2JA8I

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja8I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja8I02
3D6WA 4A3CI 5C3EI 4NBDA 4MH4A 3Q87A 1K83I 4NBBA 1SFOI 3HOYI 4Y52I 4NBGA 3LUSA 5IP7I 2JA7I 2NVXI 2HF1A 5C4XI 5C4JI 1VLAA 3H3VJ 3I4NI 4BBRI 3S16I 4A3BI 3CQZI 4NBCA 3HOXI 2K5RA 1X3WA 3RZOI 2NVYI 3S2HI 3RZDI 1LQLA 1TWAI 3S14I 3GTMS 3GTGI 3K7AI 4Y7NI 3ESWA 1I3QI 3VMIA 3S1RI 2PK7A 3S2DI 2B63I 1Y1WI 3M4OI 1ML8A 3U50C 3GTJI 2E2JI 5IP9I 4NBAA 4BXXI 1I50I 3PO2I 2R92I 3HOUI 2KPIA 4NOZA 3S1MI 1ZB8A 1TWCI 1USPA 1L1OC 1YUAA 3VMHA 2E2II 2NVQI 3GTQI 4XX2A 4BBSI 4A3JI 1ZB9A 4QTTA 3GTPI 3GCFA 3PO3I 3FKII 2R93I 1WCMI 2J6AA 1I6HI 4A3KI 4BY1I 3VMGA 4A93I 1Y1VI 3GKQA 1R9TI 1DL6A 3S15I 1QYPA 4NBFA 2DE6A 4X6AI 3HOZI 4A3DI 4A3LI 1TWFI 4NBHA 4QTUA 1TWHI 1USPB 4NBEA 2JA5I 1PFTA 1NUIA 1TFIA 2RBLA 4A3GI 2F4MA 3VB9A 4A3II 3S17I 4NB9A 5C44I 4A3FI 3GTMI 2BJOA 3S1QI 1N2FA 2DE7A 3M3YI 2JA8I 3GTLI 3GTOI 2E2HI 3GTKI 2JS4A 3HOVI 2YU9I 3HOWI 1WW9A 3H0GI 4A3EI 1RLYA 2VUMI 1TWGI 2JA6I 3I4MI 2AKLA 4A3MI 1RO4A 2JNYA 4NB8A 2R7ZI 2JR6A 3PO3S 5FLMI 3EERA 2NVTI 5CM2M 4BY7I 1X3ZA 2F4OA 2P3YA 3I07A 1Y1VS 2DE5A 3S1NI
chains in the Genus database with same CATH superfamily
3F3PC 3D6WA 4A3CI 4NBDA 3Q87A 1VQL1 3FQMA 3CCJZ 2IZ3A 1NJI1 3HOYI 4Y52I 3LUSA 2JA7I 1Z03A 2OTLZ 3CCLZ 1VLAA 3CC71 3CCMZ 2EGTA 1VQM1 1X3WA 4DK1A 3RZOI 2NVYI 4NH1C 1LQLA 4NFRA 3G6E1 1VQ91 1KD11 3K7AI 3ESWA 2AYDA 3S1RI 3OW2Z 1QVFY 3CXCY 2B63I 3M4OI 2RHBA 2RIQA 3P5JB 5IP9I 4NBAA 3PO2I 2W03A 1SIWA 1USPA 1L1OC 3CCVZ 1JJ2Y 2GU2A 2E2II 3KIFA 3D9XA 3CMA1 3G4S1 2VPYA 1QVGZ 1VQPZ 4QTTA 1W2BZ 4MD7A 3GTPI 4E2XA 4E2ZA 2J6AA 1I6HI 1K9M1 1YJNZ 4BY1I 4A93I 2QREB 3JAMf 2JUBA 1VQ5Z 1DL6A 2QR1B 3TE5B 3I551 3G4SZ 4EWCA 1VQN1 5IT9b 1VQ6Z 5FLXb 3IX0A 3CD61 4NBHA 4QTUA 1VQ81 2E7ZA 2R6MA 3CCQ1 1TFIA 1YI2Z 2RT9A 2F4MA 2OTJZ 4A3II 3S17I 2QRCB 2V8IA 3GTMI 4MD9A 2BJOA 3CPWY 3CC41 1P9NA 3GTLI 3CD6Z 3CME1 3GTKI 2VUGA 1Q7Y1 3HOVI 2HU9A 4MONA 1RLYA 1TWGI 1Q822 1S7MA 4A3MI 2JNYA 4NB8A 2R7ZI 2JR6A 1VQ4Z 5FLMI 3PO3S 2NAPA 2PMZA 1Y8CA 2F4OA 2P3YA 4E31A 3OW2Y 3I07A 2DE5A 3S1NI 3I561 2QA41 4MD8A 1WJ2A 1YIT1 4NBBA 1K731 1SFOI 4E2WA 4NBGA 3VTNA 2NVXI 