2JA8I

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja8I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja8I02
2PK7A 3GKQA 4NBFA 1NUIA 1PFTA 3HOYI 2DE5A 3PO3S 4NBCA 4A3JI 1TFIA 3GTJI 3GTKI 3ESWA 1USPA 2E2HI 2F4OA 3EERA 2K5RA 3VMGA 4BBSI 4Y52I 3CQZI 2R93I 3K7AI 3PO3I 3U50C 1TWCI 3HOVI 1USPB 2JR6A 3RZOI 3GTPI 2E2JI 5C4XI 3GTMI 2J6AA 3S1NI 4A3EI 2VUMI 1VLAA 1RLYA 1TWHI 1N2FA 1TWFI 3VMIA 1K83I 1YUAA 4BXXI 1I50I 2HF1A 1RO4A 2JNYA 4BY7I 4A3LI 3GCFA 2AKLA 4Y7NI 3H3VJ 1X3ZA 2YU9I 2NVQI 3I07A 2E2II 2NVXI 3VMHA 3GTLI 1I3QI 5C44I 5C3EI 4X6AI 3HOUI 2P3YA 4A3FI 4NBEA 5IP9I 4A3DI 3M3YI 2B63I 2BJOA 1R9TI 3S1RI 5CM2M 2JA6I 3GTMS 2JA5I 2DE7A 3RZDI 3H0GI 4BBRI 4A3BI 3PO2I 3GTGI 3HOWI 2RBLA 3HOZI 1Y1VS 4NBAA 3I4MI 3LUSA 1WCMI 3I4NI 4A93I 2JA8I 4BY1I 3S2DI 4XX2A 4A3GI 1L1OC 3S16I 4NBGA 4NBDA 3D6WA 4A3CI 1DL6A 1ZB9A 3FKII 3S17I 1Y1WI 3M4OI 2R7ZI 2KPIA 3S1QI 1TWAI 5FLMI 4QTTA 4NB9A 4NBHA 1SFOI 1WW9A 2DE6A 2NVYI 3VB9A 4NBBA 3Q87A 4MH4A 5C4JI 3S1MI 1I6HI 1TWGI 1ZB8A 4NB8A 3GTQI 4QTUA 1QYPA 2R92I 3S14I 1Y1VI 1LQLA 3GTOI 4A3KI 5IP7I 3S15I 2F4MA 2JA7I 2NVTI 4NOZA 4A3MI 1X3WA 2JS4A 3HOXI 1ML8A 3S2HI 4A3II
chains in the Genus database with same CATH superfamily
1NJI2 3BG1B 2PMZA 2QRDB 1PFTA 3HOYI 2V3VA 4MD8A 3ESWA 2E2HI 1QF8A 2K5RA 4Y52I 2V45A 1WZNA 3CQZI 4HH4A 2R93I 3J80f 1K9M2 1USPB 3MZKB 1VQ81 2E2JI 5C4XI 3GTMI 2VUMI 3VMIA 2G2KA 4RS4A 1W2BZ 2HF1A 1YJ91 1Z01A 3H3VJ 2GTHA 1VQ6Z 4CL1A 3GTLI 1YI2Z 4X6AI 3HOUI 3FQMA 4A3FI 1Z03A 4NBEA 3CCU1 4A3DI 2OTLZ 2B63I 1VQL1 4A3BI 1YJW1 3FQQA 2E7ZA 2VPYA 4NH1C 3G71Z 4NBAA 4AYBA 2JA8I 4BY1I 3HKZA 5IT9b 1L1OC 2OTJZ 3IR7A 2V8KA 1P9NA 1WJ2A 1VQ8Z 2QA4Z 4A3CI 5D1OA 1DL6A 1K8A1 3FKII 3S17I 1M902 2I3CA 3M4OI 1YIT1 4MONA 5FLXf 4NBHA 2OOYB 4NBBA 4RVFA 5C4JI 3G4S1 1NP6A 3S1MI 3T4NB 4NB8A 2VPWA 3GTQI 1VQ9Z 2AYDA 1YITZ 1WIIA 1W2BY 2VPZA 2JA7I 3CCV1 3CCM1 1X3WA 3CCRZ 2WAQA 2QA41 2Q51A 2PK7A 4E31A 3GKQA 1JJ2Z 4RVGA 2JIMA 4NBCA 4A3JI 3GTKI 1VQOZ 1USPA 1ZH1A 2ZAEB 3CC7Z 3CMAZ 1KD11 1VQ91 3U50C 3HOVI 3NDJA 5D1OB 3IFUA 1KC82 2PM9A 3CCR1 2J6AA 3CMA1 3CCVZ 2QREB 4BXXI 3KIHA 4BY7I 4A3LI 1JJ2Y 2RIQA 3EEDA 2M48A 2LIYA 4Y7NI 3OW2Y 5IT9f 4MXUA 4HGYA 2NVQI 