2R92I

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 7
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r92I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r92I02
4NBGA 4NBDA 5IP9I 1YUAA 3H0GI 1Y1WI 1ML8A 4QTTA 4QTUA 3HOYI 3EERA 4A3II 3GTKI 4NB8A 1TWAI 2JA6I 4NBCA 2JR6A 4XX2A 2JA5I 4A3CI 4BY7I 4A3LI 2R92I 5CM2M 3S16I 1N2FA 1RO4A 1TWGI 2JS4A 1TFIA 3GTLI 3HOUI 3S1MI 2JNYA 1Y1VI 2NVTI 1USPB 1NUIA 4A3MI 1TWFI 4BBRI 3Q87A 2DE6A 4A3GI 3GKQA 4NOZA 3GTGI 4NBHA 1ZB9A 1USPA 3K7AI 4NBFA 4A3FI 2DE5A 4NBBA 3CQZI 3GTOI 2J6AA 5IP7I 3VMHA 1ZB8A 1RLYA 2PK7A 2E2HI 1I3QI 3VB9A 3GTJI 4Y52I 3VMGA 1I50I 3HOVI 2AKLA 2F4MA 2NVXI 3S14I 3PO3S 3I4NI 1K83I 1DL6A 4A3BI 1SFOI 3M4OI 3GTQI 4NBAA 2K5RA 3LUSA 3GTPI 3PO2I 5FLMI 1QYPA 3S17I 3H3VJ 2R93I 4BBSI 2DE7A 2E2II 3GTMS 1WCMI 1TWCI 5C3EI 3S1NI 3I07A 4NB9A 2BJOA 2B63I 2F4OA 2NVYI 4A3DI 2RBLA 3GCFA 3PO3I 4A93I 1X3WA 1X3ZA 5C4XI 1R9TI 3VMIA 3S1QI 1PFTA 2E2JI 3M3YI 1LQLA 5C4JI 2HF1A 1L1OC 2NVQI 4X6AI 2P3YA 3S1RI 1I6HI 2KPIA 3I4MI 2JA8I 3ESWA 4BY1I 3GTMI 4A3JI 3S2HI 4MH4A 4NBEA 3U50C 3RZDI 1TWHI 4A3EI 2YU9I 3S2DI 4BXXI 4Y7NI 5C44I 1WW9A 3FKII 2VUMI 4A3KI 3HOWI 3HOZI 1VLAA 3RZOI 3D6WA 2JA7I 3S15I 1Y1VS 3HOXI 2R7ZI
chains in the Genus database with same CATH superfamily
4NBGA 1VQN1 4QTTA 2RHBA 2HU9A 2QRDB 3HOYI 4NB8A 1TWAI 3CCQZ 3J80b 4BY7I 2R92I 3S16I 5T67A 1K9M1 3T4NB 2ZAEB 3GTLI 3S1MI 3CCR1 3CCL1 1WIIA 3CD61 3Q87A 2Q4ZA 2P28A 1Z02A 1Q16A 3GTGI 4NBHA 1ZB9A 3K7AI 2DE5A 3CQZI 3GTOI 1YI2Z 1N8R2 1YJ91 3FQQA 3KIFA 1Z01A 2E2HI 1I3QI 2IZ3A 5FLXf 4Y52I 1YIT1 2VUGA 3HOVI 4RVGA 2GTHA 3PO3S 1DL6A 1S72Z 3G6EZ 3VTNA 2GTIA 1Q862 4NBAA 5D1OA 2VPYA 2OTLZ 2QRCB 4E2ZA 1VQ4Z 3H3VJ 2LIYA 4BBSI 3GTMS 2G2KA 1TWCI 5C3EI 4NB9A 2OOXB 2RBLA 3PO3I 1R9TI 3S1QI 1PFTA 1M902 3M3YI 4DQYB 1VQO1 3CMEZ 1VQ6Z 3BG1B 2JMOA 3ESWA 2E9HA 3GTMI 4A3JI 1M1K2 1VQM1 2JIOA 1RQFA 3J81f 3TDHB 2JIRA 1YIJ1 2OTJZ 3CC41 1VQ91 4NFRA 1TWHI 1YJNZ 4RV9A 4BXXI 1P9NA 2V8JA 4Y7NI 1VQ81 3FKII 1NJI2 1KC82 3CCUZ 1YUKA 3CCV1 5T6BA 3CCMZ 3HOZI 1VLAA 2QA41 1VQ51 3S15I 2QEX1 2R6MA 3HKZA 1YUAA 3G4S1 3D2LA 3H0GI 1ML8A 1VQP1 3GTKI 1Z03A 1YHQZ 4A3CI 2VPXA 4AYBA 3I561 1RO4A 3HOUI 1USPB 3EEDA 