3J80b 2HF1A 5C4JI 3H3VJ 4BBRI 3S16I 1W2BY 2VPWA 2O4HA 4TNUA 3I56Z 1VQO1 4S1TA 1VQ71 3CC21 4Y7NI 1I3QI 1WZNA 2GTHA 3NFZA 1Y1WI 2P28A 3CCSZ 1KC81 1RQFA 3F3FC 4HGYA 2R92I 4RVFA 3CPWZ 3S1MI 4MXUA 2QRDB 1KQSZ 1VQ7Z 1YUAA 1X0TA 3CC2Z 3VMHA 3GTQI 1Z02A 4XX2A 3MONA 2JIRA 2M48A 1RO2A 1ZB9A 1AA6A 3GCFA 1M901 2R93I 1VQLZ 1WCMI 1Q861 3VMGA 1Y1VI 1R9TI 3S15I 4NBFA 2LEXA 2DE6A 1S721 3CC7Z 1VQMZ 3HOZI 2V45A 3NH5A 4A3LI 1TWFI 3G6EZ 1VQ9Z 5AN9F 4E2YA 2JA5I 5D1PA 2RBLA 4E30A 3VB9A 1RO0A 1N8R1 2QEX1 2DE7A 4RS4A 3BG0B 1YJW1 2M6NA 3CMAZ 1YHQ1 4HH4A 2IZ4A 3JAMb 2AKLA 1KC82 1NJI2 3D2LA 2QEXZ 3CCR1 3NDJA 2Q51A 5CM2M 4BY7I 2I3CA 3CCE1 1YJWZ 4HGZA 5C3EI 3I55Z 1K83I 1VQNZ 3NH8A 1KD12 2V8JA 4E33A 1KQSY 5A2Qf 3CCRZ 2JIQA 1VQ8Z 2O53A 1VQK1 3I4NI 1JWHC 5T6BA 3CCQZ 5T67A 2LIYA 4A3BI 3CQZI 2QKDA 2JIOA 3CCEZ 2OZKA 1TWAI 3S14I 3CC4Z 3GTMS 3EEDA 2WB1A 1YJ91 1RNIA 4RVGA 3CMEZ 2LFUA 3S2DI 5LL6f 3GTJI 3U50C 2H85A 1K9M2 1FDOA 2E2JI 1I50I 2E9HA 3HOUI 2KPIA 4NOZA 2YADA 3J81f 2GTIA 3IFUA 2QLVB 4RVDA 4BBSI 2QA4Z 2Q4ZA 2ZAEB 3FKII 1YITZ 1QYPA 3BG1B 4X6AI 2W04A 1VQOZ 1Q811 1YIJ1 2OTL1 4RV9A 1Q7Y2 1TWHI 2JIPA 3CCL1 4NBEA 1YUKA 3QWUA 3CCM1 4NB9A 5C44I 3S1QI 1Z01A 4RVHA 3M3YI 1YIJZ 1QF8A 3HOWI 1WW9A 2PM9A 4A3EI 3I4MI 3G711 1K732 2OOYB 1RO4A 3TDHB 2VPZA 2NVTI 2OOXB 3CCV1 1Y1VS 3IR7A 1M1K1 2K3RA 2JMOA 4AYBA 2JIMA 1VQP1 1S72Z 4MH4A 1Q821 3G71Z 2V3VA 1YJN1 5IP7I 1WIIA 2VPXA 1VQ51 5C4XI 5D1OB 3CCU1 4NBCA 3NH4A 3HOXI 2K5RA 3S2HI 2V8KA 3RZDI 1Q812 1VQ61 3IF8A 2IV2X 3GTGI 2KI7B 3VMIA 5IT9f 1YI21 2PK7A 5FLXf 3CCUZ 1K8A1 1YHQZ 1M902 2OTJ1 2G2KA 1FDIA 1ML8A 1Q862 4BXXI 1Q16A 1ZB8A 1TWCI 1QXFA 2NVQI 4MRIA 2WAQA 2Y0SA 5A2Qb 4A3JI 3PO3I 1VQ41 3MZLB 4A3KI 3T4NB 3GKQA 2RPRA 1M1K2 1VQKZ 1KRLA 1N8R2 1QVFZ 3CXCZ 4A3DI 3MZKB 1YJ9Z 1USPB 4DGLA 3KIHA 4E32A 1PFTA 1NUIA 4A3GI 1JJ2Z 4CL1A 3J81b 3J80f 1NP6A 4DQYB 4A3FI 1N2FA 2VF1A 3J7A4 5D1OA 1ZH1A 3GTOI 2E2HI 3NDIA 2JS4A 2YU9I 3H0GI 1K8A2 2VUMI 5T64A 2JA6I 3CCJ1 3CCS1 1QVGY 3HKZA 3EERA 1X3ZA 2JA8I 3FQQA
chains in the Genus database with same CATH topology
