2JA8I

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja8I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja8I02
4A3II 3S1NI 2NVXI 3GTOI 2KPIA 4A3FI 2F4OA 4XX2A 4Y52I 1Y1WI 1N2FA 2F4MA 1TWHI 2R92I 3H3VJ 3Q87A 3HOXI 4A3KI 4QTTA 4BY7I 3PO3I 2JA7I 2HF1A 3EERA 4NBFA 3HOZI 3D6WA 3S1RI 3PO2I 1RO4A 3GTJI 3H0GI 5IP9I 3I07A 3VB9A 5C3EI 3S15I 1WW9A 2R93I 4NBHA 1VLAA 4NBAA 5C4XI 2NVYI 3S2DI 3ESWA 2JA5I 3RZDI 3I4MI 5FLMI 2JNYA 4A93I 4NBCA 4BBSI 4A3MI 1X3ZA 3HOWI 4NB9A 3LUSA 3CQZI 4NB8A 3GTGI 3GTKI 2NVTI 3S16I 1USPA 1NUIA 3GTMI 1Y1VI 3HOVI 3U50C 3RZOI 3GCFA 3S17I 1TFIA 4NBDA 2DE7A 3GTPI 1LQLA 2JR6A 1X3WA 3GTQI 2DE5A 4X6AI 1RLYA 2JA6I 2JA8I 3VMHA 4A3BI 4NBBA 5CM2M 4NOZA 1I3QI 1I6HI 4A3JI 3PO3S 1ZB9A 1YUAA 3S14I 1SFOI 1ML8A 1QYPA 3M3YI 1USPB 1L1OC 2BJOA 4A3DI 3GTLI 4A3GI 3GKQA 2K5RA 2E2JI 5IP7I 4NBGA 3VMGA 1DL6A 1TWAI 4BBRI 4NBEA 2JS4A 5C44I 3HOUI 3S1QI 4A3CI 3K7AI 1PFTA 4A3LI 1TWFI 5C4JI 4A3EI 1I50I 2P3YA 2YU9I 2DE6A 3M4OI 2E2II 2RBLA 2PK7A 4BY1I 4Y7NI 1WCMI 3VMIA 2AKLA 1TWCI 3S1MI 2J6AA 1ZB8A 3GTMS 1Y1VS 3FKII 1TWGI 3HOYI 2B63I 2VUMI 3S2HI 4MH4A 1R9TI 3I4NI 2E2HI 4QTUA 1K83I 4BXXI 2R7ZI 2NVQI
chains in the Genus database with same CATH superfamily
5D1PA 2KPIA 2F4OA 3CPWZ 1YHQ1 4XX2A 1Q861 1VQ6Z 2JIRA 1Z01A 3PO3I 1QF8A 2I3CA 2JMOA 3PO2I 1VQK1 4TNUA 1VQ81 2JIOA 2QREB 2R93I 4NBHA 1VLAA 4AYBA 2V3VA 1FDIA 3NDIA 1S721 3CMAZ 2JNYA 4MRIA 3CCJ1 4MD8A 4E2YA 3GTMI 1Y1VI 1M901 3IR7A 1NJI2 4RS4A 1VQ4Z 2VPWA 3P5JB 3CXCZ 3CC2Z 2QLVB 1QVFY 3GTQI 2V45A 3F3PC 2DE5A 1YHQZ 1Q822 5IT9b 2M48A 1M902 1YJ91 5CM2M 1VQN1 3NH5A 2V8JA 5IT9f 1S7MA 1ZB9A 3CCL1 1VQKZ 3M3YI 2VPYA 1WZNA 3GTLI 1K9M2 3J7A4 1RO0A 5IP7I 1KQSY 1YIJ1 4NBGA 3CCMZ 2QEXZ 3NH8A 4BBRI 1S72Z 4MXUA 1Y8CA 5C44I 3HOUI 1VQM1 5T67A 2P28A 4A3CI 3CCJZ 3G4SZ 3M4OI 4BY1I 1Z02A 1Q811 4EWCA 3VMIA 2AKLA 3HKZA 1TWCI 1ZB8A 2VUMI 2B63I 4E30A 4MH4A 3I4NI 2RIQA 1QVGY 2R7ZI 1VQNZ 4RVFA 3S1NI 2Y0SA 2OOYB 1VQOZ 1YITZ 3CCLZ 2F4MA 1VQ91 2R92I 4QTTA 2QKDA 2V8KA 1YJWZ 3CCRZ 2HF1A 2JA7I 4BY7I 3OW2Y 1YIJZ 3CCEZ 1VQ71 1RO4A 3I07A 1WW9A 2G2KA 4NBAA 2NVYI 5D1OB 1YI21 3CCU1 5FLMI 4NBCA 3IFUA 3CCQ1 1N8R2 3CPWY 1K732 3KIHA 1Q7Y1 3LUSA 2RHBA 3GTKI 