3CC71 1NP6A 1RO2A 4BBRI 3CMA1 3GKQA 3BG0B 2PMZA 3IFUA 1SIWA 1QF8A 2JIMA 4E31A 1FDOA 5IP7I 2PK7A 1YJWZ 2O4HA 3J80f 2VF1A 3MZLB 5T64A 2F4MA 2NVXI 2WAQA 1VQKZ 1VQLZ 4A3BI 3M4OI 3NDJA 1M1K1 3CCS1 2K5RA 3CCJZ 1Q812 3P5JB 1QYPA 3S17I 2DE7A 3S1NI 1QVGY 2GU2A 3CCE1 1QVGZ 1KRLA 3GCFA 2V3VA 3G71Z 1K732 3VMIA 3JAMb 1FDIA 4HGZA 3I55Z 2RT9A 2NVQI 1VQNZ 1I6HI 4BY1I 4MD7A 4MD9A 1N8R1 2KI7B 1VQ71 2QKDA 3RZDI 1RNIA 3TE5B 3S2DI 2VPWA 3CCRZ 3CCLZ 1ZH1A 4MD8A 3CD6Z 3NDIA 1K8A1 5LL6f 1Y8CA 3CC21 1Q861 3HOWI 3RZOI 2AYDA 1Y1VS 2R7ZI 4NBDA 5IP9I 2W03A 3CPWY 3MONA 1YJ9Z 2I3CA 3CPWZ 1RO0A 4A3II 1YITZ 2JA6I 4A3LI 2M6NA 2RPRA 4NH1C 1M901 1N2FA 1QXFA 1TWGI 2JS4A 1TFIA 2E7ZA 1WJ2A 1Y1VI 1NUIA 1TWFI 1KD12 2DE6A 4DGLA 1Q7Y2 2M48A 2LEXA 4NBBA 2QR1B 3F3FC 2J6AA 4RVHA 1ZB8A 1RLYA 2JIQA 1VQOZ 5D1OB 3VMGA 3CCQ1 1KC81 2AKLA 2Q51A 2OOYB 3I4NI 1K83I 1Q822 1VQMZ 1WZNA 1YIJZ 1VQ9Z 3CC4Z 3PO2I 5FLMI 1S7MA 4HGYA 2E2II 2BJOA 2F4OA 2NVYI 4A3DI 1VQ8Z 2V8IA 3CCVZ 5IT9b 1YI21 2RIQA 5C4XI 3NH8A 5IT9f 1K9M2 2E2JI 1LQLA 5C4JI 2QA4Z 1VQ5Z 4RS4A 2HF1A 4E32A 2PM9A 2QEXZ 2KPIA 2JA8I 3G4SZ 3IX0A 3IR7A 3F3PC 1S721 1JWHC 3G6E1 1VQPZ 4RVDA 2OTL1 2O53A 3I56Z 2Y0SA 1VQ41 4NBEA 4A3EI 3CC7Z 5C44I 1W2BY 3NH5A 3CMAZ 1W2BZ 2OZKA 3JAMf 2VUMI 3D6WA 4E2WA 2JA7I 3CME1 2V45A 1VQ61 3S1RI 1Q811 3OW2Y 3QWUA 3OW2Z 5A2Qb 2EGTA 1Y1WI 4TNUA 5A2Qf 4QTUA 3EERA 4NBCA 5FLXb 2JR6A 2OTJ1 4XX2A 2JA5I 5D1PA 1K731 5CM2M 4HH4A 3NFZA 3FQMA 4E2XA 2JNYA 2NVTI 1KQSY 3CCSZ 1K8A2 4A3MI 1YJN1 1KQSZ 2JIPA 3CCU1 4A3GI 4NOZA 3CCM1 3CCEZ 4EWCA 1USPA 4A3FI 4NBFA 3MZKB 3J7A4 2JUBA 1AA6A 3VMHA 1JJ2Y 3VB9A 3GTJI 1JJ2Z 4E30A 1I50I 4RVFA 1YHQ1 3S14I 2K3RA 2QLVB 1SFOI 2IZ4A 3GTQI 2IV2X 2NAPA 1QVFY 3J81b 2H85A 1QVFZ 1X0TA 3LUSA 3GTPI 2YADA 1VQ7Z 2R93I 2QREB 1WCMI 3I07A 2B63I 2V8KA 2LFUA 4A93I 4E2YA 4MRIA 3KIHA 1X3WA 1X3ZA 3CC2Z 1YJW1 1NJI1 1KD11 1L1OC 4X6AI 2VPZA 2P3YA 4MXUA 3I4MI 4S1TA 1VQK1 4CL1A 3IF8A 1VQL1 1Q7Y1 4MONA 3CXCY 3S2HI 3CCJ1 3NH4A 3CXCZ 4MH4A 3U50C 2W04A 3D9XA 2YU9I 1WW9A 5AN9F 2WB1A 1Q821 4DK1A 3G711 4A3KI 3I551 3HOXI 4E33A
chains in the Genus database with same CATH topology