3F3PC 3D6WA 4A3CI 4NBDA 3Q87A 1VQL1 3FQMA 3CCJZ 2IZ3A 1NJI1 3HOYI 4Y52I 3LUSA 2JA7I 1Z03A 2OTLZ 3CCLZ 1VLAA 3CC71 3CCMZ 2EGTA 1VQM1 1X3WA 4DK1A 3RZOI 2NVYI 4NH1C 1LQLA 4NFRA 3G6E1 1VQ91 1KD11 3K7AI 3ESWA 3S1RI 3OW2Z 1QVFY 3CXCY 2B63I 3M4OI 2RHBA 2RIQA 3P5JB 5IP9I 4NBAA 3PO2I 2W03A 1USPA 1L1OC 3CCVZ 1JJ2Y 2GU2A 2E2II 3KIFA 3D9XA 3CMA1 3G4S1 1QVGZ 1VQPZ 4QTTA 1W2BZ 4MD7A 3GTPI 4E2XA 4E2ZA 2J6AA 1I6HI 1K9M1 1YJNZ 4BY1I 4A93I 2QREB 3JAMf 2JUBA 1VQ5Z 1DL6A 2QR1B 3TE5B 3I551 3G4SZ 4EWCA 1VQN1 5IT9b 1VQ6Z 5FLXb 3IX0A 3CD61 4NBHA 4QTUA 1VQ81 2R6MA 3CCQ1 1TFIA 1YI2Z 2RT9A 2F4MA 2OTJZ 4A3II 3S17I 2QRCB 2V8IA 3GTMI 4MD9A 2BJOA 3CPWY 3CC41 1P9NA 3GTLI 3CD6Z 3CME1 3GTKI 2VUGA 1Q7Y1 3HOVI 2HU9A 4MONA 1RLYA 1TWGI 1Q822 1S7MA 4A3MI 2JNYA 4NB8A 2R7ZI 2JR6A 1VQ4Z 5FLMI 3PO3S 2PMZA 2F4OA 2P3YA 4E31A 3OW2Y 3I07A 2DE5A 3S1NI 3I561 2QA41 4MD8A 1YIT1 4NBBA 1K731 1SFOI 4E2WA 4NBGA 3VTNA 2NVXI 3J80b 2HF1A 5C4JI 3H3VJ 4BBRI 3S16I 1W2BY 2O4HA 4TNUA 3I56Z 1VQO1 4S1TA 1VQ71 3CC21 4Y7NI 1I3QI 2GTHA 3NFZA 1Y1WI 2P28A 3CCSZ 1KC81 1RQFA 3F3FC 4HGYA 2R92I 4RVFA 3CPWZ 3S1MI 4MXUA 2QRDB 1KQSZ 1VQ7Z 1YUAA 1X0TA 3CC2Z 3VMHA 3GTQI 1Z02A 4XX2A 3MONA 2M48A 1RO2A 1ZB9A 3GCFA 1M901 2R93I 1VQLZ 1WCMI 1Q861 3VMGA 1Y1VI 1R9TI 3S15I 4NBFA 2DE6A 1S721 3CC7Z 1VQMZ 3HOZI 3NH5A 4A3LI 1TWFI 3G6EZ 1VQ9Z 5AN9F 4E2YA 2JA5I 5D1PA 2RBLA 4E30A 3VB9A 1RO0A 1N8R1 2QEX1 2DE7A 4RS4A 3BG0B 1YJW1 2M6NA 3CMAZ 1YHQ1 4HH4A 2IZ4A 3JAMb 2AKLA 1KC82 1NJI2 2QEXZ 3CCR1 3NDJA 2Q51A 5CM2M 4BY7I 2I3CA 3CCE1 1YJWZ 4HGZA 5C3EI 3I55Z 1K83I 1VQNZ 3NH8A 1KD12 2V8JA 4E33A 1KQSY 5A2Qf 3CCRZ 1VQ8Z 2O53A 1VQK1 3I4NI 1JWHC 5T6BA 3CCQZ 5T67A 2LIYA 4A3BI 3CQZI 2QKDA 3CCEZ 2OZKA 1TWAI 3S14I 3CC4Z 3GTMS 3EEDA 2WB1A 1YJ91 1RNIA 4RVGA 3CMEZ 2LFUA 3S2DI 5LL6f 3GTJI 3U50C 2H85A 1K9M2 2E2JI 1I50I 2E9HA 3HOUI 2KPIA 4NOZA 2YADA 3J81f 2GTIA 3IFUA 2QLVB 4RVDA 4BBSI 2QA4Z 2Q4ZA 2ZAEB 3FKII 1YITZ 1QYPA 3BG1B 4X6AI 2W04A 1VQOZ 1Q811 1YIJ1 2OTL1 4RV9A 1Q7Y2 1TWHI 3CCL1 4NBEA 1YUKA 3QWUA 3CCM1 4NB9A 5C44I 3S1QI 1Z01A 4RVHA 3M3YI 1YIJZ 1QF8A 3HOWI 1WW9A 2PM9A 4A3EI 3I4MI 3G711 1K732 2OOYB 1RO4A 3TDHB 2NVTI 2OOXB 3CCV1 1Y1VS 1M1K1 2K3RA 2JMOA 4AYBA 1VQP1 1S72Z 4MH4A 1Q821 3G71Z 1YJN1 5IP7I 1WIIA 1VQ51 5C4XI 5D1OB 3CCU1 4NBCA 3NH4A 3HOXI 2K5RA 3S2HI 2V8KA 3RZDI 1Q812 