;  4RVF A;  4NB9 A;  4AYB A;  3HOY I;  1YJN Z;  1RO2 A;  4A3C I;  1ZB9 A;  1YIJ 1;  2LIY A;  2QRD B;  2V8J A;  1VQ5 1;  4NBB A;  1LQL A;  3NH8 A;  3CCJ 1;  4NBH A;  3S14 I;  2GTH A;  1KRL A;  2VUG A;  3CD6 1;  1M1K 1;  2DE6 A;  1VQ6 Z;  2QA4 Z;  3FQM A;  3CCR Z;  1VLA A;  2Y0S A;  1M1K 2;  2DE5 A;  3G71 Z;  1VQ9 Z;  1TWG I;  5C3E I;  1Y1W I;  5T64 A;  4X6A I;  3I4N I;  3MZK B;  2I3C A;  1Z01 A;  2KPI A;  1VQM Z;  1USP B;  2PM9 A;  4TNU A;  3CME 1;  1WW9 A;  2W04 A;  3I56 1;  1TWF I;  2V8K A;  1VQO 1;  3CMA 1;  2RPR A;  1QVG Y;  5T67 A;  2DE7 A;  1ML8 A;  4RS4 A;  1NJI 1;  1VQ8 1;  3NH5 A;  4RVG A;  1N2F A;  3NDI A;  3G6E 1;  3G4S Z;  1NJI 2;  4MON A;  2B63 I;  2Q51 A;  3CQZ I;  2JR6 A;  4BBS I;  3CC4 1;  3PO2 I;  1KQS Z;  2LFU A;  2YU9 I;  3CC2 Z;  3CCL 1;  2OTL Z;  3PO3 I;  2G2K A;  1Y1V S;  4MD7 A;  3J80 b;  2H85 A;  4E32 A;  1VQ7 Z;  3NDJ A;  2F4O A;  3I55 Z;  1YJ9 Z;  3CXC Y;  1YIT Z;  2QEX 1;  3ESW A;  4RVD A;  4NBF A;  4MXU A;  4E2X A;  3CCM 1;  1K8A 1;  5FLX b;  3VMH A;  3S15 I;  1K8A 2;  3CCQ Z;  4S1T A;  4HGY A;  3JAM b;  3GTJ I;  2NVT I;  3CC7 Z;  3J81 f;  4E2Z A;  3FQQ A;  3HKZ A;  3J80 f;  3GCF A;  3M4O I;  1S72 Z;  3PO3 S;  3VTN A;  1YI2 Z;  2J6A A;  4MH4 A;  2O4H A;  2F4M A;  4MD8 A;  5CM2 M;  1JJ2 Y;  5FLX f;  1PFT A;  1QVG Z;  1I50 I;  5LL6 f;  1VQL 1;  2EGT A;  4CL1 A;  4NBG A;  5D1O A;  3VMI A;  4NFR A;  1RNI A;  4EWC A;  3TE5 B;  1WCM I;  1VQ5 Z;  4NBD A;  1N8R 1;  3CCJ Z;  3IX0 A;  4QTU A;  3CCE 1;  3KIH A;  1N8R 2;  1P9N A;  3CD6 Z;  2JUB A;  5A2Q b;  4HH4 A;  3LUS A;  1YJW 1;  4NH1 C;  1VQ4 1;  4A3G I;  2QR1 B;  3QWU A;  1R9T I;  5IP9 I;  4Y52 I;  1VQN 1;  3BG0 B;  1WII A;  3F3F C;  2R6M A;  3CXC Z;  2HU9 A;  1YJN 1;  3I56 Z;  3S2H I;  2VUM I;  3M3Y I;  5D1P A;  5A2Q f;  4HGZ A;  2HF1 A;  4A3D I;  1TFI A;  1VQ8 Z;  2WB1 A;  1YUK A;  1K9M 1;  3G6E Z;  2M6N A;  3I07 A;  4A3M I;  3IF8 A;  1K9M 2;  1RO0 A;  2OOX B;  3S1Q I;  2OOY B;  4NBA A;  3CC4 Z;  2WAQ A;  2QA4 1;  2YAD A;  1VQ6 1;  2E2I I;  2QRC B;  3CCR 1;  2OTJ Z;  1JJ2 Z;  4NOZ A;  3GTG I;  3CCL Z;  1QYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...