1YHQ1

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhq100
1Q812 1YITZ 1VQK1 1YJ9Z 1YJWZ 1KQSY 1YJNZ 1W2BY 1Q862 1QVGY 1VQ41 1VQ9Z 1YI2Z 1KD11 3CMEZ 1M901 1QVFY 3G711 1VQN1 1VQMZ 1VQP1 3CC7Z 3I561 3CCQZ 2QEXZ 1NJI1 1VQ7Z 1K8A2 1JJ2Y 3CCJZ 3CCSZ 3CCLZ 3G4SZ 1Q7Y2 1K731 1VQOZ 1YHQ1 1S721 3CCE1 1N8R1 3CC41 1Q821 3CPWZ 3CC21 1YIJZ 1VQ6Z 1M1K1 1VQL1 3OW2Z 2QA4Z 1VQ51 3CD6Z 3CCMZ 1VQ8Z 1KC82 3CCUZ 3I551 3CCVZ 3CCR1 2OTJ1 1Q811 1YIT1 1VQKZ 3CMA1 3CPWY 1N8R2 1YJ91 1YJW1 1YJN1 1VQ4Z 1Q822 3OW2Y 3G6E1 1VQLZ 1M1K2 1VQ91 1KD12 1QVGZ 3CXCZ 1M902 3G71Z 1VQNZ 1YI21 3CME1 1VQPZ 1VQM1 3I56Z 3CCRZ 3CC71 3CCQ1 1NJI2 2OTL1 1K9M1 2QEX1 1K8A1 1VQ71 3CMAZ 3CCJ1 3CCS1 1YHQZ 1S72Z 3CCL1 1Q7Y1 1K732 3G4S1 3CCEZ 1JJ2Z 1VQO1 3CXCY 3G6EZ 3CC4Z 1Q861 3CC2Z 1KQSZ 1W2BZ 1YIJ1 1VQ61 1VQ5Z 2QA41 3I55Z 2OTLZ 1QVFZ 1KC81 3CCM1 1K9M2 3CD61 1VQ81 3CCU1 2OTJZ 3CCV1
chains in the Genus database with same CATH superfamily
5LL6f 1YITZ 3GTPI 1VQK1 1KRLA 3GCFA 4BY7I 1USPB 2I3CA 3S1MI 4E2WA 1VQ41 1JWHC 1TWAI 1YI2Z 1VQN1 1VQMZ 3TE5B 1VQP1 1FDOA 4RVDA 4Y7NI 3S1RI 3NH4A 2R7ZI 3CCJZ 2NAPA 3BG1B 4NOZA 1K731 1VQOZ 2HF1A 3CCE1 1WW9A 3GTJI 5CM2M 4NBFA 2V8KA 1Z02A 1Q821 2B63I 5IP7I 1X0TA 3CC21 2JUBA 1YIJZ 1VQ6Z 1VQL1 1WIIA 3K7AI 3OW2Z 3JAMb 3EERA 1VQ51 1QXFA 2PM9A 4A3JI 4E2YA 4A3FI 2VUGA 1TWFI 4DK1A 2AYDA 4NB9A 2QREB 1VQKZ 2RPRA 4NBBA 1N8R2 1YJ91 1YJN1 1VQ4Z 3F3PC 4RS4A 3G6E1 1M1K2 1VQ91 1TWCI 1VQNZ 3CME1 1YUKA 5C3EI 1VQPZ 3D6WA 3CCRZ 4X6AI 2VPYA 2R6MA 2OTL1 1VQ71 2Q4ZA 3CMAZ 3CCS1 4A3BI 1RQFA 3G4S1 2DE7A 3CCEZ 1JJ2Z 2NVYI 1DL6A 3CXCY 4A93I 2OOXB 4EWCA 3CC2Z 4NBGA 2RT9A 4E2ZA 2DE5A 1VQ5Z 2OZKA 1ML8A 2QA41 4MH4A 2K3RA 2M6NA 3CD61 2NVTI 5A2Qf 3CCV1 2WAQA 1RO2A 2GU2A 1Y8CA 2QRDB 1YJ9Z 1YJNZ 1TWGI 2V45A 3PO2I 3IFUA 1VQ9Z 5IP9I 1I50I 3CMEZ 4QTUA 2ZAEB 3RZOI 3IF8A 1RNIA 2WB1A 3GTMI 1VQ7Z 1JJ2Y 3CCSZ 3KIHA 3GTLI 2VPXA 3G4SZ 1Q7Y2 4A3DI 4E2XA 1WCMI 2H85A 4CL1A 2O4HA 3HOVI 2E2HI 5IT9f 3NH5A 2E2II 5AN9F 2QA4Z 4TNUA 3RZDI 3CD6Z 3CCVZ 3J80f 2GTHA 3CCR1 4HGZA 2JA8I 3CMA1 3CPWY 2KI7B 1YJW1 4RVHA 3GTQI 4DGLA 2R92I 2JA5I 3HKZA 5T67A 4E32A 3CXCZ 5FLXf 1VLAA 3I4NI 1SFOI 4MD8A 3CC71 2EGTA 1Z03A 1Y1WI 2JIMA 2QEX1 2RBLA 2VF1A 1Q7Y1 2J6AA 2JMOA 2VPWA 2P3YA 2P28A 4MD7A 3H3VJ 2E2JI 2OOYB 2JIPA 3TDHB 1Y1VI 1K9M2 1VQ81 3GTMS 1Q812 4NBHA 3NDJA 5T64A 3S16I 4A3II 3NH8A 5D1OA 2IZ3A 3J80b 1YJWZ 1KQSY 3J81f 4NH1C 1W2BY 1Q862 