2R92I

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 7
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r92I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r92I02
3H0GI 1L1OC 4Y7NI 5CM2M 3LUSA 2YU9I 1NUIA 3M3YI 3GTMI 2F4OA 5C44I 3GTJI 2HF1A 3M4OI 3PO3S 3GTKI 1DL6A 2R7ZI 1LQLA 2K5RA 3U50C 2JS4A 1USPA 4BBSI 3HOWI 1ZB9A 2DE6A 4A3EI 4NBFA 4QTTA 1R9TI 3PO2I 4BY7I 3K7AI 3H3VJ 1TWHI 4A3BI 4XX2A 2NVYI 4A3LI 3GTLI 1WCMI 2NVXI 3S1MI 3RZOI 2NVTI 1TWAI 3GTPI 3VMGA 3GTMS 3HOXI 5IP7I 1TWCI 3GTOI 2R93I 4NB9A 2E2II 3HOYI 3S2DI 2J6AA 4A3CI 3FKII 4A93I 2JNYA 2KPIA 3GTQI 3Q87A 1TFIA 1RO4A 2F4MA 1Y1WI 4X6AI 3CQZI 3GTGI 2P3YA 5C4XI 2E2HI 1QYPA 2DE5A 2RBLA 4A3JI 4NBGA 3HOUI 2PK7A 2NVQI 2AKLA 3S2HI 1I50I 4A3KI 4A3II 1ML8A 3I07A 2JA8I 3S17I 3RZDI 4NBAA 5C4JI 4NBEA 1RLYA 5FLMI 1K83I 1X3WA 2R92I 2BJOA 3HOZI 2VUMI 4NBDA 1PFTA 3S16I 4NBBA 3HOVI 2DE7A 1USPB 3I4MI 3ESWA 1SFOI 3GCFA 1WW9A 5C3EI 3VB9A 4NBHA 2JA6I 1X3ZA 3VMIA 1I6HI 1Y1VS 2E2JI 4NB8A 2JR6A 5IP9I 1YUAA 4MH4A 4BBRI 3S1RI 1Y1VI 3EERA 4A3GI 4BXXI 2JA7I 1TWGI 4BY1I 1TWFI 4A3MI 3I4NI 1ZB8A 4NOZA 1I3QI 3VMHA 3PO3I 3S15I 3D6WA 2B63I 1N2FA 3S1QI 4Y52I 4A3DI 3GKQA 4NBCA 1VLAA 4QTUA 4A3FI 3S14I 3S1NI 2JA5I
chains in the Genus database with same CATH superfamily
1L1OC 5T64A 1Q812 5CM2M 3CC21 3CCU1 1YJ91 2Y0SA 1YIJ1 3CD6Z 1VQ91 1M901 1Q822 5D1OA 5C44I 3GTJI 1VQOZ 3NFZA 2R7ZI 1DL6A 1K8A1 3CC7Z 2JS4A 1USPA 3FQMA 3HOWI 4A3EI 1VQ81 1VQMZ 2QLVB 4HH4A 2G2KA 1QVFY 2NVYI 2PMZA 2V8IA 3CMEZ 2NVTI 3CPWZ 5FLXf 1VQP1 2R93I 3MZKB 2JIOA 1VQNZ 2KPIA 2VPYA 3CCJZ 1KD11 4X6AI 3GTGI 3CCVZ 2VPWA 2RBLA 4A3JI 1Z03A 3EEDA 2AKLA 2YADA 4A3KI 4RS4A 1M1K1 2OTJ1 3S17I 3RZDI 4MD8A 1QVGY 3IFUA 1WJ2A 2QA4Z 2Q4ZA 3JAMb 3S16I 1X0TA 1JWHC 1YJW1 4E31A 1Q7Y1 2LIYA 2IV2X 3KIHA 4DGLA 1K732 1I6HI 2JR6A 1K9M2 3G4S1 3S1RI 1Y1VI 4A3GI 1NJI2 2RIQA 3NH4A 2JIPA 3CCMZ 3D6WA 2B63I 2RPRA 3GKQA 3IR7A 2K3RA 4NBCA 2ZAEB 4E33A 2M6NA 3F3PC 1KC82 3H0GI 1S72Z 4NFRA 4Y7NI 1RO0A 3J80f 2EGTA 4RVHA 1VQLZ 1VQ5Z 2GTIA 1N8R2 2GTHA 3I55Z 2YU9I 3OW2Y 3M3YI 4HGYA 3CCSZ 3M4OI 3PO3S 3GTKI 3MZLB 2VPXA 1YITZ 1LQLA 1YJNZ 2K5RA 2V45A 2VPZA 3CCV1 5D1PA 1ZB9A 2QRDB 4NBFA 3J80b 3CCR1 3F3FC 