4NBGA 1VQN1 4QTTA 2RHBA 2HU9A 2QRDB 3HOYI 4NB8A 1TWAI 3CCQZ 3J80b 4BY7I 2R92I 3S16I 5T67A 1K9M1 3T4NB 2ZAEB 3GTLI 3S1MI 3CCR1 3CCL1 1WIIA 3CD61 3Q87A 2Q4ZA 2P28A 1Z02A 3GTGI 4NBHA 1ZB9A 3K7AI 2DE5A 3CQZI 3GTOI 1YI2Z 1N8R2 1YJ91 3FQQA 3KIFA 1Z01A 2E2HI 1I3QI 2IZ3A 5FLXf 4Y52I 1YIT1 2VUGA 3HOVI 4RVGA 2GTHA 3PO3S 1DL6A 1S72Z 3G6EZ 3VTNA 2GTIA 1Q862 4NBAA 5D1OA 2OTLZ 2QRCB 4E2ZA 1VQ4Z 3H3VJ 2LIYA 4BBSI 3GTMS 2G2KA 1TWCI 5C3EI 4NB9A 2OOXB 2RBLA 3PO3I 1R9TI 3S1QI 1PFTA 1M902 3M3YI 4DQYB 1VQO1 3CMEZ 1VQ6Z 3BG1B 2JMOA 3ESWA 2E9HA 3GTMI 4A3JI 1M1K2 1VQM1 1RQFA 3J81f 3TDHB 1YIJ1 2OTJZ 3CC41 1VQ91 4NFRA 1TWHI 1YJNZ 4RV9A 4BXXI 1P9NA 2V8JA 4Y7NI 1VQ81 3FKII 1NJI2 1KC82 3CCUZ 1YUKA 3CCV1 5T6BA 3CCMZ 3HOZI 1VLAA 2QA41 1VQ51 3S15I 2QEX1 2R6MA 3HKZA 1YUAA 3G4S1 3H0GI 1ML8A 1VQP1 3GTKI 1Z03A 1YHQZ 4A3CI 4AYBA 3I561 1RO4A 3HOUI 1USPB 3EEDA 3CC71 1NP6A 1RO2A 4BBRI 3CMA1 3GKQA 3BG0B 2PMZA 3IFUA 1QF8A 4E31A 5IP7I 2PK7A 1YJWZ 2O4HA 3J80f 2VF1A 3MZLB 5T64A 2F4MA 2NVXI 2WAQA 1VQKZ 1VQLZ 4A3BI 3M4OI 3NDJA 1M1K1 3CCS1 2K5RA 3CCJZ 1Q812 3P5JB 1QYPA 3S17I 2DE7A 3S1NI 1QVGY 2GU2A 3CCE1 1QVGZ 1KRLA 3GCFA 3G71Z 1K732 3VMIA 3JAMb 4HGZA 3I55Z 2RT9A 2NVQI 1VQNZ 1I6HI 4BY1I 4MD7A 4MD9A 1N8R1 2KI7B 1VQ71 2QKDA 3RZDI 1RNIA 3TE5B 3S2DI 3CCRZ 3CCLZ 1ZH1A 4MD8A 3CD6Z 3NDIA 1K8A1 5LL6f 3CC21 1Q861 3HOWI 3RZOI 1Y1VS 2R7ZI 4NBDA 5IP9I 2W03A 3CPWY 3MONA 1YJ9Z 2I3CA 3CPWZ 1RO0A 4A3II 1YITZ 2JA6I 4A3LI 2M6NA 2RPRA 4NH1C 1M901 1N2FA 1TWGI 2JS4A 1TFIA 1Y1VI 1NUIA 1TWFI 1KD12 2DE6A 4DGLA 1Q7Y2 2M48A 4NBBA 2QR1B 3F3FC 2J6AA 4RVHA 1ZB8A 1RLYA 1VQOZ 5D1OB 3VMGA 3CCQ1 1KC81 2AKLA 2Q51A 2OOYB 3I4NI 1K83I 1Q822 1VQMZ 1YIJZ 1VQ9Z 3CC4Z 3PO2I 5FLMI 1S7MA 4HGYA 2E2II 2BJOA 2F4OA 2NVYI 4A3DI 1VQ8Z 2V8IA 3CCVZ 5IT9b 1YI21 2RIQA 5C4XI 3NH8A 5IT9f 1K9M2 2E2JI 1LQLA 5C4JI 2QA4Z 1VQ5Z 4RS4A 2HF1A 4E32A 2PM9A 2QEXZ 2KPIA 2JA8I 3G4SZ 3IX0A 3F3PC 1S721 1JWHC 3G6E1 1VQPZ 4RVDA 2OTL1 2O53A 3I56Z 2Y0SA 1VQ41 4NBEA 4A3EI 3CC7Z 5C44I 1W2BY 3NH5A 3CMAZ 1W2BZ 2OZKA 3JAMf 2VUMI 3D6WA 4E2WA 2JA7I 3CME1 1VQ61 3S1RI 1Q811 3OW2Y 3QWUA 3OW2Z 5A2Qb 2EGTA 1Y1WI 4TNUA 5A2Qf 4QTUA 3EERA 4NBCA 5FLXb 2JR6A 2OTJ1 4XX2A 2JA5I 5D1PA 1K731 5CM2M 4HH4A 3NFZA 3FQMA 4E2XA 2JNYA 2NVTI 1KQSY 3CCSZ 1K8A2 4A3MI 1YJN1 1KQSZ 