1VQ61 3IF8A 3GTGI 2KI7B 3VMIA 5IT9f 1YI21 2PK7A 5FLXf 3CCUZ 1K8A1 1YHQZ 1M902 2OTJ1 2G2KA 1ML8A 1Q862 4BXXI 1ZB8A 1TWCI 2NVQI 4MRIA 2WAQA 2Y0SA 5A2Qb 4A3JI 3PO3I 1VQ41 3MZLB 4A3KI 3T4NB 3GKQA 2RPRA 1M1K2 1VQKZ 1KRLA 1N8R2 1QVFZ 3CXCZ 4A3DI 3MZKB 1YJ9Z 1USPB 4DGLA 3KIHA 4E32A 1PFTA 1NUIA 4A3GI 1JJ2Z 4CL1A 3J81b 3J80f 1NP6A 4DQYB 4A3FI 1N2FA 2VF1A 3J7A4 5D1OA 1ZH1A 3GTOI 2E2HI 3NDIA 2JS4A 2YU9I 3H0GI 1K8A2 2VUMI 5T64A 2JA6I 3CCJ1 3CCS1 1QVGY 3HKZA 3EERA 1X3ZA 2JA8I 3FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6W A;  4A3C I;  5C3E I;  4NBD A;  4MH4 A;  3Q87 A;  1K83 I;  4NBB A;  1SFO I;  3HOY I;  4Y52 I;  4NBG A;  3LUS A;  5IP7 I;  2JA7 I;  2NVX I;  2HF1 A;  5C4X I;  5C4J I;  1VLA A;  3H3V J;  3I4N I;  4BBR I;  3S16 I;  4A3B I;  3CQZ I;  4NBC A;  3HOX I;  2K5R A;  1X3W A;  3RZO I;  2NVY I;  3S2H I;  3RZD I;  1LQL A;  1TWA I;  3S14 I;  3GTM S;  3GTG I;  3K7A I;  4Y7N I;  3ESW A;  1I3Q I;  3VMI A;  3S1R I;  2PK7 A;  3S2D I;  2B63 I;  1Y1W I;  3M4O I;  1ML8 A;  3U50 C;  3GTJ I;  2E2J I;  5IP9 I;  4NBA A;  4BXX I;  1I50 I;  3PO2 I;  2R92 I;  3HOU I;  2KPI A;  4NOZ A;  3S1M I;  1ZB8 A;  1TWC I;  1USP A;  1L1O C;  1YUA A;  3VMH A;  2E2I I;  2NVQ I;  3GTQ I;  4XX2 A;  4BBS I;  4A3J I;  1ZB9 A;  4QTT A;  3GTP I;  3GCF A;  3PO3 I;  3FKI I;  2R93 I;  1WCM I;  2J6A A;  1I6H I;  4A3K I;  4BY1 I;  3VMG A;  4A93 I;  1Y1V I;  3GKQ A;  1R9T I;  1DL6 A;  3S15 I;  1QYP A;  4NBF A;  2DE6 A;  4X6A I;  3HOZ I;  4A3D I;  4A3L I;  1TWF I;  4NBH A;  4QTU A;  1TWH I;  1USP B;  4NBE A;  2JA5 I;  1PFT A;  1NUI A;  1TFI A;  2RBL A;  4A3G I;  2F4M A;  3VB9 A;  4A3I I;  3S17 I;  4NB9 A;  5C44 I;  4A3F I;  3GTM I;  2BJO A;  3S1Q I;  1N2F A;  2DE7 A;  3M3Y I;  2JA8 I;  3GTL I;  3GTO I;  2E2H I;  3GTK I;  2JS4 A;  3HOV I;  2YU9 I;  3HOW I;  1WW9 A;  3H0G I;  4A3E I;  1RLY A;  2VUM I;  1TWG I;  2JA6 I;  3I4M I;  2AKL A;  4A3M I;  1RO4 A;  2JNY A;  4NB8 A;  2R7Z I;  2JR6 A;  3PO3 S;  5FLM I;  3EER A;  2NVT I;  5CM2 M;  4BY7 I;  1X3Z A;  2F4O A;  2P3Y A;  3I07 A;  1Y1V S;  2DE5 A;  3S1N I; 
#chains in the Genus database with same CATH topology