3H3VJ 2JMOA 2Q51A 4A3LI 1JJ2Z 1W2BY 2AYDA 1KQSY 2NVXI 3GTLI 2O4HA 3RZOI 3G711 3T4NB 2OOYB 3CCQ1 3GTMS 2JIMA 3HOXI 5IP7I 1TWCI 3CC4Z 1YHQ1 4NB9A 1TFIA 2QR1B 1QVFZ 3I56Z 4NBGA 2QRCB 2NVQI 3CXCZ 2R6MA 3NH5A 3NH8A 4A3II 3G6E1 1YI2Z 3VTNA 3IX0A 3CCM1 1VQKZ 3CCEZ 2R92I 2OZKA 3HOZI 3I4MI 1Y8CA 3ESWA 3GCFA 4RV9A 5C3EI 2JA6I 5FLXb 3CMAZ 1Y1VS 1VQ6Z 4S1TA 1VQ4Z 5IP9I 1YUAA 3CCS1 1VQ71 5T6BA 3EERA 4BXXI 1TWFI 3I4NI 1ZB8A 1I3QI 4RVFA 3S1QI 4A3DI 2OTLZ 1M902 4QTUA 2IZ3A 3S14I 2VUGA 3S1NI 2JA5I 4MONA 1SIWA 3CD61 2IZ4A 1FDOA 1ZH1A 3CC2Z 1VQO1 1YJ9Z 2RHBA 1YIJZ 1NP6A 2F4OA 3CC71 2HF1A 1VQ9Z 4E30A 3J81f 3KIFA 3FQQA 1VQM1 1Q811 3BG0B 4DQYB 2DE6A 1R9TI 2QKDA 4QTTA 4BY7I 3K7AI 1TWHI 1VQ8Z 3OW2Z 4XX2A 1Q821 3CME1 3HKZA 1WCMI 3TE5B 3S1MI 3J81b 1TWAI 1Q862 3VMGA 4DK1A 3GTOI 4MRIA 1VQN1 2E2II 3CCJ1 3IF8A 1VQPZ 2J6AA 1M1K2 3GTQI 2QEXZ 5A2Qf 2F4MA 1Y1WI 1FDIA 1RNIA 1W2BZ 1RQFA 5C4XI 4MD9A 2VF1A 3HOUI 4RVGA 4E2ZA 3S2HI 1I50I 1Q7Y2 3I07A 5A2Qb 3NDIA 4NBAA 1YUKA 4E2XA 2OTJZ 2QA41 5FLMI 2QREB 1PFTA 4NBBA 3HOVI 1USPB 2LFUA 1SFOI 2NAPA 1YJWZ 4MXUA 4NBHA 2KI7B 2E2JI 4NB8A 4MH4A 2JUBA 5T67A 3D9XA 1JJ2Y 3G4SZ 2JA7I 1TWGI 4BY1I 4A3MI 4NOZA 3PO3I 3S15I 4CL1A 3TDHB 1K731 1K9M1 4A3FI 1S721 1NJI1 5AN9F 2V8KA 1VQL1 1VQ51 2OOXB 1Q16A 3I551 1QVGZ 2HU9A 3CXCY 3LUSA 1NUIA 1YIT1 1YJN1 3GTMI 2QEX1 2JIQA 5LL6f 3CPWY 2RT9A 1KC81 3U50C 2W03A 4BBSI 1Q861 2V8JA 3PO2I 1WIIA 3J7A4 1N8R1 3JAMf 1S7MA 3CCRZ 4A3BI 1K8A2 2WAQA 3CCLZ 3GTPI 3NDJA 2V3VA 3CC41 2P28A 3G71Z 4EWCA 3CCQZ 3CCUZ 4E2WA 3HOYI 3S2DI 3BG1B 4A3CI 3FKII 2I3CA 1YHQZ 4A93I 2JNYA 3I561 3Q87A 1RO4A 1QF8A 3CQZI 4E32A 2P3YA 2E2HI 1QYPA 2DE5A 2PK7A 3P5JB 4MD7A 1KD12 1RO2A 1YI21 1ML8A 2GU2A 2E7ZA 2JA8I 1VQK1 3CCE1 5C4JI 1WZNA 2LEXA 4NBEA 3G6EZ 1RLYA 4NH1C 1K83I 1X3WA 2WB1A 2BJOA 1KRLA 2VUMI 4NBDA 1QXFA 2DE7A 2O53A 5IT9f 2H85A 3CMA1 1KQSZ 2PM9A 1WW9A 3VB9A 1VQ61 2JIRA 1Z01A 2W04A 1VQ41 3D2LA 1X3ZA 1AA6A 3VMIA 4RVDA 4BBRI 3MONA 1P9NA 3QWUA 1VQ7Z 5IT9b 5D1OB 3VMHA 2OTL1 1N2FA 2M48A 4Y52I 4E2YA 4AYBA 1VLAA 2E9HA 4HGZA 3CCL1 4TNUA 1Z02A
chains in the Genus database with same CATH topology