3CCU1 4A3GI 4NOZA 3CCM1 3CCEZ 4EWCA 1USPA 4A3FI 4NBFA 3MZKB 3J7A4 2JUBA 3VMHA 1JJ2Y 3VB9A 3GTJI 1JJ2Z 4E30A 1I50I 4RVFA 1YHQ1 3S14I 2K3RA 2QLVB 1SFOI 2IZ4A 3GTQI 1QVFY 3J81b 2H85A 1QVFZ 1X0TA 3LUSA 3GTPI 2YADA 1VQ7Z 2R93I 2QREB 1WCMI 3I07A 2B63I 2V8KA 2LFUA 4A93I 4E2YA 4MRIA 3KIHA 1X3WA 1X3ZA 3CC2Z 1YJW1 1NJI1 1KD11 1L1OC 4X6AI 2P3YA 4MXUA 3I4MI 4S1TA 1VQK1 4CL1A 3IF8A 1VQL1 1Q7Y1 4MONA 3CXCY 3S2HI 3CCJ1 3NH4A 3CXCZ 4MH4A 3U50C 2W04A 3D9XA 2YU9I 1WW9A 5AN9F 2WB1A 1Q821 4DK1A 3G711 4A3KI 3I551 3HOXI 4E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBG A;  4NBD A;  5IP9 I;  1YUA A;  3H0G I;  1Y1W I;  1ML8 A;  4QTT A;  4QTU A;  3HOY I;  3EER A;  4A3I I;  3GTK I;  4NB8 A;  1TWA I;  2JA6 I;  4NBC A;  2JR6 A;  4XX2 A;  2JA5 I;  4A3C I;  4BY7 I;  4A3L I;  2R92 I;  5CM2 M;  3S16 I;  1N2F A;  1RO4 A;  1TWG I;  2JS4 A;  1TFI A;  3GTL I;  3HOU I;  3S1M I;  2JNY A;  1Y1V I;  2NVT I;  1USP B;  1NUI A;  4A3M I;  1TWF I;  4BBR I;  3Q87 A;  2DE6 A;  4A3G I;  3GKQ A;  4NOZ A;  3GTG I;  4NBH A;  1ZB9 A;  1USP A;  3K7A I;  4NBF A;  4A3F I;  2DE5 A;  4NBB A;  3CQZ I;  3GTO I;  2J6A A;  5IP7 I;  3VMH A;  1ZB8 A;  1RLY A;  2PK7 A;  2E2H I;  1I3Q I;  3VB9 A;  3GTJ I;  4Y52 I;  3VMG A;  1I50 I;  3HOV I;  2AKL A;  2F4M A;  2NVX I;  3S14 I;  3PO3 S;  3I4N I;  1K83 I;  1DL6 A;  4A3B I;  1SFO I;  3M4O I;  3GTQ I;  4NBA A;  2K5R A;  3LUS A;  3GTP I;  3PO2 I;  5FLM I;  1QYP A;  3S17 I;  3H3V J;  2R93 I;  4BBS I;  2DE7 A;  2E2I I;  3GTM S;  1WCM I;  1TWC I;  5C3E I;  3S1N I;  3I07 A;  4NB9 A;  2BJO A;  2B63 I;  2F4O A;  2NVY I;  4A3D I;  2RBL A;  3GCF A;  3PO3 I;  4A93 I;  1X3W A;  1X3Z A;  5C4X I;  1R9T I;  3VMI A;  3S1Q I;  1PFT A;  2E2J I;  3M3Y I;  1LQL A;  5C4J I;  2HF1 A;  1L1O C;  2NVQ I;  4X6A I;  2P3Y A;  3S1R I;  1I6H I;  2KPI A;  3I4M I;  2JA8 I;  3ESW A;  4BY1 I;  3GTM I;  4A3J I;  3S2H I;  4MH4 A;  4NBE A;  3U50 C;  3RZD I;  1TWH I;  4A3E I;  2YU9 I;  3S2D I;  4BXX I;  4Y7N I;  5C44 I;  1WW9 A;  3FKI I;  2VUM I;  4A3K I;  3HOW I;  3HOZ I;  1VLA A;  3RZO I;  3D6W A;  2JA7 I;  3S15 I;  1Y1V S;  3HOX I;  2R7Z I; 
#chains in the Genus database with same CATH topology