 3F3P C;  3D6W A;  4A3C I;  4NBD A;  3Q87 A;  1VQL 1;  3FQM A;  3CCJ Z;  2IZ3 A;  1NJI 1;  3HOY I;  4Y52 I;  3LUS A;  2JA7 I;  1Z03 A;  2OTL Z;  3CCL Z;  1VLA A;  3CC7 1;  3CCM Z;  2EGT A;  1VQM 1;  1X3W A;  4DK1 A;  3RZO I;  2NVY I;  4NH1 C;  1LQL A;  4NFR A;  3G6E 1;  1VQ9 1;  1KD1 1;  3K7A I;  3ESW A;  2AYD A;  3S1R I;  3OW2 Z;  1QVF Y;  3CXC Y;  2B63 I;  3M4O I;  2RHB A;  2RIQ A;  3P5J B;  5IP9 I;  4NBA A;  3PO2 I;  2W03 A;  1SIW A;  1USP A;  1L1O C;  3CCV Z;  1JJ2 Y;  2GU2 A;  2E2I I;  3KIF A;  3D9X A;  3CMA 1;  3G4S 1;  2VPY A;  1QVG Z;  1VQP Z;  4QTT A;  1W2B Z;  4MD7 A;  3GTP I;  4E2X A;  4E2Z A;  2J6A A;  1I6H I;  1K9M 1;  1YJN Z;  4BY1 I;  4A93 I;  2QRE B;  3JAM f;  2JUB A;  1VQ5 Z;  1DL6 A;  2QR1 B;  3TE5 B;  3I55 1;  3G4S Z;  4EWC A;  1VQN 1;  5IT9 b;  1VQ6 Z;  5FLX b;  3IX0 A;  3CD6 1;  4NBH A;  4QTU A;  1VQ8 1;  2E7Z A;  2R6M A;  3CCQ 1;  1TFI A;  1YI2 Z;  2RT9 A;  2F4M A;  2OTJ Z;  4A3I I;  3S17 I;  2QRC B;  2V8I A;  3GTM I;  4MD9 A;  2BJO A;  3CPW Y;  3CC4 1;  1P9N A;  3GTL I;  3CD6 Z;  3CME 1;  3GTK I;  2VUG A;  1Q7Y 1;  3HOV I;  2HU9 A;  4MON A;  1RLY A;  1TWG I;  1Q82 2;  1S7M A;  4A3M I;  2JNY A;  4NB8 A;  2R7Z I;  2JR6 A;  1VQ4 Z;  5FLM I;  3PO3 S;  2NAP A;  2PMZ A;  1Y8C A;  2F4O A;  2P3Y A;  4E31 A;  3OW2 Y;  3I07 A;  2DE5 A;  3S1N I;  3I56 1;  2QA4 1;  4MD8 A;  1WJ2 A;  1YIT 1;  4NBB A;  1K73 1;  1SFO I;  4E2W A;  4NBG A;  3VTN A;  2NVX I;  3J80 b;  2HF1 A;  5C4J I;  3H3V J;  4BBR I;  3S16 I;  1W2B Y;  2VPW A;  2O4H A;  4TNU A;  3I56 Z;  1VQO 1;  4S1T A;  1VQ7 1;  3CC2 1;  4Y7N I;  1I3Q I;  1WZN A;  2GTH A;  3NFZ A;  1Y1W I;  2P28 A;  3CCS Z;  1KC8 1;  1RQF A;  3F3F C;  4HGY A;  2R92 I;  4RVF A;  3CPW Z;  3S1M I;  4MXU A;  2QRD B;  1KQS Z;  1VQ7 Z;  1YUA A;  1X0T A;  3CC2 Z;  3VMH A;  3GTQ I;  1Z02 A;  4XX2 A;  3MON A;  2JIR A;  2M48 A;  1RO2 A;  1ZB9 A;  1AA6 A;  3GCF A;  1M90 1;  2R93 I;  1VQL Z;  1WCM I;  1Q86 1;  3VMG A;  1Y1V I;  1R9T I;  3S15 I;  4NBF A;  2LEX A;  2DE6 A;  1S72 1;  3CC7 Z;  1VQM Z;  3HOZ I;  2V45 A;  3NH5 A;  4A3L I;  1TWF I;  3G6E Z;  1VQ9 Z;  5AN9 F;  4E2Y A;  2JA5 I;  5D1P A;  2RBL A;  4E30 A;  3VB9 A;  1RO0 A;  1N8R 1;  2QEX 1;  2DE7 