1L1OC 5T64A 1Q812 5CM2M 3CC21 3CCU1 1YJ91 2Y0SA 1YIJ1 3CD6Z 1VQ91 1M901 1Q822 5D1OA 5C44I 3GTJI 1VQOZ 3NFZA 2R7ZI 1DL6A 1K8A1 3CC7Z 2JS4A 1USPA 3FQMA 3HOWI 4A3EI 1VQ81 1VQMZ 2QLVB 4HH4A 2G2KA 1QVFY 2NVYI 2PMZA 2V8IA 3CMEZ 2NVTI 3CPWZ 5FLXf 1VQP1 2R93I 3MZKB 1VQNZ 2KPIA 3CCJZ 1KD11 4X6AI 3GTGI 3CCVZ 2RBLA 4A3JI 1Z03A 3EEDA 2AKLA 2YADA 4A3KI 4RS4A 1M1K1 2OTJ1 3S17I 3RZDI 4MD8A 1QVGY 3IFUA 2QA4Z 2Q4ZA 3JAMb 3S16I 1X0TA 1JWHC 1YJW1 4E31A 1Q7Y1 2LIYA 3KIHA 4DGLA 1K732 1I6HI 2JR6A 1K9M2 3G4S1 3S1RI 1Y1VI 4A3GI 1NJI2 2RIQA 3NH4A 3CCMZ 3D6WA 2B63I 2RPRA 3GKQA 2K3RA 4NBCA 2ZAEB 4E33A 2M6NA 3F3PC 1KC82 3H0GI 1S72Z 4NFRA 4Y7NI 1RO0A 3J80f 2EGTA 4RVHA 1VQLZ 1VQ5Z 2GTIA 1N8R2 2GTHA 3I55Z 2YU9I 3OW2Y 3M3YI 4HGYA 3CCSZ 3M4OI 3PO3S 3GTKI 3MZLB 1YITZ 1LQLA 1YJNZ 2K5RA 3CCV1 5D1PA 1ZB9A 2QRDB 4NBFA 3J80b 3CCR1 3F3FC 3H3VJ 2JMOA 2Q51A 4A3LI 1JJ2Z 1W2BY 3GTLI 1KQSY 2NVXI 2O4HA 3RZOI 3G711 3T4NB 2OOYB 3CCQ1 3GTMS 3HOXI 5IP7I 1TWCI 3CC4Z 1YHQ1 4NB9A 1TFIA 2QR1B 1QVFZ 3I56Z 4NBGA 2QRCB 2NVQI 3CXCZ 2R6MA 3NH5A 3NH8A 4A3II 3G6E1 1YI2Z 3VTNA 3IX0A 3CCM1 1VQKZ 3CCEZ 2R92I 2OZKA 3HOZI 3I4MI 3ESWA 3GCFA 4RV9A 5C3EI 2JA6I 5FLXb 3CMAZ 1Y1VS 1VQ6Z 4S1TA 1VQ4Z 5IP9I 1YUAA 3CCS1 1VQ71 5T6BA 3EERA 4BXXI 1TWFI 3I4NI 1ZB8A 1I3QI 4RVFA 3S1QI 4A3DI 2OTLZ 1M902 4QTUA 2IZ3A 3S14I 2VUGA 3S1NI 2JA5I 4MONA 3CD61 2IZ4A 1ZH1A 3CC2Z 1VQO1 1YJ9Z 2RHBA 1YIJZ 1NP6A 2F4OA 3CC71 2HF1A 1VQ9Z 4E30A 3J81f 3KIFA 3FQQA 1VQM1 1Q811 3BG0B 4DQYB 2DE6A 1R9TI 2QKDA 4QTTA 4BY7I 3K7AI 1TWHI 1VQ8Z 3OW2Z 4XX2A 1Q821 3CME1 3HKZA 1WCMI 3TE5B 3S1MI 3J81b 1TWAI 1Q862 3VMGA 4DK1A 3GTOI 4MRIA 1VQN1 2E2II 3CCJ1 3IF8A 1VQPZ 2J6AA 1M1K2 3GTQI 2QEXZ 5A2Qf 2F4MA 1Y1WI 1RNIA 1W2BZ 1RQFA 5C4XI 4MD9A 2VF1A 3HOUI 4RVGA 4E2ZA 3S2HI 1I50I 1Q7Y2 3I07A 5A2Qb 3NDIA 4NBAA 1YUKA 4E2XA 2OTJZ 2QA41 5FLMI 2QREB 1PFTA 4NBBA 3HOVI 1USPB 2LFUA 1SFOI 1YJWZ 4MXUA 4NBHA 2KI7B 2E2JI 4NB8A 4MH4A 2JUBA 5T67A 3D9XA 1JJ2Y 3G4SZ 2JA7I 1TWGI 4BY1I 4A3MI 4NOZA 3PO3I 3S15I 4CL1A 3TDHB 1K731 1K9M1 4A3FI 1S721 1NJI1 5AN9F 2V8KA 1VQL1 1VQ51 2OOXB 3I551 1QVGZ 2HU9A 3CXCY 3LUSA 1NUIA 1YIT1 1YJN1 3GTMI 2QEX1 5LL6f 3CPWY 2RT9A 1KC81 3U50C 2W03A 4BBSI 1Q861 2V8JA 3PO2I 1WIIA 3J7A4 1N8R1 3JAMf 1S7MA 3CCRZ 4A3BI 1K8A2 2WAQA 3CCLZ 3GTPI 3NDJA 