 4NBG A;  1VQN 1;  4QTT A;  2RHB A;  2HU9 A;  2QRD B;  3HOY I;  4NB8 A;  1TWA I;  3CCQ Z;  3J80 b;  4BY7 I;  2R92 I;  3S16 I;  5T67 A;  1K9M 1;  3T4N B;  2ZAE B;  3GTL I;  3S1M I;  3CCR 1;  3CCL 1;  1WII A;  3CD6 1;  3Q87 A;  2Q4Z A;  2P28 A;  1Z02 A;  1Q16 A;  3GTG I;  4NBH A;  1ZB9 A;  3K7A I;  2DE5 A;  3CQZ I;  3GTO I;  1YI2 Z;  1N8R 2;  1YJ9 1;  3FQQ A;  3KIF A;  1Z01 A;  2E2H I;  1I3Q I;  2IZ3 A;  5FLX f;  4Y52 I;  1YIT 1;  2VUG A;  3HOV I;  4RVG A;  2GTH A;  3PO3 S;  1DL6 A;  1S72 Z;  3G6E Z;  3VTN A;  2GTI A;  1Q86 2;  4NBA A;  5D1O A;  2VPY A;  2OTL Z;  2QRC B;  4E2Z A;  1VQ4 Z;  3H3V J;  2LIY A;  4BBS I;  3GTM S;  2G2K A;  1TWC I;  5C3E I;  4NB9 A;  2OOX B;  2RBL A;  3PO3 I;  1R9T I;  3S1Q I;  1PFT A;  1M90 2;  3M3Y I;  4DQY B;  1VQO 1;  3CME Z;  1VQ6 Z;  3BG1 B;  2JMO A;  3ESW A;  2E9H A;  3GTM I;  4A3J I;  1M1K 2;  1VQM 1;  2JIO A;  1RQF A;  3J81 f;  3TDH B;  2JIR A;  1YIJ 1;  2OTJ Z;  3CC4 1;  1VQ9 1;  4NFR A;  1TWH I;  1YJN Z;  4RV9 A;  4BXX I;  1P9N A;  2V8J A;  4Y7N I;  1VQ8 1;  3FKI I;  1NJI 2;  1KC8 2;  3CCU Z;  1YUK A;  3CCV 1;  5T6B A;  3CCM Z;  3HOZ I;  1VLA A;  2QA4 1;  1VQ5 1;  3S15 I;  2QEX 1;  2R6M A;  3HKZ A;  1YUA A;  3G4S 1;  3D2L A;  3H0G I;  1ML8 A;  1VQP 1;  3GTK I;  1Z03 A;  1YHQ Z;  4A3C I;  2VPX A;  4AYB A;  3I56 1;  1RO4 A;  3HOU I;  1USP B;  3EED A;  3CC7 1;  1NP6 A;  1RO2 A;  4BBR I;  3CMA 1;  3GKQ A;  3BG0 B;  2PMZ A;  3IFU A;  1SIW A;  1QF8 A;  2JIM A;  4E31 A;  1FDO A;  5IP7 I;  2PK7 A;  1YJW Z;  2O4H A;  3J80 f;  2VF1 A;  3MZL B;  5T64 A;  2F4M A;  2NVX I;  2WAQ A;  1VQK Z;  1VQL Z;  4A3B I;  3M4O I;  3NDJ A;  1M1K 1;  3CCS 1;  2K5R A;  3CCJ Z;  1Q81 2;  3P5J B;  1QYP A;  3S17 I;  2DE7 A;  3S1N I;  1QVG Y;  2GU2 A;  3CCE 1;  1QVG Z;  1KRL A;  3GCF A;  2V3V A;  3G71 Z;  1K73 2;  3VMI A;  3JAM b;  1FDI A;  4HGZ A;  3I55 Z;  2RT9 A;  2NVQ I;  1VQN Z;  1I6H I;  4BY1 I;  4MD7 A;  4MD9 A;  1N8R 1;  2KI7 B;  1VQ7 1;  2QKD A;  3RZD I;  1RNI A;  3TE5 B;  3S2D I;  2VPW A;  3CCR Z;  3CCL Z;  1ZH1 A;  4MD8 A;  3CD6 Z;  3NDI A;  1K8A 1;  5LL6 f;  1Y8C A;  3CC2 1;  1Q86 1;  3HOW I;  3RZO I;  2AYD A;  1Y1V S;  2R7Z I;  4NBD A;  5IP9 I;  