A;  4RS4 A;  3BG0 B;  1YJW 1;  2M6N A;  3CMA Z;  1YHQ 1;  4HH4 A;  2IZ4 A;  3JAM b;  2AKL A;  1KC8 2;  1NJI 2;  3D2L A;  2QEX Z;  3CCR 1;  3NDJ A;  2Q51 A;  5CM2 M;  4BY7 I;  2I3C A;  3CCE 1;  1YJW Z;  4HGZ A;  5C3E I;  3I55 Z;  1K83 I;  1VQN Z;  3NH8 A;  1KD1 2;  2V8J A;  4E33 A;  1KQS Y;  5A2Q f;  3CCR Z;  2JIQ A;  1VQ8 Z;  2O53 A;  1VQK 1;  3I4N I;  1JWH C;  5T6B A;  3CCQ Z;  5T67 A;  2LIY A;  4A3B I;  3CQZ I;  2QKD A;  2JIO A;  3CCE Z;  2OZK A;  1TWA I;  3S14 I;  3CC4 Z;  3GTM S;  3EED A;  2WB1 A;  1YJ9 1;  1RNI A;  4RVG A;  3CME Z;  2LFU A;  3S2D I;  5LL6 f;  3GTJ I;  3U50 C;  2H85 A;  1K9M 2;  1FDO A;  2E2J I;  1I50 I;  2E9H A;  3HOU I;  2KPI A;  4NOZ A;  2YAD A;  3J81 f;  2GTI A;  3IFU A;  2QLV B;  4RVD A;  4BBS I;  2QA4 Z;  2Q4Z A;  2ZAE B;  3FKI I;  1YIT Z;  1QYP A;  3BG1 B;  4X6A I;  2W04 A;  1VQO Z;  1Q81 1;  1YIJ 1;  2OTL 1;  4RV9 A;  1Q7Y 2;  1TWH I;  2JIP A;  3CCL 1;  4NBE A;  1YUK A;  3QWU A;  3CCM 1;  4NB9 A;  5C44 I;  3S1Q I;  1Z01 A;  4RVH A;  3M3Y I;  1YIJ Z;  1QF8 A;  3HOW I;  1WW9 A;  2PM9 A;  4A3E I;  3I4M I;  3G71 1;  1K73 2;  2OOY B;  1RO4 A;  3TDH B;  2VPZ A;  2NVT I;  2OOX B;  3CCV 1;  1Y1V S;  3IR7 A;  1M1K 1;  2K3R A;  2JMO A;  4AYB A;  2JIM A;  1VQP 1;  1S72 Z;  4MH4 A;  1Q82 1;  3G71 Z;  2V3V A;  1YJN 1;  5IP7 I;  1WII A;  2VPX A;  1VQ5 1;  5C4X I;  5D1O B;  3CCU 1;  4NBC A;  3NH4 A;  3HOX I;  2K5R A;  3S2H I;  2V8K A;  3RZD I;  1Q81 2;  1VQ6 1;  3IF8 A;  2IV2 X;  3GTG I;  2KI7 B;  3VMI A;  5IT9 f;  1YI2 1;  2PK7 A;  5FLX f;  3CCU Z;  1K8A 1;  1YHQ Z;  1M90 2;  2OTJ 1;  2G2K A;  1FDI A;  1ML8 A;  1Q86 2;  4BXX I;  1Q16 A;  1ZB8 A;  1TWC I;  1QXF A;  2NVQ I;  4MRI A;  2WAQ A;  2Y0S A;  5A2Q b;  4A3J I;  3PO3 I;  1VQ4 1;  3MZL B;  4A3K I;  3T4N B;  3GKQ A;  2RPR A;  1M1K 2;  1VQK Z;  1KRL A;  1N8R 2;  1QVF Z;  3CXC Z;  4A3D I;  3MZK B;  1YJ9 Z;  1USP B;  4DGL A;  3KIH A;  4E32 A;  1PFT A;  1NUI A;  4A3G I;  1JJ2 Z;  4CL1 A;  3J81 b;  3J80 f;  1NP6 A;  4DQY B;  4A3F I;  1N2F A;  2VF1 A;  3J7A 4;  5D1O A;  1ZH1 A;  3GTO I;  2E2H I;  3NDI A;  2JS4 A;  2YU9 I;  3H0G I;  1K8A 2;  2VUM I;  5T64 A;  2JA6 I;  3CCJ 1;  3CCS 1;  1QVG Y;  3HKZ A;  3EER A;  1X3Z A;  2JA8 I;  3FQQ A; 