5D1PA 3QWUA 2JIPA 2NVXI 1SIWA 2V8JA 3CC71 2QEXZ 4NFRA 5IP9I 1RNIA 3G711 3M3YI 3CCLZ 2R6MA 2JA5I 3I56Z 3PO2I 3IX0A 2RBLA 3G4SZ 1Y1VS 4EWCA 2P28A 4RVDA 4XX2A 4HGZA 4E32A 1VQ5Z 1YHQZ 4NBDA 2JIQA 5T64A 5AN9F 2H85A 1Y1WI 3CPWZ 3S1QI 4QTTA 1YIJZ 1VQ41 4NB9A 1RQFA 3F3FC 1WW9A 3CC2Z 1QVGY 3VB9A 4E2XA 4MH4A 1X0TA 1Q812 1N8R1 2RHBA 1YJ9Z 3S14I 3GTOI 1YIJ1 5IP7I 1Q7Y2 5T67A 3S15I 2F4MA 4A3MI 5T6BA 3CD61 2NAPA 3S2HI 3D9XA 4A3II 3NH8A 2V8IA 3CCMZ 2EGTA 2HU9A 2JUBA 4NBFA 1NUIA 2Y0SA 2WB1A 3CPWY 3CC4Z 1TFIA 3GTJI 3JAMf 1S7MA 1VQN1 2F4OA 1RO2A 3EERA 3CCUZ 3VMGA 4BBSI 2IZ3A 1NJI1 2OTJ1 2VPXA 3JAMb 1VQ71 4S1TA 4RVHA 4MRIA 4TNUA 1TWCI 1VQO1 3GTPI 4A3EI 1YJWZ 1TWHI 5A2Qb 1K83I 2JNYA 3GCFA 3NDIA 2YU9I 3I07A 1YHQ1 3VMHA 4RV9A 4E2WA 2P3YA 1Q861 2BJOA 4E2YA 3S1RI 2K3RA 3P5JB 2DE7A 1VQMZ 1Q822 2LFUA 2O4HA 1M1K2 2JMOA 2GTIA 3HOWI 3I561 1QVFY 3HOZI 3BG0B 3G6EZ 3J7A4 1WCMI 4MD9A 4A93I 4E33A 1YJNZ 3I55Z 3NH4A 2W04A 1VQ4Z 3S16I 4NBGA 2RT9A 3D6WA 4E2ZA 1AA6A 1QVGZ 1K732 2OTL1 3J80b 2Q4ZA 3VTNA 1VQPZ 2R7ZI 1S721 1TWAI 5FLMI 1VQ51 2DE6A 5A2Qf 3Q87A 2GU2A 3NH5A 4DGLA 3CCEZ 1ZB8A 1I6HI 3CMEZ 1QVFZ 3J81f 2R92I 1S72Z 2VUGA 2M6NA 4A3KI 1YI21 3CXCZ 2NVTI 1VQ61 4NOZA 2JS4A 3HOXI 4DK1A 3CME1 1QXFA 3CCL1 1N8R2 2JIRA 3CCQZ 3MZLB 1Q7Y1 2DE5A 3CCQ1 3G6E1 1Z02A 2QRCB 1K9M1 3PO3S 2E9HA 4E30A 1KQSY 3CC21 1KC81 2QLVB 1FDIA 1VQKZ 2YADA 2W03A 3OW2Z 3I551 1VQM1 3K7AI 1VQNZ 3PO3I 2O53A 2JR6A 3RZOI 3CCSZ 3CCJ1 3S1NI 3IF8A 1VLAA 1RLYA 1KD12 1N2FA 1TWFI 4DQYB 1YUAA 1I50I 1RO4A 1YUKA 4MD7A 3TDHB 2AKLA 3MONA 1X3ZA 2LEXA 2QR1B 2E2II 1I3QI 5C44I 5C3EI 1VQK1 1VQP1 1R9TI 5CM2M 2JA6I 3GTMS 1Y8CA 2QEX1 3RZDI 1VQ7Z 1RO0A 3H0GI 4BBRI 3GTGI 3F3PC 3CCE1 1Q862 1JWHC 1VQLZ 3KIFA 1K8A2 3I4MI 3LUSA 1M901 3I4NI 3S2DI 3D2LA 2VF1A 2JIOA 1FDOA 4A3GI 1Q821 3TE5B 1M1K1 2KI7B 1KQSZ 1KRLA 1Q811 1ZB9A 2KPIA 1YJN1 1SFOI 2NVYI 1K731 3CXCY 1TWGI 3CD6Z 2IZ4A 2OZKA 3J81b 4QTUA 1QYPA 2QKDA 2RPRA 1Y1VI 1LQLA 3NFZA 3CCJZ 2OOXB 3CCS1 5FLXb 2IV2X 1Q16A 3CC41 1ML8A 5LL6f
chains in the Genus database with same CATH topology