2W03 A;  3CPW Y;  3MON A;  1YJ9 Z;  2I3C A;  3CPW Z;  1RO0 A;  4A3I I;  1YIT Z;  2JA6 I;  4A3L I;  2M6N A;  2RPR A;  4NH1 C;  1M90 1;  1N2F A;  1QXF A;  1TWG I;  2JS4 A;  1TFI A;  2E7Z A;  1WJ2 A;  1Y1V I;  1NUI A;  1TWF I;  1KD1 2;  2DE6 A;  4DGL A;  1Q7Y 2;  2M48 A;  2LEX A;  4NBB A;  2QR1 B;  3F3F C;  2J6A A;  4RVH A;  1ZB8 A;  1RLY A;  2JIQ A;  1VQO Z;  5D1O B;  3VMG A;  3CCQ 1;  1KC8 1;  2AKL A;  2Q51 A;  2OOY B;  3I4N I;  1K83 I;  1Q82 2;  1VQM Z;  1WZN A;  1YIJ Z;  1VQ9 Z;  3CC4 Z;  3PO2 I;  5FLM I;  1S7M A;  4HGY A;  2E2I I;  2BJO A;  2F4O A;  2NVY I;  4A3D I;  1VQ8 Z;  2V8I A;  3CCV Z;  5IT9 b;  1YI2 1;  2RIQ A;  5C4X I;  3NH8 A;  5IT9 f;  1K9M 2;  2E2J I;  1LQL A;  5C4J I;  2QA4 Z;  1VQ5 Z;  4RS4 A;  2HF1 A;  4E32 A;  2PM9 A;  2QEX Z;  2KPI A;  2JA8 I;  3G4S Z;  3IX0 A;  3IR7 A;  3F3P C;  1S72 1;  1JWH C;  3G6E 1;  1VQP Z;  4RVD A;  2OTL 1;  2O53 A;  3I56 Z;  2Y0S A;  1VQ4 1;  4NBE A;  4A3E I;  3CC7 Z;  5C44 I;  1W2B Y;  3NH5 A;  3CMA Z;  1W2B Z;  2OZK A;  3JAM f;  2VUM I;  3D6W A;  4E2W A;  2JA7 I;  3CME 1;  2V45 A;  1VQ6 1;  3S1R I;  1Q81 1;  3OW2 Y;  3QWU A;  3OW2 Z;  5A2Q b;  2EGT A;  1Y1W I;  4TNU A;  5A2Q f;  4QTU A;  3EER A;  4NBC A;  5FLX b;  2JR6 A;  2OTJ 1;  4XX2 A;  2JA5 I;  5D1P A;  1K73 1;  5CM2 M;  4HH4 A;  3NFZ A;  3FQM A;  4E2X A;  2JNY A;  2NVT I;  1KQS Y;  3CCS Z;  1K8A 2;  4A3M I;  1YJN 1;  1KQS Z;  2JIP A;  3CCU 1;  4A3G I;  4NOZ A;  3CCM 1;  3CCE Z;  4EWC A;  1USP A;  4A3F I;  4NBF A;  3MZK B;  3J7A 4;  2JUB A;  1AA6 A;  3VMH A;  1JJ2 Y;  3VB9 A;  3GTJ I;  1JJ2 Z;  4E30 A;  1I50 I;  4RVF A;  1YHQ 1;  3S14 I;  2K3R A;  2QLV B;  1SFO I;  2IZ4 A;  3GTQ I;  2IV2 X;  2NAP A;  1QVF Y;  3J81 b;  2H85 A;  1QVF Z;  1X0T A;  3LUS A;  3GTP I;  2YAD A;  1VQ7 Z;  2R93 I;  2QRE B;  1WCM I;  3I07 A;  2B63 I;  2V8K A;  2LFU A;  4A93 I;  4E2Y A;  4MRI A;  3KIH A;  1X3W A;  1X3Z A;  3CC2 Z;  1YJW 1;  1NJI 1;  1KD1 1;  1L1O C;  4X6A I;  2VPZ A;  2P3Y A;  4MXU A;  3I4M I;  4S1T A;  1VQK 1;  4CL1 A;  3IF8 A;  1VQL 1;  1Q7Y 1;  4MON A;  3CXC Y;  3S2H I;  3CCJ 1;  3NH4 A;  3CXC Z;  4MH4 A;  3U50 C;  2W04 A;  3D9X A;  2YU9 I;  1WW9 A;  5AN9 F;  2WB1 A;  1Q82 1;  4DK1 A;  3G71 1;  4A3K I;  3I55 1;  3HOX I;  4E33 A; 