#chains in the Genus database with same CATH homology
 3F3P C;  3D6W A;  4A3C I;  4NBD A;  3Q87 A;  1VQL 1;  3FQM A;  3CCJ Z;  2IZ3 A;  1NJI 1;  3HOY I;  4Y52 I;  3LUS A;  2JA7 I;  1Z03 A;  2OTL Z;  3CCL Z;  1VLA A;  3CC7 1;  3CCM Z;  2EGT A;  1VQM 1;  1X3W A;  4DK1 A;  3RZO I;  2NVY I;  4NH1 C;  1LQL A;  4NFR A;  3G6E 1;  1VQ9 1;  1KD1 1;  3K7A I;  3ESW A;  3S1R I;  3OW2 Z;  1QVF Y;  3CXC Y;  2B63 I;  3M4O I;  2RHB A;  2RIQ A;  3P5J B;  5IP9 I;  4NBA A;  3PO2 I;  2W03 A;  1USP A;  1L1O C;  3CCV Z;  1JJ2 Y;  2GU2 A;  2E2I I;  3KIF A;  3D9X A;  3CMA 1;  3G4S 1;  1QVG Z;  1VQP Z;  4QTT A;  1W2B Z;  4MD7 A;  3GTP I;  4E2X A;  4E2Z A;  2J6A A;  1I6H I;  1K9M 1;  1YJN Z;  4BY1 I;  4A93 I;  2QRE B;  3JAM f;  2JUB A;  1VQ5 Z;  1DL6 A;  2QR1 B;  3TE5 B;  3I55 1;  3G4S Z;  4EWC A;  1VQN 1;  5IT9 b;  1VQ6 Z;  5FLX b;  3IX0 A;  3CD6 1;  4NBH A;  4QTU A;  1VQ8 1;  2R6M A;  3CCQ 1;  1TFI A;  1YI2 Z;  2RT9 A;  2F4M A;  2OTJ Z;  4A3I I;  3S17 I;  2QRC B;  2V8I A;  3GTM I;  4MD9 A;  2BJO A;  3CPW Y;  3CC4 1;  1P9N A;  3GTL I;  3CD6 Z;  3CME 1;  3GTK I;  2VUG A;  1Q7Y 1;  3HOV I;  2HU9 A;  4MON A;  1RLY A;  1TWG I;  1Q82 2;  1S7M A;  4A3M I;  2JNY A;  4NB8 A;  2R7Z I;  2JR6 A;  1VQ4 Z;  5FLM I;  3PO3 S;  2PMZ A;  2F4O A;  2P3Y A;  4E31 A;  3OW2 Y;  3I07 A;  2DE5 A;  3S1N I;  3I56 1;  2QA4 1;  4MD8 A;  1YIT 1;  4NBB A;  1K73 1;  1SFO I;  4E2W A;  4NBG A;  3VTN A;  2NVX I;  3J80 b;  2HF1 A;  5C4J I;  3H3V J;  4BBR I;  3S16 I;  1W2B Y;  2O4H A;  4TNU A;  3I56 Z;  1VQO 1;  4S1T A;  1VQ7 1;  3CC2 1;  4Y7N I;  1I3Q I;  2GTH A;  3NFZ A;  1Y1W I;  2P28 A;  3CCS Z;  1KC8 1;  1RQF A;  3F3F C;  4HGY A;  2R92 I;  4RVF A;  3CPW Z;  3S1M I;  4MXU A;  2QRD B;  1KQS Z;  1VQ7 Z;  1YUA A;  1X0T A;  3CC2 Z;  3VMH A;  3GTQ I;  1Z02 A;  4XX2 A;  3MON A;  2M48 A;  1RO2 A;  1ZB9 A;  3GCF A;  1M90 1;  2R93 I;  1VQL Z;  1WCM I;  1Q86 1;  3VMG A;  1Y1V I;  1R9T I;  3S15 I;  4NBF A;  2DE6 A;  1S72 1;  3CC7 Z;  1VQM Z;  3HOZ I;  3NH5 A;  4A3L I;  1TWF I;  3G6E Z;  1VQ9 Z;  5AN9 F;  4E2Y A;  2JA5 I;  5D1P A;  2RBL A;  4E30 A;  3VB9 A;  1RO0 