1NJI2 3BG1B 2PMZA 2QRDB 1PFTA 3HOYI 4MD8A 3ESWA 2E2HI 1QF8A 2K5RA 4Y52I 3CQZI 4HH4A 2R93I 3J80f 1K9M2 1USPB 3MZKB 1VQ81 2E2JI 5C4XI 3GTMI 2VUMI 3VMIA 2G2KA 4RS4A 1W2BZ 2HF1A 1YJ91 1Z01A 3H3VJ 2GTHA 1VQ6Z 4CL1A 3GTLI 1YI2Z 4X6AI 3HOUI 3FQMA 4A3FI 1Z03A 4NBEA 3CCU1 4A3DI 2OTLZ 2B63I 1VQL1 4A3BI 1YJW1 3FQQA 4NH1C 3G71Z 4NBAA 4AYBA 2JA8I 4BY1I 3HKZA 5IT9b 1L1OC 2OTJZ 2V8KA 1P9NA 1VQ8Z 2QA4Z 4A3CI 5D1OA 1DL6A 1K8A1 3FKII 3S17I 1M902 2I3CA 3M4OI 1YIT1 4MONA 5FLXf 4NBHA 2OOYB 4NBBA 4RVFA 5C4JI 3G4S1 1NP6A 3S1MI 3T4NB 4NB8A 3GTQI 1VQ9Z 1YITZ 1WIIA 1W2BY 2JA7I 3CCV1 3CCM1 1X3WA 3CCRZ 2WAQA 2QA41 2Q51A 2PK7A 4E31A 3GKQA 1JJ2Z 4RVGA 4NBCA 4A3JI 3GTKI 1VQOZ 1USPA 1ZH1A 2ZAEB 3CC7Z 3CMAZ 1KD11 1VQ91 3U50C 3HOVI 3NDJA 5D1OB 3IFUA 1KC82 2PM9A 3CCR1 2J6AA 3CMA1 3CCVZ 2QREB 4BXXI 3KIHA 4BY7I 4A3LI 1JJ2Y 2RIQA 3EEDA 2M48A 2LIYA 4Y7NI 3OW2Y 5IT9f 4MXUA 4HGYA 2NVQI 5D1PA 3QWUA 2NVXI 2V8JA 3CC71 2QEXZ 4NFRA 5IP9I 1RNIA 3G711 3M3YI 3CCLZ 2R6MA 2JA5I 3I56Z 3PO2I 3IX0A 2RBLA 3G4SZ 1Y1VS 4EWCA 2P28A 4RVDA 4XX2A 4HGZA 4E32A 1VQ5Z 1YHQZ 4NBDA 5T64A 5AN9F 2H85A 1Y1WI 3CPWZ 3S1QI 4QTTA 1YIJZ 1VQ41 4NB9A 1RQFA 3F3FC 1WW9A 3CC2Z 1QVGY 3VB9A 4E2XA 4MH4A 1X0TA 1Q812 1N8R1 2RHBA 1YJ9Z 3S14I 3GTOI 1YIJ1 5IP7I 1Q7Y2 5T67A 3S15I 2F4MA 4A3MI 5T6BA 3CD61 3S2HI 3D9XA 4A3II 3NH8A 2V8IA 3CCMZ 2EGTA 2HU9A 2JUBA 4NBFA 1NUIA 2Y0SA 2WB1A 3CPWY 3CC4Z 1TFIA 3GTJI 3JAMf 1S7MA 1VQN1 2F4OA 1RO2A 3EERA 3CCUZ 3VMGA 4BBSI 2IZ3A 1NJI1 2OTJ1 3JAMb 1VQ71 4S1TA 4RVHA 4MRIA 4TNUA 1TWCI 1VQO1 3GTPI 4A3EI 1YJWZ 1TWHI 5A2Qb 1K83I 2JNYA 3GCFA 3NDIA 2YU9I 3I07A 1YHQ1 3VMHA 4RV9A 4E2WA 2P3YA 1Q861 2BJOA 4E2YA 3S1RI 2K3RA 3P5JB 2DE7A 1VQMZ 1Q822 2LFUA 2O4HA 1M1K2 2JMOA 2GTIA 3HOWI 3I561 1QVFY 3HOZI 3BG0B 3G6EZ 3J7A4 1WCMI 4MD9A 4A93I 4E33A 1YJNZ 3I55Z 3NH4A 2W04A 1VQ4Z 3S16I 4NBGA 2RT9A 3D6WA 4E2ZA 1QVGZ 1K732 2OTL1 3J80b 2Q4ZA 3VTNA 1VQPZ 2R7ZI 1S721 1TWAI 5FLMI 1VQ51 2DE6A 5A2Qf 3Q87A 2GU2A 3NH5A 4DGLA 3CCEZ 1ZB8A 1I6HI 3CMEZ 1QVFZ 3J81f 2R92I 1S72Z 2VUGA 2M6NA 4A3KI 1YI21 3CXCZ 2NVTI 1VQ61 4NOZA 2JS4A 3HOXI 4DK1A 3CME1 3CCL1 1N8R2 3CCQZ 3MZLB 1Q7Y1 2DE5A 3CCQ1 3G6E1 1Z02A 2QRCB 1K9M1 3PO3S 2E9HA 4E30A 1KQSY 3CC21 1KC81 2QLVB 1VQKZ 2YADA 2W03A 3OW2Z 3I551 1VQM1 3K7AI 1VQNZ 3PO3I 2O53A 2JR6A 3RZOI 3CCSZ 3CCJ1 3S1NI 3IF8A 1VLAA 