#chains in the Genus database with same CATH homology
 4NBG A;  1VQN 1;  4QTT A;  2RHB A;  2HU9 A;  2QRD B;  3HOY I;  4NB8 A;  1TWA I;  3CCQ Z;  3J80 b;  4BY7 I;  2R92 I;  3S16 I;  5T67 A;  1K9M 1;  3T4N B;  2ZAE B;  3GTL I;  3S1M I;  3CCR 1;  3CCL 1;  1WII A;  3CD6 1;  3Q87 A;  2Q4Z A;  2P28 A;  1Z02 A;  3GTG I;  4NBH A;  1ZB9 A;  3K7A I;  2DE5 A;  3CQZ I;  3GTO I;  1YI2 Z;  1N8R 2;  1YJ9 1;  3FQQ A;  3KIF A;  1Z01 A;  2E2H I;  1I3Q I;  2IZ3 A;  5FLX f;  4Y52 I;  1YIT 1;  2VUG A;  3HOV I;  4RVG A;  2GTH A;  3PO3 S;  1DL6 A;  1S72 Z;  3G6E Z;  3VTN A;  2GTI A;  1Q86 2;  4NBA A;  5D1O A;  2OTL Z;  2QRC B;  4E2Z A;  1VQ4 Z;  3H3V J;  2LIY A;  4BBS I;  3GTM S;  2G2K A;  1TWC I;  5C3E I;  4NB9 A;  2OOX B;  2RBL A;  3PO3 I;  1R9T I;  3S1Q I;  1PFT A;  1M90 2;  3M3Y I;  4DQY B;  1VQO 1;  3CME Z;  1VQ6 Z;  3BG1 B;  2JMO A;  3ESW A;  2E9H A;  3GTM I;  4A3J I;  1M1K 2;  1VQM 1;  1RQF A;  3J81 f;  3TDH B;  1YIJ 1;  2OTJ Z;  3CC4 1;  1VQ9 1;  4NFR A;  1TWH I;  1YJN Z;  4RV9 A;  4BXX I;  1P9N A;  2V8J A;  4Y7N I;  1VQ8 1;  3FKI I;  1NJI 2;  1KC8 2;  3CCU Z;  1YUK A;  3CCV 1;  5T6B A;  3CCM Z;  3HOZ I;  1VLA A;  2QA4 1;  1VQ5 1;  3S15 I;  2QEX 1;  2R6M A;  3HKZ A;  1YUA A;  3G4S 1;  3H0G I;  1ML8 A;  1VQP 1;  3GTK I;  1Z03 A;  1YHQ Z;  4A3C I;  4AYB A;  3I56 1;  1RO4 A;  3HOU I;  1USP B;  3EED A;  3CC7 1;  1NP6 A;  1RO2 A;  4BBR I;  3CMA 1;  3GKQ A;  3BG0 B;  2PMZ A;  3IFU A;  1QF8 A;  4E31 A;  5IP7 I;  2PK7 A;  1YJW Z;  2O4H A;  3J80 f;  2VF1 A;  3MZL B;  5T64 A;  2F4M A;  2NVX I;  2WAQ A;  1VQK Z;  1VQL Z;  4A3B I;  3M4O I;  3NDJ A;  1M1K 1;  3CCS 1;  2K5R A;  3CCJ Z;  1Q81 2;  3P5J B;  1QYP A;  3S17 I;  2DE7 A;  3S1N I;  1QVG Y;  2GU2 A;  3CCE 1;  1QVG Z;  1KRL A;  3GCF A;  3G71 Z;  1K73 2;  3VMI A;  3JAM b;  4HGZ A;  3I55 Z;  2RT9 A;  2NVQ I;  1VQN Z;  1I6H I;  4BY1 I;  4MD7 A;  4MD9 A;  1N8R 1;  2KI7 B;  1VQ7 1;  2QKD A;  3RZD I;  1RNI A;  3TE5 B;  3S2D I;  3CCR Z;  3CCL Z;  1ZH1 A;  4MD8 A;  3CD6 Z;  3NDI A;  1K8A 1;  5LL6 f;  3CC2 1;  1Q86 1;  3HOW I;  3RZO I;  1Y1V S;  2R7Z I;  4NBD A;  5IP9 I;  