A;  1N8R 1;  2QEX 1;  2DE7 A;  4RS4 A;  3BG0 B;  1YJW 1;  2M6N A;  3CMA Z;  1YHQ 1;  4HH4 A;  2IZ4 A;  3JAM b;  2AKL A;  1KC8 2;  1NJI 2;  2QEX Z;  3CCR 1;  3NDJ A;  2Q51 A;  5CM2 M;  4BY7 I;  2I3C A;  3CCE 1;  1YJW Z;  4HGZ A;  5C3E I;  3I55 Z;  1K83 I;  1VQN Z;  3NH8 A;  1KD1 2;  2V8J A;  4E33 A;  1KQS Y;  5A2Q f;  3CCR Z;  1VQ8 Z;  2O53 A;  1VQK 1;  3I4N I;  1JWH C;  5T6B A;  3CCQ Z;  5T67 A;  2LIY A;  4A3B I;  3CQZ I;  2QKD A;  3CCE Z;  2OZK A;  1TWA I;  3S14 I;  3CC4 Z;  3GTM S;  3EED A;  2WB1 A;  1YJ9 1;  1RNI A;  4RVG A;  3CME Z;  2LFU A;  3S2D I;  5LL6 f;  3GTJ I;  3U50 C;  2H85 A;  1K9M 2;  2E2J I;  1I50 I;  2E9H A;  3HOU I;  2KPI A;  4NOZ A;  2YAD A;  3J81 f;  2GTI A;  3IFU A;  2QLV B;  4RVD A;  4BBS I;  2QA4 Z;  2Q4Z A;  2ZAE B;  3FKI I;  1YIT Z;  1QYP A;  3BG1 B;  4X6A I;  2W04 A;  1VQO Z;  1Q81 1;  1YIJ 1;  2OTL 1;  4RV9 A;  1Q7Y 2;  1TWH I;  3CCL 1;  4NBE A;  1YUK A;  3QWU A;  3CCM 1;  4NB9 A;  5C44 I;  3S1Q I;  1Z01 A;  4RVH A;  3M3Y I;  1YIJ Z;  1QF8 A;  3HOW I;  1WW9 A;  2PM9 A;  4A3E I;  3I4M I;  3G71 1;  1K73 2;  2OOY B;  1RO4 A;  3TDH B;  2NVT I;  2OOX B;  3CCV 1;  1Y1V S;  1M1K 1;  2K3R A;  2JMO A;  4AYB A;  1VQP 1;  1S72 Z;  4MH4 A;  1Q82 1;  3G71 Z;  1YJN 1;  5IP7 I;  1WII A;  1VQ5 1;  5C4X I;  5D1O B;  3CCU 1;  4NBC A;  3NH4 A;  3HOX I;  2K5R A;  3S2H I;  2V8K A;  3RZD I;  1Q81 2;  1VQ6 1;  3IF8 A;  3GTG I;  2KI7 B;  3VMI A;  5IT9 f;  1YI2 1;  2PK7 A;  5FLX f;  3CCU Z;  1K8A 1;  1YHQ Z;  1M90 2;  2OTJ 1;  2G2K A;  1ML8 A;  1Q86 2;  4BXX I;  1ZB8 A;  1TWC I;  2NVQ I;  4MRI A;  2WAQ A;  2Y0S A;  5A2Q b;  4A3J I;  3PO3 I;  1VQ4 1;  3MZL B;  4A3K I;  3T4N B;  3GKQ A;  2RPR A;  1M1K 2;  1VQK Z;  1KRL A;  1N8R 2;  1QVF Z;  3CXC Z;  4A3D I;  3MZK B;  1YJ9 Z;  1USP B;  4DGL A;  3KIH A;  4E32 A;  1PFT A;  1NUI A;  4A3G I;  1JJ2 Z;  4CL1 A;  3J81 b;  3J80 f;  1NP6 A;  4DQY B;  4A3F I;  1N2F A;  2VF1 A;  3J7A 4;  5D1O A;  1ZH1 A;  3GTO I;  2E2H I;  3NDI A;  2JS4 A;  2YU9 I;  3H0G I;  1K8A 2;  2VUM I;  5T64 A;  2JA6 I;  3CCJ 1;  3CCS 1;  1QVG Y;  3HKZ A;  3EER A;  1X3Z A;  2JA8 I;  3FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...