2IZ3A 3S16I 3CME1 1USPA 1NUIA 3HOVI 2QRCB 3S17I 2NAPA 4NBDA 2JIPA 1Q862 3GTPI 1NP6A 4X6AI 1RLYA 1VQ9Z 2LIYA 2JA8I 3VMHA 1VQ5Z 3CC7Z 3CC41 1KD11 1I6HI 4A3JI 1KC81 2WAQA 1VQ7Z 4RVHA 3S14I 1QYPA 2IV2X 2RT9A 4RVDA 5T6BA 4A3DI 3G6E1 2OOXB 2E2JI 3CXCY 3MZLB 3I56Z 1YI2Z 3CCUZ 2Q4ZA 1VQL1 3G711 3CCQZ 1WJ2A 1PFTA 4A3LI 5C4JI 4A3EI 1I50I 5FLXb 2P3YA 4RV9A 3CD61 4NFRA 3CMEZ 2RBLA 2PK7A 2OTL1 2VPZA 3JAMb 5FLXf 2QR1B 2HU9A 1VQP1 3FKII 2RPRA 1VQ8Z 2O53A 4RVGA 3JAMf 4HGZA 2LEXA 1W2BZ 2NVQI 4A3II 1JWHC 2KI7B 1YUKA 2LFUA 3GTOI 4A3FI 1Z03A 4Y52I 1Y1WI 4MD9A 3H3VJ 3HOXI 3G6EZ 2PM9A 3EERA 2JIQA 4NBFA 1YJN1 1AA6A 4E33A 3S1RI 2E7ZA 3H0GI 5IP9I 2ZAEB 5C3EI 3S15I 2AYDA 3CD6Z 5C4XI 1Q812 1YJ9Z 2OTJ1 3CCV1 4A3MI 3HOWI 1RO2A 3CQZI 4NB8A 3GTGI 2NVTI 2VUGA 5AN9F 3NH4A 2QA41 1TFIA 2VPXA 2DE7A 3TDHB 1VQMZ 3CCS1 1LQLA 1X3WA 1K8A1 3D9XA 4E2ZA 4HGYA 3MONA 2GTHA 2WB1A 3NDJA 1YUAA 1ML8A 3VTNA 1L1OC 2BJOA 3GKQA 2OTJZ 2JS4A 3CCVZ 1M1K1 1Q7Y2 3S1QI 3CC21 3KIFA 3I551 2OZKA 2YU9I 4MD7A 4Y7NI 1WCMI 4HH4A 2QA4Z 3IX0A 3J81b 3NFZA 3S1MI 1M1K2 3CCSZ 1TWGI 3HOYI 2PMZA 3J81f 2E2HI 4QTUA 1NJI1 2VF1A 2K3RA 1KD12 3CCM1 3BG0B 5D1OA 2IZ4A 2QEX1 1KC82 3T4NB 2NVXI 3IF8A 4E31A 2GTIA 1N2FA 1TWHI 2EGTA 3Q87A 4A3KI 1Q821 3G4S1 2JIMA 3HOZI 3D6WA 4S1TA 2R6MA 3GTJI 2W03A 3F3FC 1QVFZ 3VB9A 3I55Z 4DQYB 1K9M1 3S2DI 3CC4Z 3ESWA 2JA5I 2O4HA 3RZDI 1W2BY 3I4MI 4MONA 3J80b 1P9NA 4A93I 4BBSI 3TE5B 1X3ZA 4NB9A 1VQO1 1YIT1 5A2Qb 3J80f 3RZOI 3U50C 2W04A 3CCR1 3GCFA 1YJW1 1ZH1A 5LL6f 3EEDA 1KQSZ 5A2Qf 1Q16A 1VQLZ 1FDOA 3CCE1 3G71Z 2Q51A 1X0TA 2JR6A 2JA6I 4A3BI 4E2WA 2OTLZ 4NBBA 3FQMA 4NOZA 1I3QI 5T64A 1VQPZ 3PO3S 1SFOI 1VQ61 1USPB 1KRLA 4A3GI 3FQQA 3D2LA 2K5RA 2QRDB 1QVGZ 1DL6A 3VMGA 1RQFA 1TWAI 4NBEA 4E2XA 3K7AI 1WIIA 1TWFI 1JJ2Z 2H85A 1JJ2Y 2DE6A 3MZKB 2E2II 2V8IA 1VQ51 1QXFA 4NH1C 3CC71 2YADA 3OW2Z 1YJNZ 3CMA1 2M6NA 2E9HA 2J6AA 1N8R1 1Y1VS 1K8A2 3GTMS 1K731 4DK1A 3S2HI 1R9TI 3BG1B 4CL1A 4E32A 1RNIA 3QWUA 1VQ41 2GU2A 1SIWA 1K83I 4DGLA 3I561 2JUBA 4BXXI
chains in the Genus database with same CATH topology