1RLYA 1KD12 1N2FA 1TWFI 4DQYB 1YUAA 1I50I 1RO4A 1YUKA 4MD7A 3TDHB 2AKLA 3MONA 1X3ZA 2QR1B 2E2II 1I3QI 5C44I 5C3EI 1VQK1 1VQP1 1R9TI 5CM2M 2JA6I 3GTMS 2QEX1 3RZDI 1VQ7Z 1RO0A 3H0GI 4BBRI 3GTGI 3F3PC 3CCE1 1Q862 1JWHC 1VQLZ 3KIFA 1K8A2 3I4MI 3LUSA 1M901 3I4NI 3S2DI 2VF1A 4A3GI 1Q821 3TE5B 1M1K1 2KI7B 1KQSZ 1KRLA 1Q811 1ZB9A 2KPIA 1YJN1 1SFOI 2NVYI 1K731 3CXCY 1TWGI 3CD6Z 2IZ4A 2OZKA 3J81b 4QTUA 1QYPA 2QKDA 2RPRA 1Y1VI 1LQLA 3NFZA 3CCJZ 2OOXB 3CCS1 5FLXb 3CC41 1ML8A 5LL6f
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PK7 A;  3GKQ A;  4NBF A;  1NUI A;  1PFT A;  3HOY I;  2DE5 A;  3PO3 S;  4NBC A;  4A3J I;  1TFI A;  3GTJ I;  3GTK I;  3ESW A;  1USP A;  2E2H I;  2F4O A;  3EER A;  2K5R A;  3VMG A;  4BBS I;  4Y52 I;  3CQZ I;  2R93 I;  3K7A I;  3PO3 I;  3U50 C;  1TWC I;  3HOV I;  1USP B;  2JR6 A;  3RZO I;  3GTP I;  2E2J I;  5C4X I;  3GTM I;  2J6A A;  3S1N I;  4A3E I;  2VUM I;  1VLA A;  1RLY A;  1TWH I;  1N2F A;  1TWF I;  3VMI A;  1K83 I;  1YUA A;  4BXX I;  1I50 I;  2HF1 A;  1RO4 A;  2JNY A;  4BY7 I;  4A3L I;  3GCF A;  2AKL A;  4Y7N I;  3H3V J;  1X3Z A;  2YU9 I;  2NVQ I;  3I07 A;  2E2I I;  2NVX I;  3VMH A;  3GTL I;  1I3Q I;  5C44 I;  5C3E I;  4X6A I;  3HOU I;  2P3Y A;  4A3F I;  4NBE A;  5IP9 I;  4A3D I;  3M3Y I;  2B63 I;  2BJO A;  1R9T I;  3S1R I;  5CM2 M;  2JA6 I;  3GTM S;  2JA5 I;  2DE7 A;  3RZD I;  3H0G I;  4BBR I;  4A3B I;  3PO2 I;  3GTG I;  3HOW I;  2RBL A;  3HOZ I;  1Y1V S;  4NBA A;  3I4M I;  3LUS A;  1WCM I;  3I4N I;  4A93 I;  2JA8 I;  4BY1 I;  3S2D I;  4XX2 A;  4A3G I;  1L1O C;  3S16 I;  4NBG A;  4NBD A;  3D6W A;  4A3C I;  1DL6 A;  1ZB9 A;  3FKI I;  3S17 I;  1Y1W I;  3M4O I;  2R7Z I;  2KPI A;  3S1Q I;  1TWA I;  5FLM I;  4QTT A;  4NB9 A;  4NBH A;  1SFO I;  1WW9 A;  2DE6 A;  2NVY I;  3VB9 A;  4NBB A;  3Q87 A;  4MH4 A;  5C4J I;  3S1M I;  1I6H I;  1TWG I;  1ZB8 A;  4NB8 A;  3GTQ I;  4QTU A;  1QYP A;  2R92 I;  3S14 I;  1Y1V I;  1LQL A;  3GTO I;  4A3K I;  5IP7 I;  3S15 I;  2F4M A;  2JA7 I;  2NVT I;  4NOZ A;  4A3M I;  1X3W A;  2JS4 A;  3HOX I;  1ML8 A;  3S2H I;  4A3I I; 
#chains in the Genus database with same CATH topology