3CC41 2P28A 3G71Z 4EWCA 3CCQZ 3CCUZ 4E2WA 3HOYI 3S2DI 3BG1B 4A3CI 3FKII 2I3CA 1YHQZ 4A93I 2JNYA 3I561 3Q87A 1RO4A 1QF8A 3CQZI 4E32A 2P3YA 2E2HI 1QYPA 2DE5A 2PK7A 3P5JB 4MD7A 1KD12 1RO2A 1YI21 1ML8A 2GU2A 2JA8I 1VQK1 3CCE1 5C4JI 4NBEA 3G6EZ 1RLYA 4NH1C 1K83I 1X3WA 2WB1A 2BJOA 1KRLA 2VUMI 4NBDA 2DE7A 2O53A 5IT9f 2H85A 3CMA1 1KQSZ 2PM9A 1WW9A 3VB9A 1VQ61 1Z01A 2W04A 1VQ41 1X3ZA 3VMIA 4RVDA 4BBRI 3MONA 1P9NA 3QWUA 1VQ7Z 5IT9b 5D1OB 3VMHA 2OTL1 1N2FA 2M48A 4Y52I 4E2YA 4AYBA 1VLAA 2E9HA 4HGZA 3CCL1 4TNUA 1Z02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G I;  1L1O C;  4Y7N I;  5CM2 M;  3LUS A;  2YU9 I;  1NUI A;  3M3Y I;  3GTM I;  2F4O A;  5C44 I;  3GTJ I;  2HF1 A;  3M4O I;  3PO3 S;  3GTK I;  1DL6 A;  2R7Z I;  1LQL A;  2K5R A;  3U50 C;  2JS4 A;  1USP A;  4BBS I;  3HOW I;  1ZB9 A;  2DE6 A;  4A3E I;  4NBF A;  4QTT A;  1R9T I;  3PO2 I;  4BY7 I;  3K7A I;  3H3V J;  1TWH I;  4A3B I;  4XX2 A;  2NVY I;  4A3L I;  3GTL I;  1WCM I;  2NVX I;  3S1M I;  3RZO I;  2NVT I;  1TWA I;  3GTP I;  3VMG A;  3GTM S;  3HOX I;  5IP7 I;  1TWC I;  3GTO I;  2R93 I;  4NB9 A;  2E2I I;  3HOY I;  3S2D I;  2J6A A;  4A3C I;  3FKI I;  4A93 I;  2JNY A;  2KPI A;  3GTQ I;  3Q87 A;  1TFI A;  1RO4 A;  2F4M A;  1Y1W I;  4X6A I;  3CQZ I;  3GTG I;  2P3Y A;  5C4X I;  2E2H I;  1QYP A;  2DE5 A;  2RBL A;  4A3J I;  4NBG A;  3HOU I;  2PK7 A;  2NVQ I;  2AKL A;  3S2H I;  1I50 I;  4A3K I;  4A3I I;  1ML8 A;  3I07 A;  2JA8 I;  3S17 I;  3RZD I;  4NBA A;  5C4J I;  4NBE A;  1RLY A;  5FLM I;  1K83 I;  1X3W A;  2R92 I;  2BJO A;  3HOZ I;  2VUM I;  4NBD A;  1PFT A;  3S16 I;  4NBB A;  3HOV I;  2DE7 A;  1USP B;  3I4M I;  3ESW A;  1SFO I;  3GCF A;  1WW9 A;  5C3E I;  3VB9 A;  4NBH A;  2JA6 I;  1X3Z A;  3VMI A;  1I6H I;  1Y1V S;  2E2J I;  4NB8 A;  2JR6 A;  5IP9 I;  1YUA A;  4MH4 A;  4BBR I;  3S1R I;  1Y1V I;  3EER A;  4A3G I;  4BXX I;  2JA7 I;  1TWG I;  4BY1 I;  1TWF I;  4A3M I;  3I4N I;  1ZB8 A;  4NOZ A;  1I3Q I;  3VMH A;  3PO3 I;  3S15 I;  3D6W A;  2B63 I;  1N2F A;  3S1Q I;  4Y52 I;  4A3D I;  3GKQ A;  4NBC A;  1VLA A;  4QTU A;  4A3F I;  3S14 I;  3S1N I;  2JA5 I; 
#chains in the Genus database with same CATH topology