5D1PA 2KPIA 2F4OA 3CPWZ 1YHQ1 4XX2A 1Q861 1VQ6Z 1Z01A 3PO3I 1QF8A 2I3CA 2JMOA 3PO2I 1VQK1 4TNUA 1VQ81 2R93I 2QREB 4NBHA 1VLAA 4AYBA 3NDIA 1S721 3CMAZ 2JNYA 4MRIA 3CCJ1 4MD8A 4E2YA 3GTMI 1Y1VI 1M901 1NJI2 4RS4A 1VQ4Z 3P5JB 3CXCZ 3CC2Z 2QLVB 1QVFY 3GTQI 3F3PC 2DE5A 1YHQZ 1Q822 5IT9b 2M48A 1M902 1YJ91 5CM2M 1VQN1 3NH5A 2V8JA 5IT9f 1S7MA 1ZB9A 3CCL1 1VQKZ 3M3YI 3GTLI 1K9M2 3J7A4 1RO0A 5IP7I 1KQSY 1YIJ1 4NBGA 3CCMZ 2QEXZ 3NH8A 4BBRI 1S72Z 4MXUA 5C44I 3HOUI 1VQM1 5T67A 2P28A 4A3CI 3CCJZ 3G4SZ 3M4OI 4BY1I 1Z02A 1Q811 4EWCA 3VMIA 2AKLA 3HKZA 1TWCI 1ZB8A 2VUMI 2B63I 4E30A 4MH4A 3I4NI 2RIQA 1QVGY 2R7ZI 1VQNZ 4RVFA 3S1NI 2Y0SA 2OOYB 1VQOZ 1YITZ 3CCLZ 2F4MA 1VQ91 2R92I 4QTTA 2QKDA 2V8KA 1YJWZ 3CCRZ 2HF1A 2JA7I 4BY7I 3OW2Y 1YIJZ 3CCEZ 1VQ71 1RO4A 3I07A 1WW9A 2G2KA 4NBAA 2NVYI 5D1OB 1YI21 3CCU1 5FLMI 4NBCA 3IFUA 3CCQ1 1N8R2 3CPWY 1K732 3KIHA 1Q7Y1 3LUSA 2RHBA 3GTKI 2IZ3A 3S16I 3CME1 1USPA 1NUIA 3HOVI 2QRCB 3S17I 4NBDA 1Q862 3GTPI 1NP6A 4X6AI 1RLYA 1VQ9Z 2LIYA 2JA8I 3VMHA 1VQ5Z 3CC7Z 3CC41 1KD11 1I6HI 4A3JI 1KC81 2WAQA 1VQ7Z 4RVHA 3S14I 1QYPA 2RT9A 4RVDA 5T6BA 4A3DI 3G6E1 2OOXB 2E2JI 3CXCY 3MZLB 3I56Z 1YI2Z 3CCUZ 2Q4ZA 1VQL1 3G711 3CCQZ 1PFTA 4A3LI 5C4JI 4A3EI 1I50I 5FLXb 2P3YA 4RV9A 3CD61 4NFRA 3CMEZ 2RBLA 2PK7A 2OTL1 3JAMb 5FLXf 2QR1B 2HU9A 1VQP1 3FKII 2RPRA 1VQ8Z 2O53A 4RVGA 3JAMf 4HGZA 1W2BZ 2NVQI 4A3II 1JWHC 2KI7B 1YUKA 2LFUA 3GTOI 4A3FI 1Z03A 4Y52I 1Y1WI 4MD9A 3H3VJ 3HOXI 3G6EZ 2PM9A 3EERA 4NBFA 1YJN1 4E33A 3S1RI 3H0GI 5IP9I 2ZAEB 5C3EI 3S15I 3CD6Z 5C4XI 1Q812 1YJ9Z 2OTJ1 3CCV1 4A3MI 3HOWI 1RO2A 3CQZI 4NB8A 3GTGI 2NVTI 2VUGA 5AN9F 3NH4A 2QA41 1TFIA 2DE7A 3TDHB 1VQMZ 3CCS1 1LQLA 1X3WA 1K8A1 3D9XA 4E2ZA 4HGYA 3MONA 2GTHA 2WB1A 3NDJA 1YUAA 1ML8A 3VTNA 1L1OC 2BJOA 3GKQA 2OTJZ 2JS4A 3CCVZ 1M1K1 1Q7Y2 3S1QI 3CC21 3KIFA 3I551 2OZKA 2YU9I 4MD7A 4Y7NI 1WCMI 4HH4A 2QA4Z 3IX0A 3J81b 3NFZA 3S1MI 1M1K2 3CCSZ 1TWGI 3HOYI 2PMZA 3J81f 2E2HI 4QTUA 1NJI1 2VF1A 2K3RA 1KD12 3CCM1 3BG0B 5D1OA 2IZ4A 2QEX1 1KC82 3T4NB 2NVXI 3IF8A 4E31A 2GTIA 1N2FA 1TWHI 2EGTA 3Q87A 4A3KI 1Q821 3G4S1 3HOZI 3D6WA 4S1TA 2R6MA 3GTJI 2W03A 3F3FC 1QVFZ 3VB9A 3I55Z 4DQYB 1K9M1 3S2DI 3CC4Z 3ESWA 2JA5I 2O4HA 3RZDI 1W2BY 3I4MI 4MONA 3J80b 1P9NA 4A93I 4BBSI 3TE5B 1X3ZA 4NB9A 1VQO1 1YIT1 5A2Qb 3J80f 3RZOI 3U50C 2W04A 3CCR1 