 1NJI 2;  3BG1 B;  2PMZ A;  2QRD B;  1PFT A;  3HOY I;  2V3V A;  4MD8 A;  3ESW A;  2E2H I;  1QF8 A;  2K5R A;  4Y52 I;  2V45 A;  1WZN A;  3CQZ I;  4HH4 A;  2R93 I;  3J80 f;  1K9M 2;  1USP B;  3MZK B;  1VQ8 1;  2E2J I;  5C4X I;  3GTM I;  2VUM I;  3VMI A;  2G2K A;  4RS4 A;  1W2B Z;  2HF1 A;  1YJ9 1;  1Z01 A;  3H3V J;  2GTH A;  1VQ6 Z;  4CL1 A;  3GTL I;  1YI2 Z;  4X6A I;  3HOU I;  3FQM A;  4A3F I;  1Z03 A;  4NBE A;  3CCU 1;  4A3D I;  2OTL Z;  2B63 I;  1VQL 1;  4A3B I;  1YJW 1;  3FQQ A;  2E7Z A;  2VPY A;  4NH1 C;  3G71 Z;  4NBA A;  4AYB A;  2JA8 I;  4BY1 I;  3HKZ A;  5IT9 b;  1L1O C;  2OTJ Z;  3IR7 A;  2V8K A;  1P9N A;  1WJ2 A;  1VQ8 Z;  2QA4 Z;  4A3C I;  5D1O A;  1DL6 A;  1K8A 1;  3FKI I;  3S17 I;  1M90 2;  2I3C A;  3M4O I;  1YIT 1;  4MON A;  5FLX f;  4NBH A;  2OOY B;  4NBB A;  4RVF A;  5C4J I;  3G4S 1;  1NP6 A;  3S1M I;  3T4N B;  4NB8 A;  2VPW A;  3GTQ I;  1VQ9 Z;  2AYD A;  1YIT Z;  1WII A;  1W2B Y;  2VPZ A;  2JA7 I;  3CCV 1;  3CCM 1;  1X3W A;  3CCR Z;  2WAQ A;  2QA4 1;  2Q51 A;  2PK7 A;  4E31 A;  3GKQ A;  1JJ2 Z;  4RVG A;  2JIM A;  4NBC A;  4A3J I;  3GTK I;  1VQO Z;  1USP A;  1ZH1 A;  2ZAE B;  3CC7 Z;  3CMA Z;  1KD1 1;  1VQ9 1;  3U50 C;  3HOV I;  3NDJ A;  5D1O B;  3IFU A;  1KC8 2;  2PM9 A;  3CCR 1;  2J6A A;  3CMA 1;  3CCV Z;  2QRE B;  4BXX I;  3KIH A;  4BY7 I;  4A3L I;  1JJ2 Y;  2RIQ A;  3EED A;  2M48 A;  2LIY A;  4Y7N I;  3OW2 Y;  5IT9 f;  4MXU A;  4HGY A;  2NVQ I;  5D1P A;  3QWU A;  2JIP A;  2NVX I;  1SIW A;  2V8J A;  3CC7 1;  2QEX Z;  4NFR A;  5IP9 I;  1RNI A;  3G71 1;  3M3Y I;  3CCL Z;  2R6M A;  2JA5 I;  3I56 Z;  3PO2 I;  3IX0 A;  2RBL A;  3G4S Z;  1Y1V S;  4EWC A;  2P28 A;  4RVD A;  4XX2 A;  4HGZ A;  4E32 A;  1VQ5 Z;  1YHQ Z;  4NBD A;  2JIQ A;  5T64 A;  5AN9 F;  2H85 A;  1Y1W I;  3CPW Z;  3S1Q I;  4QTT A;  1YIJ Z;  1VQ4 1;  4NB9 A;  1RQF A;  3F3F C;  1WW9 A;  3CC2 Z;  1QVG Y;  3VB9 A;  4E2X A;  4MH4 A;  1X0T A;  1Q81 2;  1N8R 1;  2RHB A;  1YJ9 Z;  3S14 I;  3GTO I;  1YIJ 1;  5IP7 I;  1Q7Y 2;  5T67 A;  3S15 I;  2F4M A;  4A3M I;  5T6B A;  3CD6 1;  2NAP A;  3S2H I;  3D9X A;  4A3I I;  3NH8 A;  2V8I A;  3CCM Z;  2EGT A;  2HU9 A;  2JUB A;  4NBF A;  1NUI A;  2Y0S A;  2WB1 A;  3CPW Y;  3CC4 