 1L1O C;  5T64 A;  1Q81 2;  5CM2 M;  3CC2 1;  3CCU 1;  1YJ9 1;  2Y0S A;  1YIJ 1;  3CD6 Z;  1VQ9 1;  1M90 1;  1Q82 2;  5D1O A;  5C44 I;  3GTJ I;  1VQO Z;  3NFZ A;  2R7Z I;  1DL6 A;  1K8A 1;  3CC7 Z;  2JS4 A;  1USP A;  3FQM A;  3HOW I;  4A3E I;  1VQ8 1;  1VQM Z;  2QLV B;  4HH4 A;  2G2K A;  1QVF Y;  2NVY I;  2PMZ A;  2V8I A;  3CME Z;  2NVT I;  3CPW Z;  5FLX f;  1VQP 1;  2R93 I;  3MZK B;  2JIO A;  1VQN Z;  2KPI A;  2VPY A;  3CCJ Z;  1KD1 1;  4X6A I;  3GTG I;  3CCV Z;  2VPW A;  2RBL A;  4A3J I;  1Z03 A;  3EED A;  2AKL A;  2YAD A;  4A3K I;  4RS4 A;  1M1K 1;  2OTJ 1;  3S17 I;  3RZD I;  4MD8 A;  1QVG Y;  3IFU A;  1WJ2 A;  2QA4 Z;  2Q4Z A;  3JAM b;  3S16 I;  1X0T A;  1JWH C;  1YJW 1;  4E31 A;  1Q7Y 1;  2LIY A;  2IV2 X;  3KIH A;  4DGL A;  1K73 2;  1I6H I;  2JR6 A;  1K9M 2;  3G4S 1;  3S1R I;  1Y1V I;  4A3G I;  1NJI 2;  2RIQ A;  3NH4 A;  2JIP A;  3CCM Z;  3D6W A;  2B63 I;  2RPR A;  3GKQ A;  3IR7 A;  2K3R A;  4NBC A;  2ZAE B;  4E33 A;  2M6N A;  3F3P C;  1KC8 2;  3H0G I;  1S72 Z;  4NFR A;  4Y7N I;  1RO0 A;  3J80 f;  2EGT A;  4RVH A;  1VQL Z;  1VQ5 Z;  2GTI A;  1N8R 2;  2GTH A;  3I55 Z;  2YU9 I;  3OW2 Y;  3M3Y I;  4HGY A;  3CCS Z;  3M4O I;  3PO3 S;  3GTK I;  3MZL B;  2VPX A;  1YIT Z;  1LQL A;  1YJN Z;  2K5R A;  2V45 A;  2VPZ A;  3CCV 1;  5D1P A;  1ZB9 A;  2QRD B;  4NBF A;  3J80 b;  3CCR 1;  3F3F C;  3H3V J;  2JMO A;  2Q51 A;  4A3L I;  1JJ2 Z;  1W2B Y;  2AYD A;  1KQS Y;  2NVX I;  3GTL I;  2O4H A;  3RZO I;  3G71 1;  3T4N B;  2OOY B;  3CCQ 1;  3GTM S;  2JIM A;  3HOX I;  5IP7 I;  1TWC I;  3CC4 Z;  1YHQ 1;  4NB9 A;  1TFI A;  2QR1 B;  1QVF Z;  3I56 Z;  4NBG A;  2QRC B;  2NVQ I;  3CXC Z;  2R6M A;  3NH5 A;  3NH8 A;  4A3I I;  3G6E 1;  1YI2 Z;  3VTN A;  3IX0 A;  3CCM 1;  1VQK Z;  3CCE Z;  2R92 I;  2OZK A;  3HOZ I;  3I4M I;  1Y8C A;  3ESW A;  3GCF A;  4RV9 A;  5C3E I;  2JA6 I;  5FLX b;  3CMA Z;  1Y1V S;  1VQ6 Z;  4S1T A;  1VQ4 Z;  5IP9 I;  1YUA A;  3CCS 1;  1VQ7 1;  5T6B A;  3EER A;  4BXX I;  1TWF I;  3I4N I;  1ZB8 A;  1I3Q I;  4RVF A;  3S1Q I;  4A3D I;  2OTL Z;  1M90 2;  4QTU A;  2IZ3 A;  3S14 I;  2VUG A;  3S1N I;  2JA5 I;  4MON A;  1SIW A;  3CD6 1;  2IZ4 A;  1FDO A;  1ZH1 A;  3CC2 Z;  