3GCFA 1YJW1 1ZH1A 5LL6f 3EEDA 1KQSZ 5A2Qf 1VQLZ 3CCE1 3G71Z 2Q51A 1X0TA 2JR6A 2JA6I 4A3BI 4E2WA 2OTLZ 4NBBA 3FQMA 4NOZA 1I3QI 5T64A 1VQPZ 3PO3S 1SFOI 1VQ61 1USPB 1KRLA 4A3GI 3FQQA 2K5RA 2QRDB 1QVGZ 1DL6A 3VMGA 1RQFA 1TWAI 4NBEA 4E2XA 3K7AI 1WIIA 1TWFI 1JJ2Z 2H85A 1JJ2Y 2DE6A 3MZKB 2E2II 2V8IA 1VQ51 4NH1C 3CC71 3OW2Z 2YADA 1YJNZ 3CMA1 2M6NA 2E9HA 2J6AA 1N8R1 1Y1VS 1K8A2 3GTMS 1K731 4DK1A 3S2HI 1R9TI 3BG1B 4CL1A 4E32A 1RNIA 3QWUA 1VQ41 2GU2A 1K83I 4DGLA 3I561 2JUBA 4BXXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I I;  3S1N I;  2NVX I;  3GTO I;  2KPI A;  4A3F I;  2F4O A;  4XX2 A;  4Y52 I;  1Y1W I;  1N2F A;  2F4M A;  1TWH I;  2R92 I;  3H3V J;  3Q87 A;  3HOX I;  4A3K I;  4QTT A;  4BY7 I;  3PO3 I;  2JA7 I;  2HF1 A;  3EER A;  4NBF A;  3HOZ I;  3D6W A;  3S1R I;  3PO2 I;  1RO4 A;  3GTJ I;  3H0G I;  5IP9 I;  3I07 A;  3VB9 A;  5C3E I;  3S15 I;  1WW9 A;  2R93 I;  4NBH A;  1VLA A;  4NBA A;  5C4X I;  2NVY I;  3S2D I;  3ESW A;  2JA5 I;  3RZD I;  3I4M I;  5FLM I;  2JNY A;  4A93 I;  4NBC A;  4BBS I;  4A3M I;  1X3Z A;  3HOW I;  4NB9 A;  3LUS A;  3CQZ I;  4NB8 A;  3GTG I;  3GTK I;  2NVT I;  3S16 I;  1USP A;  1NUI A;  3GTM I;  1Y1V I;  3HOV I;  3U50 C;  3RZO I;  3GCF A;  3S17 I;  1TFI A;  4NBD A;  2DE7 A;  3GTP I;  1LQL A;  2JR6 A;  1X3W A;  3GTQ I;  2DE5 A;  4X6A I;  1RLY A;  2JA6 I;  2JA8 I;  3VMH A;  4A3B I;  4NBB A;  5CM2 M;  4NOZ A;  1I3Q I;  1I6H I;  4A3J I;  3PO3 S;  1ZB9 A;  1YUA A;  3S14 I;  1SFO I;  1ML8 A;  1QYP A;  3M3Y I;  1USP B;  1L1O C;  2BJO A;  4A3D I;  3GTL I;  4A3G I;  3GKQ A;  2K5R A;  2E2J I;  5IP7 I;  4NBG A;  3VMG A;  1DL6 A;  1TWA I;  4BBR I;  4NBE A;  2JS4 A;  5C44 I;  3HOU I;  3S1Q I;  4A3C I;  3K7A I;  1PFT A;  4A3L I;  1TWF I;  5C4J I;  4A3E I;  1I50 I;  2P3Y A;  2YU9 I;  2DE6 A;  3M4O I;  2E2I I;  2RBL A;  2PK7 A;  4BY1 I;  4Y7N I;  1WCM I;  3VMI A;  2AKL A;  1TWC I;  3S1M I;  2J6A A;  1ZB8 A;  3GTM S;  1Y1V S;  3FKI I;  1TWG I;  3HOY I;  2B63 I;  2VUM I;  3S2H I;  4MH4 A;  1R9T I;  3I4N I;  2E2H I;  4QTU A;  1K83 I;  4BXX I;  2R7Z I;  2NVQ I; 
#chains in the Genus database with same CATH topology