Z;  1TFI A;  3GTJ I;  3JAM f;  1S7M A;  1VQN 1;  2F4O A;  1RO2 A;  3EER A;  3CCU Z;  3VMG A;  4BBS I;  2IZ3 A;  1NJI 1;  2OTJ 1;  2VPX A;  3JAM b;  1VQ7 1;  4S1T A;  4RVH A;  4MRI A;  4TNU A;  1TWC I;  1VQO 1;  3GTP I;  4A3E I;  1YJW Z;  1TWH I;  5A2Q b;  1K83 I;  2JNY A;  3GCF A;  3NDI A;  2YU9 I;  3I07 A;  1YHQ 1;  3VMH A;  4RV9 A;  4E2W A;  2P3Y A;  1Q86 1;  2BJO A;  4E2Y A;  3S1R I;  2K3R A;  3P5J B;  2DE7 A;  1VQM Z;  1Q82 2;  2LFU A;  2O4H A;  1M1K 2;  2JMO A;  2GTI A;  3HOW I;  3I56 1;  1QVF Y;  3HOZ I;  3BG0 B;  3G6E Z;  3J7A 4;  1WCM I;  4MD9 A;  4A93 I;  4E33 A;  1YJN Z;  3I55 Z;  3NH4 A;  2W04 A;  1VQ4 Z;  3S16 I;  4NBG A;  2RT9 A;  3D6W A;  4E2Z A;  1AA6 A;  1QVG Z;  1K73 2;  2OTL 1;  3J80 b;  2Q4Z A;  3VTN A;  1VQP Z;  2R7Z I;  1S72 1;  1TWA I;  5FLM I;  1VQ5 1;  2DE6 A;  5A2Q f;  3Q87 A;  2GU2 A;  3NH5 A;  4DGL A;  3CCE Z;  1ZB8 A;  1I6H I;  3CME Z;  1QVF Z;  3J81 f;  2R92 I;  1S72 Z;  2VUG A;  2M6N A;  4A3K I;  1YI2 1;  3CXC Z;  2NVT I;  1VQ6 1;  4NOZ A;  2JS4 A;  3HOX I;  4DK1 A;  3CME 1;  1QXF A;  3CCL 1;  1N8R 2;  2JIR A;  3CCQ Z;  3MZL B;  1Q7Y 1;  2DE5 A;  3CCQ 1;  3G6E 1;  1Z02 A;  2QRC B;  1K9M 1;  3PO3 S;  2E9H A;  4E30 A;  1KQS Y;  3CC2 1;  1KC8 1;  2QLV B;  1FDI A;  1VQK Z;  2YAD A;  2W03 A;  3OW2 Z;  3I55 1;  1VQM 1;  3K7A I;  1VQN Z;  3PO3 I;  2O53 A;  2JR6 A;  3RZO I;  3CCS Z;  3CCJ 1;  3S1N I;  3IF8 A;  1VLA A;  1RLY A;  1KD1 2;  1N2F A;  1TWF I;  4DQY B;  1YUA A;  1I50 I;  1RO4 A;  1YUK A;  4MD7 A;  3TDH B;  2AKL A;  3MON A;  1X3Z A;  2LEX A;  2QR1 B;  2E2I I;  1I3Q I;  5C44 I;  5C3E I;  1VQK 1;  1VQP 1;  1R9T I;  5CM2 M;  2JA6 I;  3GTM S;  1Y8C A;  2QEX 1;  3RZD I;  1VQ7 Z;  1RO0 A;  3H0G I;  4BBR I;  3GTG I;  3F3P C;  3CCE 1;  1Q86 2;  1JWH C;  1VQL Z;  3KIF A;  1K8A 2;  3I4M I;  3LUS A;  1M90 1;  3I4N I;  3S2D I;  3D2L A;  2VF1 A;  2JIO A;  1FDO A;  4A3G I;  1Q82 1;  3TE5 B;  1M1K 1;  2KI7 B;  1KQS Z;  1KRL A;  1Q81 1;  1ZB9 A;  2KPI A;  1YJN 1;  1SFO I;  2NVY I;  1K73 1;  3CXC Y;  1TWG I;  3CD6 Z;  2IZ4 A;  2OZK A;  3J81 b;  4QTU A;  1QYP A;  2QKD A;  2RPR A;  1Y1V I;  1LQL A;  3NFZ A;  3CCJ Z;  2OOX B;  3CCS 1;  5FLX b;  2IV2 X;  1Q16 A;  3CC4 1;  1ML8 A;  5LL6 f; 