1VQO 1;  1YJ9 Z;  2RHB A;  1YIJ Z;  1NP6 A;  2F4O A;  3CC7 1;  2HF1 A;  1VQ9 Z;  4E30 A;  3J81 f;  3KIF A;  3FQQ A;  1VQM 1;  1Q81 1;  3BG0 B;  4DQY B;  2DE6 A;  1R9T I;  2QKD A;  4QTT A;  4BY7 I;  3K7A I;  1TWH I;  1VQ8 Z;  3OW2 Z;  4XX2 A;  1Q82 1;  3CME 1;  3HKZ A;  1WCM I;  3TE5 B;  3S1M I;  3J81 b;  1TWA I;  1Q86 2;  3VMG A;  4DK1 A;  3GTO I;  4MRI A;  1VQN 1;  2E2I I;  3CCJ 1;  3IF8 A;  1VQP Z;  2J6A A;  1M1K 2;  3GTQ I;  2QEX Z;  5A2Q f;  2F4M A;  1Y1W I;  1FDI A;  1RNI A;  1W2B Z;  1RQF A;  5C4X I;  4MD9 A;  2VF1 A;  3HOU I;  4RVG A;  4E2Z A;  3S2H I;  1I50 I;  1Q7Y 2;  3I07 A;  5A2Q b;  3NDI A;  4NBA A;  1YUK A;  4E2X A;  2OTJ Z;  2QA4 1;  5FLM I;  2QRE B;  1PFT A;  4NBB A;  3HOV I;  1USP B;  2LFU A;  1SFO I;  2NAP A;  1YJW Z;  4MXU A;  4NBH A;  2KI7 B;  2E2J I;  4NB8 A;  4MH4 A;  2JUB A;  5T67 A;  3D9X A;  1JJ2 Y;  3G4S Z;  2JA7 I;  1TWG I;  4BY1 I;  4A3M I;  4NOZ A;  3PO3 I;  3S15 I;  4CL1 A;  3TDH B;  1K73 1;  1K9M 1;  4A3F I;  1S72 1;  1NJI 1;  5AN9 F;  2V8K A;  1VQL 1;  1VQ5 1;  2OOX B;  1Q16 A;  3I55 1;  1QVG Z;  2HU9 A;  3CXC Y;  3LUS A;  1NUI A;  1YIT 1;  1YJN 1;  3GTM I;  2QEX 1;  2JIQ A;  5LL6 f;  3CPW Y;  2RT9 A;  1KC8 1;  3U50 C;  2W03 A;  4BBS I;  1Q86 1;  2V8J A;  3PO2 I;  1WII A;  3J7A 4;  1N8R 1;  3JAM f;  1S7M A;  3CCR Z;  4A3B I;  1K8A 2;  2WAQ A;  3CCL Z;  3GTP I;  3NDJ A;  2V3V A;  3CC4 1;  2P28 A;  3G71 Z;  4EWC A;  3CCQ Z;  3CCU Z;  4E2W A;  3HOY I;  3S2D I;  3BG1 B;  4A3C I;  3FKI I;  2I3C A;  1YHQ Z;  4A93 I;  2JNY A;  3I56 1;  3Q87 A;  1RO4 A;  1QF8 A;  3CQZ I;  4E32 A;  2P3Y A;  2E2H I;  1QYP A;  2DE5 A;  2PK7 A;  3P5J B;  4MD7 A;  1KD1 2;  1RO2 A;  1YI2 1;  1ML8 A;  2GU2 A;  2E7Z A;  2JA8 I;  1VQK 1;  3CCE 1;  5C4J I;  1WZN A;  2LEX A;  4NBE A;  3G6E Z;  1RLY A;  4NH1 C;  1K83 I;  1X3W A;  2WB1 A;  2BJO A;  1KRL A;  2VUM I;  4NBD A;  1QXF A;  2DE7 A;  2O53 A;  5IT9 f;  2H85 A;  3CMA 1;  1KQS Z;  2PM9 A;  1WW9 A;  3VB9 A;  1VQ6 1;  2JIR A;  1Z01 A;  2W04 A;  1VQ4 1;  3D2L A;  1X3Z A;  1AA6 A;  3VMI A;  4RVD A;  4BBR I;  3MON A;  1P9N A;  3QWU A;  1VQ7 Z;  5IT9 b;  5D1O B;  3VMH A;  2OTL 1;  1N2F A;  2M48 A;  4Y52 I;  4E2Y A;  4AYB A;  1VLA A;  2E9H A;  4HGZ A;  3CCL 1;  4TNU A;  1Z02 A; 