 5D1P A;  2KPI A;  2F4O A;  3CPW Z;  1YHQ 1;  4XX2 A;  1Q86 1;  1VQ6 Z;  2JIR A;  1Z01 A;  3PO3 I;  1QF8 A;  2I3C A;  2JMO A;  3PO2 I;  1VQK 1;  4TNU A;  1VQ8 1;  2JIO A;  2QRE B;  2R93 I;  4NBH A;  1VLA A;  4AYB A;  2V3V A;  1FDI A;  3NDI A;  1S72 1;  3CMA Z;  2JNY A;  4MRI A;  3CCJ 1;  4MD8 A;  4E2Y A;  3GTM I;  1Y1V I;  1M90 1;  3IR7 A;  1NJI 2;  4RS4 A;  1VQ4 Z;  2VPW A;  3P5J B;  3CXC Z;  3CC2 Z;  2QLV B;  1QVF Y;  3GTQ I;  2V45 A;  3F3P C;  2DE5 A;  1YHQ Z;  1Q82 2;  5IT9 b;  2M48 A;  1M90 2;  1YJ9 1;  5CM2 M;  1VQN 1;  3NH5 A;  2V8J A;  5IT9 f;  1S7M A;  1ZB9 A;  3CCL 1;  1VQK Z;  3M3Y I;  2VPY A;  1WZN A;  3GTL I;  1K9M 2;  3J7A 4;  1RO0 A;  5IP7 I;  1KQS Y;  1YIJ 1;  4NBG A;  3CCM Z;  2QEX Z;  3NH8 A;  4BBR I;  1S72 Z;  4MXU A;  1Y8C A;  5C44 I;  3HOU I;  1VQM 1;  5T67 A;  2P28 A;  4A3C I;  3CCJ Z;  3G4S Z;  3M4O I;  4BY1 I;  1Z02 A;  1Q81 1;  4EWC A;  3VMI A;  2AKL A;  3HKZ A;  1TWC I;  1ZB8 A;  2VUM I;  2B63 I;  4E30 A;  4MH4 A;  3I4N I;  2RIQ A;  1QVG Y;  2R7Z I;  1VQN Z;  4RVF A;  3S1N I;  2Y0S A;  2OOY B;  1VQO Z;  1YIT Z;  3CCL Z;  2F4M A;  1VQ9 1;  2R92 I;  4QTT A;  2QKD A;  2V8K A;  1YJW Z;  3CCR Z;  2HF1 A;  2JA7 I;  4BY7 I;  3OW2 Y;  1YIJ Z;  3CCE Z;  1VQ7 1;  1RO4 A;  3I07 A;  1WW9 A;  2G2K A;  4NBA A;  2NVY I;  5D1O B;  1YI2 1;  3CCU 1;  5FLM I;  4NBC A;  3IFU A;  3CCQ 1;  1N8R 2;  3CPW Y;  1K73 2;  3KIH A;  1Q7Y 1;  3LUS A;  2RHB A;  3GTK I;  2IZ3 A;  3S16 I;  3CME 1;  1USP A;  1NUI A;  3HOV I;  2QRC B;  3S17 I;  2NAP A;  4NBD A;  2JIP A;  1Q86 2;  3GTP I;  1NP6 A;  4X6A I;  1RLY A;  1VQ9 Z;  2LIY A;  2JA8 I;  3VMH A;  1VQ5 Z;  3CC7 Z;  3CC4 1;  1KD1 1;  1I6H I;  4A3J I;  1KC8 1;  2WAQ A;  1VQ7 Z;  4RVH A;  3S14 I;  1QYP A;  2IV2 X;  2RT9 A;  4RVD A;  5T6B A;  4A3D I;  3G6E 1;  2OOX B;  2E2J I;  3CXC Y;  3MZL B;  3I56 Z;  1YI2 Z;  3CCU Z;  2Q4Z A;  1VQL 1;  3G71 1;  3CCQ Z;  1WJ2 A;  1PFT A;  4A3L I;  5C4J I;  4A3E I;  1I50 I;  5FLX b;  2P3Y A;  4RV9 A;  3CD6 1;  4NFR A;  3CME Z;  2RBL A;  2PK7 A;  2OTL 1;  2VPZ A;  3JAM b;  5FLX f;  2QR1 B;  2HU9 A;  1VQP 1;  3FKI I;  2RPR A;  1VQ8 Z;  2O53 A;  4RVG A;  3JAM f;  4HGZ A;  2LEX A;  1W2B Z;  2NVQ I;  4A3I I;  1JWH