#chains in the Genus database with same CATH homology
 1NJI 2;  3BG1 B;  2PMZ A;  2QRD B;  1PFT A;  3HOY I;  4MD8 A;  3ESW A;  2E2H I;  1QF8 A;  2K5R A;  4Y52 I;  3CQZ I;  4HH4 A;  2R93 I;  3J80 f;  1K9M 2;  1USP B;  3MZK B;  1VQ8 1;  2E2J I;  5C4X I;  3GTM I;  2VUM I;  3VMI A;  2G2K A;  4RS4 A;  1W2B Z;  2HF1 A;  1YJ9 1;  1Z01 A;  3H3V J;  2GTH A;  1VQ6 Z;  4CL1 A;  3GTL I;  1YI2 Z;  4X6A I;  3HOU I;  3FQM A;  4A3F I;  1Z03 A;  4NBE A;  3CCU 1;  4A3D I;  2OTL Z;  2B63 I;  1VQL 1;  4A3B I;  1YJW 1;  3FQQ A;  4NH1 C;  3G71 Z;  4NBA A;  4AYB A;  2JA8 I;  4BY1 I;  3HKZ A;  5IT9 b;  1L1O C;  2OTJ Z;  2V8K A;  1P9N A;  1VQ8 Z;  2QA4 Z;  4A3C I;  5D1O A;  1DL6 A;  1K8A 1;  3FKI I;  3S17 I;  1M90 2;  2I3C A;  3M4O I;  1YIT 1;  4MON A;  5FLX f;  4NBH A;  2OOY B;  4NBB A;  4RVF A;  5C4J I;  3G4S 1;  1NP6 A;  3S1M I;  3T4N B;  4NB8 A;  3GTQ I;  1VQ9 Z;  1YIT Z;  1WII A;  1W2B Y;  2JA7 I;  3CCV 1;  3CCM 1;  1X3W A;  3CCR Z;  2WAQ A;  2QA4 1;  2Q51 A;  2PK7 A;  4E31 A;  3GKQ A;  1JJ2 Z;  4RVG A;  4NBC A;  4A3J I;  3GTK I;  1VQO Z;  1USP A;  1ZH1 A;  2ZAE B;  3CC7 Z;  3CMA Z;  1KD1 1;  1VQ9 1;  3U50 C;  3HOV I;  3NDJ A;  5D1O B;  3IFU A;  1KC8 2;  2PM9 A;  3CCR 1;  2J6A A;  3CMA 1;  3CCV Z;  2QRE B;  4BXX I;  3KIH A;  4BY7 I;  4A3L I;  1JJ2 Y;  2RIQ A;  3EED A;  2M48 A;  2LIY A;  4Y7N I;  3OW2 Y;  5IT9 f;  4MXU A;  4HGY A;  2NVQ I;  5D1P A;  3QWU A;  2NVX I;  2V8J A;  3CC7 1;  2QEX Z;  4NFR A;  5IP9 I;  1RNI A;  3G71 1;  3M3Y I;  3CCL Z;  2R6M A;  2JA5 I;  3I56 Z;  3PO2 I;  3IX0 A;  2RBL A;  3G4S Z;  1Y1V S;  4EWC A;  2P28 A;  4RVD A;  4XX2 A;  4HGZ A;  4E32 A;  1VQ5 Z;  1YHQ Z;  4NBD A;  5T64 A;  5AN9 F;  2H85 A;  1Y1W I;  3CPW Z;  3S1Q I;  4QTT A;  1YIJ Z;  1VQ4 1;  4NB9 A;  1RQF A;  3F3F C;  1WW9 A;  3CC2 Z;  1QVG Y;  3VB9 A;  4E2X A;  4MH4 A;  1X0T A;  1Q81 2;  1N8R 1;  2RHB A;  1YJ9 Z;  3S14 I;  3GTO I;  1YIJ 1;  5IP7 I;  1Q7Y 2;  5T67 A;  3S15 I;  2F4M A;  4A3M I;  5T6B A;  3CD6 1;  3S2H I;  3D9X A;  4A3I I;  3NH8 A;  2V8I A;  3CCM Z;  2EGT A;  2HU9 A;  2JUB A;  4NBF A;  1NUI A;  2Y0S A;  2WB1 A;  3CPW Y;  