2W03 A;  3CPW Y;  3MON A;  1YJ9 Z;  2I3C A;  3CPW Z;  1RO0 A;  4A3I I;  1YIT Z;  2JA6 I;  4A3L I;  2M6N A;  2RPR A;  4NH1 C;  1M90 1;  1N2F A;  1TWG I;  2JS4 A;  1TFI A;  1Y1V I;  1NUI A;  1TWF I;  1KD1 2;  2DE6 A;  4DGL A;  1Q7Y 2;  2M48 A;  4NBB A;  2QR1 B;  3F3F C;  2J6A A;  4RVH A;  1ZB8 A;  1RLY A;  1VQO Z;  5D1O B;  3VMG A;  3CCQ 1;  1KC8 1;  2AKL A;  2Q51 A;  2OOY B;  3I4N I;  1K83 I;  1Q82 2;  1VQM Z;  1YIJ Z;  1VQ9 Z;  3CC4 Z;  3PO2 I;  5FLM I;  1S7M A;  4HGY A;  2E2I I;  2BJO A;  2F4O A;  2NVY I;  4A3D I;  1VQ8 Z;  2V8I A;  3CCV Z;  5IT9 b;  1YI2 1;  2RIQ A;  5C4X I;  3NH8 A;  5IT9 f;  1K9M 2;  2E2J I;  1LQL A;  5C4J I;  2QA4 Z;  1VQ5 Z;  4RS4 A;  2HF1 A;  4E32 A;  2PM9 A;  2QEX Z;  2KPI A;  2JA8 I;  3G4S Z;  3IX0 A;  3F3P C;  1S72 1;  1JWH C;  3G6E 1;  1VQP Z;  4RVD A;  2OTL 1;  2O53 A;  3I56 Z;  2Y0S A;  1VQ4 1;  4NBE A;  4A3E I;  3CC7 Z;  5C44 I;  1W2B Y;  3NH5 A;  3CMA Z;  1W2B Z;  2OZK A;  3JAM f;  2VUM I;  3D6W A;  4E2W A;  2JA7 I;  3CME 1;  1VQ6 1;  3S1R I;  1Q81 1;  3OW2 Y;  3QWU A;  3OW2 Z;  5A2Q b;  2EGT A;  1Y1W I;  4TNU A;  5A2Q f;  4QTU A;  3EER A;  4NBC A;  5FLX b;  2JR6 A;  2OTJ 1;  4XX2 A;  2JA5 I;  5D1P A;  1K73 1;  5CM2 M;  4HH4 A;  3NFZ A;  3FQM A;  4E2X A;  2JNY A;  2NVT I;  1KQS Y;  3CCS Z;  1K8A 2;  4A3M I;  1YJN 1;  1KQS Z;  3CCU 1;  4A3G I;  4NOZ A;  3CCM 1;  3CCE Z;  4EWC A;  1USP A;  4A3F I;  4NBF A;  3MZK B;  3J7A 4;  2JUB A;  3VMH A;  1JJ2 Y;  3VB9 A;  3GTJ I;  1JJ2 Z;  4E30 A;  1I50 I;  4RVF A;  1YHQ 1;  3S14 I;  2K3R A;  2QLV B;  1SFO I;  2IZ4 A;  3GTQ I;  1QVF Y;  3J81 b;  2H85 A;  1QVF Z;  1X0T A;  3LUS A;  3GTP I;  2YAD A;  1VQ7 Z;  2R93 I;  2QRE B;  1WCM I;  3I07 A;  2B63 I;  2V8K A;  2LFU A;  4A93 I;  4E2Y A;  4MRI A;  3KIH A;  1X3W A;  1X3Z A;  3CC2 Z;  1YJW 1;  1NJI 1;  1KD1 1;  1L1O C;  4X6A I;  2P3Y A;  4MXU A;  3I4M I;  4S1T A;  1VQK 1;  4CL1 A;  3IF8 A;  1VQL 1;  1Q7Y 1;  4MON A;  3CXC Y;  3S2H I;  3CCJ 1;  3NH4 A;  3CXC Z;  4MH4 A;  3U50 C;  2W04 A;  3D9X A;  2YU9 I;  1WW9 A;  5AN9 F;  2WB1 A;  1Q82 1;  4DK1 A;  3G71 1;  4A3K I;  3I55 1;  3HOX I;  4E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...