C;  2KI7 B;  1YUK A;  2LFU A;  3GTO I;  4A3F I;  1Z03 A;  4Y52 I;  1Y1W I;  4MD9 A;  3H3V J;  3HOX I;  3G6E Z;  2PM9 A;  3EER A;  2JIQ A;  4NBF A;  1YJN 1;  1AA6 A;  4E33 A;  3S1R I;  2E7Z A;  3H0G I;  5IP9 I;  2ZAE B;  5C3E I;  3S15 I;  2AYD A;  3CD6 Z;  5C4X I;  1Q81 2;  1YJ9 Z;  2OTJ 1;  3CCV 1;  4A3M I;  3HOW I;  1RO2 A;  3CQZ I;  4NB8 A;  3GTG I;  2NVT I;  2VUG A;  5AN9 F;  3NH4 A;  2QA4 1;  1TFI A;  2VPX A;  2DE7 A;  3TDH B;  1VQM Z;  3CCS 1;  1LQL A;  1X3W A;  1K8A 1;  3D9X A;  4E2Z A;  4HGY A;  3MON A;  2GTH A;  2WB1 A;  3NDJ A;  1YUA A;  1ML8 A;  3VTN A;  1L1O C;  2BJO A;  3GKQ A;  2OTJ Z;  2JS4 A;  3CCV Z;  1M1K 1;  1Q7Y 2;  3S1Q I;  3CC2 1;  3KIF A;  3I55 1;  2OZK A;  2YU9 I;  4MD7 A;  4Y7N I;  1WCM I;  4HH4 A;  2QA4 Z;  3IX0 A;  3J81 b;  3NFZ A;  3S1M I;  1M1K 2;  3CCS Z;  1TWG I;  3HOY I;  2PMZ A;  3J81 f;  2E2H I;  4QTU A;  1NJI 1;  2VF1 A;  2K3R A;  1KD1 2;  3CCM 1;  3BG0 B;  5D1O A;  2IZ4 A;  2QEX 1;  1KC8 2;  3T4N B;  2NVX I;  3IF8 A;  4E31 A;  2GTI A;  1N2F A;  1TWH I;  2EGT A;  3Q87 A;  4A3K I;  1Q82 1;  3G4S 1;  2JIM A;  3HOZ I;  3D6W A;  4S1T A;  2R6M A;  3GTJ I;  2W03 A;  3F3F C;  1QVF Z;  3VB9 A;  3I55 Z;  4DQY B;  1K9M 1;  3S2D I;  3CC4 Z;  3ESW A;  2JA5 I;  2O4H A;  3RZD I;  1W2B Y;  3I4M I;  4MON A;  3J80 b;  1P9N A;  4A93 I;  4BBS I;  3TE5 B;  1X3Z A;  4NB9 A;  1VQO 1;  1YIT 1;  5A2Q b;  3J80 f;  3RZO I;  3U50 C;  2W04 A;  3CCR 1;  3GCF A;  1YJW 1;  1ZH1 A;  5LL6 f;  3EED A;  1KQS Z;  5A2Q f;  1Q16 A;  1VQL Z;  1FDO A;  3CCE 1;  3G71 Z;  2Q51 A;  1X0T A;  2JR6 A;  2JA6 I;  4A3B I;  4E2W A;  2OTL Z;  4NBB A;  3FQM A;  4NOZ A;  1I3Q I;  5T64 A;  1VQP Z;  3PO3 S;  1SFO I;  1VQ6 1;  1USP B;  1KRL A;  4A3G I;  3FQQ A;  3D2L A;  2K5R A;  2QRD B;  1QVG Z;  1DL6 A;  3VMG A;  1RQF A;  1TWA I;  4NBE A;  4E2X A;  3K7A I;  1WII A;  1TWF I;  1JJ2 Z;  2H85 A;  1JJ2 Y;  2DE6 A;  3MZK B;  2E2I I;  2V8I A;  1VQ5 1;  1QXF A;  4NH1 C;  3CC7 1;  2YAD A;  3OW2 Z;  1YJN Z;  3CMA 1;  2M6N A;  2E9H A;  2J6A A;  1N8R 1;  1Y1V S;  1K8A 2;  3GTM S;  1K73 1;  4DK1 A;  3S2H I;  1R9T I;  3BG1 B;  4CL1 A;  4E32 A;  1RNI A;  3QWU A;  1VQ4 1;  2GU2 A;  1SIW A;  1K83 I;  4DGL A;  3I56 1;  2JUB A;  4BXX I; 