3CC4 Z;  1TFI A;  3GTJ I;  3JAM f;  1S7M A;  1VQN 1;  2F4O A;  1RO2 A;  3EER A;  3CCU Z;  3VMG A;  4BBS I;  2IZ3 A;  1NJI 1;  2OTJ 1;  3JAM b;  1VQ7 1;  4S1T A;  4RVH A;  4MRI A;  4TNU A;  1TWC I;  1VQO 1;  3GTP I;  4A3E I;  1YJW Z;  1TWH I;  5A2Q b;  1K83 I;  2JNY A;  3GCF A;  3NDI A;  2YU9 I;  3I07 A;  1YHQ 1;  3VMH A;  4RV9 A;  4E2W A;  2P3Y A;  1Q86 1;  2BJO A;  4E2Y A;  3S1R I;  2K3R A;  3P5J B;  2DE7 A;  1VQM Z;  1Q82 2;  2LFU A;  2O4H A;  1M1K 2;  2JMO A;  2GTI A;  3HOW I;  3I56 1;  1QVF Y;  3HOZ I;  3BG0 B;  3G6E Z;  3J7A 4;  1WCM I;  4MD9 A;  4A93 I;  4E33 A;  1YJN Z;  3I55 Z;  3NH4 A;  2W04 A;  1VQ4 Z;  3S16 I;  4NBG A;  2RT9 A;  3D6W A;  4E2Z A;  1QVG Z;  1K73 2;  2OTL 1;  3J80 b;  2Q4Z A;  3VTN A;  1VQP Z;  2R7Z I;  1S72 1;  1TWA I;  5FLM I;  1VQ5 1;  2DE6 A;  5A2Q f;  3Q87 A;  2GU2 A;  3NH5 A;  4DGL A;  3CCE Z;  1ZB8 A;  1I6H I;  3CME Z;  1QVF Z;  3J81 f;  2R92 I;  1S72 Z;  2VUG A;  2M6N A;  4A3K I;  1YI2 1;  3CXC Z;  2NVT I;  1VQ6 1;  4NOZ A;  2JS4 A;  3HOX I;  4DK1 A;  3CME 1;  3CCL 1;  1N8R 2;  3CCQ Z;  3MZL B;  1Q7Y 1;  2DE5 A;  3CCQ 1;  3G6E 1;  1Z02 A;  2QRC B;  1K9M 1;  3PO3 S;  2E9H A;  4E30 A;  1KQS Y;  3CC2 1;  1KC8 1;  2QLV B;  1VQK Z;  2YAD A;  2W03 A;  3OW2 Z;  3I55 1;  1VQM 1;  3K7A I;  1VQN Z;  3PO3 I;  2O53 A;  2JR6 A;  3RZO I;  3CCS Z;  3CCJ 1;  3S1N I;  3IF8 A;  1VLA A;  1RLY A;  1KD1 2;  1N2F A;  1TWF I;  4DQY B;  1YUA A;  1I50 I;  1RO4 A;  1YUK A;  4MD7 A;  3TDH B;  2AKL A;  3MON A;  1X3Z A;  2QR1 B;  2E2I I;  1I3Q I;  5C44 I;  5C3E I;  1VQK 1;  1VQP 1;  1R9T I;  5CM2 M;  2JA6 I;  3GTM S;  2QEX 1;  3RZD I;  1VQ7 Z;  1RO0 A;  3H0G I;  4BBR I;  3GTG I;  3F3P C;  3CCE 1;  1Q86 2;  1JWH C;  1VQL Z;  3KIF A;  1K8A 2;  3I4M I;  3LUS A;  1M90 1;  3I4N I;  3S2D I;  2VF1 A;  4A3G I;  1Q82 1;  3TE5 B;  1M1K 1;  2KI7 B;  1KQS Z;  1KRL A;  1Q81 1;  1ZB9 A;  2KPI A;  1YJN 1;  1SFO I;  2NVY I;  1K73 1;  3CXC Y;  1TWG I;  3CD6 Z;  2IZ4 A;  2OZK A;  3J81 b;  4QTU A;  1QYP A;  2QKD A;  2RPR A;  1Y1V I;  1LQL A;  3NFZ A;  3CCJ Z;  2OOX B;  3CCS 1;  5FLX b;  3CC4 1;  1ML8 A;  5LL6 f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...