#chains in the Genus database with same CATH homology
 1L1O C;  5T64 A;  1Q81 2;  5CM2 M;  3CC2 1;  3CCU 1;  1YJ9 1;  2Y0S A;  1YIJ 1;  3CD6 Z;  1VQ9 1;  1M90 1;  1Q82 2;  5D1O A;  5C44 I;  3GTJ I;  1VQO Z;  3NFZ A;  2R7Z I;  1DL6 A;  1K8A 1;  3CC7 Z;  2JS4 A;  1USP A;  3FQM A;  3HOW I;  4A3E I;  1VQ8 1;  1VQM Z;  2QLV B;  4HH4 A;  2G2K A;  1QVF Y;  2NVY I;  2PMZ A;  2V8I A;  3CME Z;  2NVT I;  3CPW Z;  5FLX f;  1VQP 1;  2R93 I;  3MZK B;  1VQN Z;  2KPI A;  3CCJ Z;  1KD1 1;  4X6A I;  3GTG I;  3CCV Z;  2RBL A;  4A3J I;  1Z03 A;  3EED A;  2AKL A;  2YAD A;  4A3K I;  4RS4 A;  1M1K 1;  2OTJ 1;  3S17 I;  3RZD I;  4MD8 A;  1QVG Y;  3IFU A;  2QA4 Z;  2Q4Z A;  3JAM b;  3S16 I;  1X0T A;  1JWH C;  1YJW 1;  4E31 A;  1Q7Y 1;  2LIY A;  3KIH A;  4DGL A;  1K73 2;  1I6H I;  2JR6 A;  1K9M 2;  3G4S 1;  3S1R I;  1Y1V I;  4A3G I;  1NJI 2;  2RIQ A;  3NH4 A;  3CCM Z;  3D6W A;  2B63 I;  2RPR A;  3GKQ A;  2K3R A;  4NBC A;  2ZAE B;  4E33 A;  2M6N A;  3F3P C;  1KC8 2;  3H0G I;  1S72 Z;  4NFR A;  4Y7N I;  1RO0 A;  3J80 f;  2EGT A;  4RVH A;  1VQL Z;  1VQ5 Z;  2GTI A;  1N8R 2;  2GTH A;  3I55 Z;  2YU9 I;  3OW2 Y;  3M3Y I;  4HGY A;  3CCS Z;  3M4O I;  3PO3 S;  3GTK I;  3MZL B;  1YIT Z;  1LQL A;  1YJN Z;  2K5R A;  3CCV 1;  5D1P A;  1ZB9 A;  2QRD B;  4NBF A;  3J80 b;  3CCR 1;  3F3F C;  3H3V J;  2JMO A;  2Q51 A;  4A3L I;  1JJ2 Z;  1W2B Y;  3GTL I;  1KQS Y;  2NVX I;  2O4H A;  3RZO I;  3G71 1;  3T4N B;  2OOY B;  3CCQ 1;  3GTM S;  3HOX I;  5IP7 I;  1TWC I;  3CC4 Z;  1YHQ 1;  4NB9 A;  1TFI A;  2QR1 B;  1QVF Z;  3I56 Z;  4NBG A;  2QRC B;  2NVQ I;  3CXC Z;  2R6M A;  3NH5 A;  3NH8 A;  4A3I I;  3G6E 1;  1YI2 Z;  3VTN A;  3IX0 A;  3CCM 1;  1VQK Z;  3CCE Z;  2R92 I;  2OZK A;  3HOZ I;  3I4M I;  3ESW A;  3GCF A;  4RV9 A;  5C3E I;  2JA6 I;  5FLX b;  3CMA Z;  1Y1V S;  1VQ6 Z;  4S1T A;  1VQ4 Z;  5IP9 I;  1YUA A;  3CCS 1;  1VQ7 1;  5T6B A;  3EER A;  4BXX I;  1TWF I;  3I4N I;  1ZB8 A;  1I3Q I;  4RVF A;  3S1Q I;  4A3D I;  2OTL Z;  1M90 2;  4QTU A;  2IZ3 A;  3S14 I;  2VUG A;  3S1N I;  2JA5 I;  4MON A;  3CD6 1;  2IZ4 A;  1ZH1 A;  3CC2 Z;  1VQO 1;  