#chains in the Genus database with same CATH homology
 5D1P A;  2KPI A;  2F4O A;  3CPW Z;  1YHQ 1;  4XX2 A;  1Q86 1;  1VQ6 Z;  1Z01 A;  3PO3 I;  1QF8 A;  2I3C A;  2JMO A;  3PO2 I;  1VQK 1;  4TNU A;  1VQ8 1;  2R93 I;  2QRE B;  4NBH A;  1VLA A;  4AYB A;  3NDI A;  1S72 1;  3CMA Z;  2JNY A;  4MRI A;  3CCJ 1;  4MD8 A;  4E2Y A;  3GTM I;  1Y1V I;  1M90 1;  1NJI 2;  4RS4 A;  1VQ4 Z;  3P5J B;  3CXC Z;  3CC2 Z;  2QLV B;  1QVF Y;  3GTQ I;  3F3P C;  2DE5 A;  1YHQ Z;  1Q82 2;  5IT9 b;  2M48 A;  1M90 2;  1YJ9 1;  5CM2 M;  1VQN 1;  3NH5 A;  2V8J A;  5IT9 f;  1S7M A;  1ZB9 A;  3CCL 1;  1VQK Z;  3M3Y I;  3GTL I;  1K9M 2;  3J7A 4;  1RO0 A;  5IP7 I;  1KQS Y;  1YIJ 1;  4NBG A;  3CCM Z;  2QEX Z;  3NH8 A;  4BBR I;  1S72 Z;  4MXU A;  5C44 I;  3HOU I;  1VQM 1;  5T67 A;  2P28 A;  4A3C I;  3CCJ Z;  3G4S Z;  3M4O I;  4BY1 I;  1Z02 A;  1Q81 1;  4EWC A;  3VMI A;  2AKL A;  3HKZ A;  1TWC I;  1ZB8 A;  2VUM I;  2B63 I;  4E30 A;  4MH4 A;  3I4N I;  2RIQ A;  1QVG Y;  2R7Z I;  1VQN Z;  4RVF A;  3S1N I;  2Y0S A;  2OOY B;  1VQO Z;  1YIT Z;  3CCL Z;  2F4M A;  1VQ9 1;  2R92 I;  4QTT A;  2QKD A;  2V8K A;  1YJW Z;  3CCR Z;  2HF1 A;  2JA7 I;  4BY7 I;  3OW2 Y;  1YIJ Z;  3CCE Z;  1VQ7 1;  1RO4 A;  3I07 A;  1WW9 A;  2G2K A;  4NBA A;  2NVY I;  5D1O B;  1YI2 1;  3CCU 1;  5FLM I;  4NBC A;  3IFU A;  3CCQ 1;  1N8R 2;  3CPW Y;  1K73 2;  3KIH A;  1Q7Y 1;  3LUS A;  2RHB A;  3GTK I;  2IZ3 A;  3S16 I;  3CME 1;  1USP A;  1NUI A;  3HOV I;  2QRC B;  3S17 I;  4NBD A;  1Q86 2;  3GTP I;  1NP6 A;  4X6A I;  1RLY A;  1VQ9 Z;  2LIY A;  2JA8 I;  3VMH A;  1VQ5 Z;  3CC7 Z;  3CC4 1;  1KD1 1;  1I6H I;  4A3J I;  1KC8 1;  2WAQ A;  1VQ7 Z;  4RVH A;  3S14 I;  1QYP A;  2RT9 A;  4RVD A;  5T6B A;  4A3D I;  3G6E 1;  2OOX B;  2E2J I;  3CXC Y;  3MZL B;  3I56 Z;  1YI2 Z;  3CCU Z;  2Q4Z A;  1VQL 1;  3G71 1;  3CCQ Z;  1PFT A;  4A3L I;  5C4J I;  4A3E I;  1I50 I;  5FLX b;  2P3Y A;  4RV9 A;  3CD6 1;  4NFR A;  3CME Z;  2RBL A;  2PK7 A;  2OTL 1;  3JAM b;  5FLX f;  2QR1 B;  2HU9 A;  1VQP 1;  3FKI I;  2RPR A;  1VQ8 Z;  2O53 A;  4RVG A;  3JAM f;  4HGZ A;  1W2B Z;  2NVQ I;  4A3I I;  1JWH C;  