1YJ9 Z;  2RHB A;  1YIJ Z;  1NP6 A;  2F4O A;  3CC7 1;  2HF1 A;  1VQ9 Z;  4E30 A;  3J81 f;  3KIF A;  3FQQ A;  1VQM 1;  1Q81 1;  3BG0 B;  4DQY B;  2DE6 A;  1R9T I;  2QKD A;  4QTT A;  4BY7 I;  3K7A I;  1TWH I;  1VQ8 Z;  3OW2 Z;  4XX2 A;  1Q82 1;  3CME 1;  3HKZ A;  1WCM I;  3TE5 B;  3S1M I;  3J81 b;  1TWA I;  1Q86 2;  3VMG A;  4DK1 A;  3GTO I;  4MRI A;  1VQN 1;  2E2I I;  3CCJ 1;  3IF8 A;  1VQP Z;  2J6A A;  1M1K 2;  3GTQ I;  2QEX Z;  5A2Q f;  2F4M A;  1Y1W I;  1RNI A;  1W2B Z;  1RQF A;  5C4X I;  4MD9 A;  2VF1 A;  3HOU I;  4RVG A;  4E2Z A;  3S2H I;  1I50 I;  1Q7Y 2;  3I07 A;  5A2Q b;  3NDI A;  4NBA A;  1YUK A;  4E2X A;  2OTJ Z;  2QA4 1;  5FLM I;  2QRE B;  1PFT A;  4NBB A;  3HOV I;  1USP B;  2LFU A;  1SFO I;  1YJW Z;  4MXU A;  4NBH A;  2KI7 B;  2E2J I;  4NB8 A;  4MH4 A;  2JUB A;  5T67 A;  3D9X A;  1JJ2 Y;  3G4S Z;  2JA7 I;  1TWG I;  4BY1 I;  4A3M I;  4NOZ A;  3PO3 I;  3S15 I;  4CL1 A;  3TDH B;  1K73 1;  1K9M 1;  4A3F I;  1S72 1;  1NJI 1;  5AN9 F;  2V8K A;  1VQL 1;  1VQ5 1;  2OOX B;  3I55 1;  1QVG Z;  2HU9 A;  3CXC Y;  3LUS A;  1NUI A;  1YIT 1;  1YJN 1;  3GTM I;  2QEX 1;  5LL6 f;  3CPW Y;  2RT9 A;  1KC8 1;  3U50 C;  2W03 A;  4BBS I;  1Q86 1;  2V8J A;  3PO2 I;  1WII A;  3J7A 4;  1N8R 1;  3JAM f;  1S7M A;  3CCR Z;  4A3B I;  1K8A 2;  2WAQ A;  3CCL Z;  3GTP I;  3NDJ A;  3CC4 1;  2P28 A;  3G71 Z;  4EWC A;  3CCQ Z;  3CCU Z;  4E2W A;  3HOY I;  3S2D I;  3BG1 B;  4A3C I;  3FKI I;  2I3C A;  1YHQ Z;  4A93 I;  2JNY A;  3I56 1;  3Q87 A;  1RO4 A;  1QF8 A;  3CQZ I;  4E32 A;  2P3Y A;  2E2H I;  1QYP A;  2DE5 A;  2PK7 A;  3P5J B;  4MD7 A;  1KD1 2;  1RO2 A;  1YI2 1;  1ML8 A;  2GU2 A;  2JA8 I;  1VQK 1;  3CCE 1;  5C4J I;  4NBE A;  3G6E Z;  1RLY A;  4NH1 C;  1K83 I;  1X3W A;  2WB1 A;  2BJO A;  1KRL A;  2VUM I;  4NBD A;  2DE7 A;  2O53 A;  5IT9 f;  2H85 A;  3CMA 1;  1KQS Z;  2PM9 A;  1WW9 A;  3VB9 A;  1VQ6 1;  1Z01 A;  2W04 A;  1VQ4 1;  1X3Z A;  3VMI A;  4RVD A;  4BBR I;  3MON A;  1P9N A;  3QWU A;  1VQ7 Z;  5IT9 b;  5D1O B;  3VMH A;  2OTL 1;  1N2F A;  2M48 A;  4Y52 I;  4E2Y A;  4AYB A;  1VLA A;  2E9H A;  4HGZ A;  3CCL 1;  4TNU A;  1Z02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...