2KI7 B;  1YUK A;  2LFU A;  3GTO I;  4A3F I;  1Z03 A;  4Y52 I;  1Y1W I;  4MD9 A;  3H3V J;  3HOX I;  3G6E Z;  2PM9 A;  3EER A;  4NBF A;  1YJN 1;  4E33 A;  3S1R I;  3H0G I;  5IP9 I;  2ZAE B;  5C3E I;  3S15 I;  3CD6 Z;  5C4X I;  1Q81 2;  1YJ9 Z;  2OTJ 1;  3CCV 1;  4A3M I;  3HOW I;  1RO2 A;  3CQZ I;  4NB8 A;  3GTG I;  2NVT I;  2VUG A;  5AN9 F;  3NH4 A;  2QA4 1;  1TFI A;  2DE7 A;  3TDH B;  1VQM Z;  3CCS 1;  1LQL A;  1X3W A;  1K8A 1;  3D9X A;  4E2Z A;  4HGY A;  3MON A;  2GTH A;  2WB1 A;  3NDJ A;  1YUA A;  1ML8 A;  3VTN A;  1L1O C;  2BJO A;  3GKQ A;  2OTJ Z;  2JS4 A;  3CCV Z;  1M1K 1;  1Q7Y 2;  3S1Q I;  3CC2 1;  3KIF A;  3I55 1;  2OZK A;  2YU9 I;  4MD7 A;  4Y7N I;  1WCM I;  4HH4 A;  2QA4 Z;  3IX0 A;  3J81 b;  3NFZ A;  3S1M I;  1M1K 2;  3CCS Z;  1TWG I;  3HOY I;  2PMZ A;  3J81 f;  2E2H I;  4QTU A;  1NJI 1;  2VF1 A;  2K3R A;  1KD1 2;  3CCM 1;  3BG0 B;  5D1O A;  2IZ4 A;  2QEX 1;  1KC8 2;  3T4N B;  2NVX I;  3IF8 A;  4E31 A;  2GTI A;  1N2F A;  1TWH I;  2EGT A;  3Q87 A;  4A3K I;  1Q82 1;  3G4S 1;  3HOZ I;  3D6W A;  4S1T A;  2R6M A;  3GTJ I;  2W03 A;  3F3F C;  1QVF Z;  3VB9 A;  3I55 Z;  4DQY B;  1K9M 1;  3S2D I;  3CC4 Z;  3ESW A;  2JA5 I;  2O4H A;  3RZD I;  1W2B Y;  3I4M I;  4MON A;  3J80 b;  1P9N A;  4A93 I;  4BBS I;  3TE5 B;  1X3Z A;  4NB9 A;  1VQO 1;  1YIT 1;  5A2Q b;  3J80 f;  3RZO I;  3U50 C;  2W04 A;  3CCR 1;  3GCF A;  1YJW 1;  1ZH1 A;  5LL6 f;  3EED A;  1KQS Z;  5A2Q f;  1VQL Z;  3CCE 1;  3G71 Z;  2Q51 A;  1X0T A;  2JR6 A;  2JA6 I;  4A3B I;  4E2W A;  2OTL Z;  4NBB A;  3FQM A;  4NOZ A;  1I3Q I;  5T64 A;  1VQP Z;  3PO3 S;  1SFO I;  1VQ6 1;  1USP B;  1KRL A;  4A3G I;  3FQQ A;  2K5R A;  2QRD B;  1QVG Z;  1DL6 A;  3VMG A;  1RQF A;  1TWA I;  4NBE A;  4E2X A;  3K7A I;  1WII A;  1TWF I;  1JJ2 Z;  2H85 A;  1JJ2 Y;  2DE6 A;  3MZK B;  2E2I I;  2V8I A;  1VQ5 1;  4NH1 C;  3CC7 1;  3OW2 Z;  2YAD A;  1YJN Z;  3CMA 1;  2M6N A;  2E9H A;  2J6A A;  1N8R 1;  1Y1V S;  1K8A 2;  3GTM S;  1K73 1;  4DK1 A;  3S2H I;  1R9T I;  3BG1 B;  4CL1 A;  4E32 A;  1RNI A;  3QWU A;  1VQ4 1;  2GU2 A;  1K83 I;  4DGL A;  3I56 1;  2JUB A;  4BXX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...