2HU9A 1I3QI 2E7ZA 2VPZA 2E9HA 4A3GI 2M48A 3ESWA 1TWHI 3G711 5C44I 2PK7A 3CQZI 3VMGA 3CC7Z 2PMZA 5FLXb 1R9TI 2QEXZ 2JIOA 2QLVB 4NBDA 3VTNA 2G2KA 1FDIA 3I4MI 2BJOA 3S15I 4BY1I 2JA7I 3HOXI 1USPA 1ZH1A 3H0GI 4A3EI 1S721 1L1OC 1ZB8A 1P9NA 1N8R1 3VMHA 4A3MI 3CPWZ 5C4JI 2JIRA 1M1K1 2QR1B 1Q16A 2RIQA 5T6BA 3T4NB 4NBCA 3HOYI 4NBEA 1VQ8Z 1KC82 1RLYA 3FQQA 2K5RA 4E33A 1Q811 3IX0A 3VMIA 3M4OI 3S2DI 5D1OB 3F3FC 1YUAA 2NVXI 1Q822 4MRIA 2YU9I 2DE6A 2QRCB 1KD12 3S1QI 3Q87A 1QVGZ 3J81b 1M902 2IV2X 3G71Z 4QTTA 2AKLA 3GKQA 3KIFA 4E30A 3GTGI 1Y1VS 2V8JA 3CCQ1 4MONA 3S14I 1NJI2 1RO4A 3IR7A 1PFTA 1S7MA 3MONA 3MZKB 1S72Z 3CCL1 3QWUA 4A3CI 3S17I 1I6HI 4BBRI 5A2Qb 1RO0A 1QYPA 1KQSZ 1X3ZA 3S2HI 1W2BZ 1Z01A 3NDIA 1LQLA 3D9XA 1WZNA 1KC81 3CCM1 3CCU1 1SIWA 3PO3I 2O53A 3HOWI 3HOZI 4HH4A 2R93I 4MD9A 1QVGY 2LEXA 2V3VA 2LIYA 1ZB9A 1KD11 1M901 1QVFY 2QKDA 4AYBA 3FKII 4MXUA 3M3YI 4RV9A 3I561 3CCQZ 2W04A 1NJI1 5IT9b 1K8A2 5D1PA 3CCLZ 3EEDA 2W03A 1YHQ1 2VUMI 1NP6A 2JIQA 3VB9A 1WJ2A 1X3WA 3CC41 2IZ4A 3S1NI 1NUIA 2NVQI 3J7A4 3D2LA 1TFIA 3CCMZ 3CCUZ 3I551 3P5JB 3I07A 2OTJ1 4RVGA 1YIT1 3LUSA 2JNYA 1QF8A 2F4MA 4E31A 3OW2Y 3GTOI 4HGYA 1VQLZ 2V8IA 3NFZA 4Y52I 2JA6I 1YI21 4BBSI 2JS4A 4NFRA 4XX2A 4NB8A 2LFUA 4NBAA 3I56Z 1VQM1 4A3LI 1N2FA 3BG0B 3MZLB 5FLMI 1K9M1 1K8A1 3PO3S 4A3KI 3CCJ1 2GTIA 2RHBA 1YHQZ 2Y0SA 1K732 3GTKI 1VQO1 4S1TA 2JR6A 3G6EZ 3CC4Z 3JAMf 1Q861 4BXXI 3HOUI 1YIJ1 1VQ61 1K83I 3U50C 2Q51A 2YADA 4DQYB 3I55Z 2OTLZ 2F4OA 4RVFA 5C4XI 1QVFZ 2KPIA 3FQMA 2OTJZ 1AA6A
chains in the Genus database with same CATH topology
5LL6f 1YITZ 3GTPI 1VQK1 1KRLA 3GCFA 4BY7I 1USPB 2I3CA 3S1MI 4E2WA 1VQ41 1JWHC 1TWAI 1YI2Z 1VQN1 1VQMZ 3TE5B 1VQP1 4RVDA 4Y7NI 3S1RI 3NH4A 2R7ZI 3CCJZ 3BG1B 4NOZA 1K731 1VQOZ 2HF1A 3CCE1 1WW9A 3GTJI 5CM2M 4NBFA 2V8KA 1Z02A 1Q821 2B63I 5IP7I 1X0TA 3CC21 2JUBA 1YIJZ 1VQ6Z 1VQL1 1WIIA 3K7AI 3OW2Z 3JAMb 3EERA 1VQ51 4A3JI 2PM9A 4E2YA 4A3FI 2VUGA 1TWFI 4DK1A 4NB9A 2QREB 1VQKZ 2RPRA 4NBBA 1N8R2 1YJ91 1YJN1 1VQ4Z 3F3PC 4RS4A 3G6E1 1M1K2 1VQ91 1TWCI 1VQNZ 3CME1 1YUKA 5C3EI 1VQPZ 3D6WA 3CCRZ 4X6AI 2R6MA 2OTL1 1VQ71 2Q4ZA 3CMAZ 3CCS1 4A3BI 1RQFA 3G4S1 2DE7A 3CCEZ 1JJ2Z 2NVYI 1DL6A 3CXCY 4A93I 2OOXB 4EWCA 3CC2Z 4NBGA 2RT9A 4E2ZA 2DE5A 1VQ5Z 2OZKA 1ML8A 2QA41 4MH4A 2K3RA 2M6NA 3CD61 2NVTI 5A2Qf 3CCV1 2WAQA 1RO2A 2GU2A 2QRDB 1YJ9Z 1YJNZ 1TWGI 3PO2I 3IFUA 1VQ9Z 5IP9I 1I50I 3CMEZ 4QTUA 2ZAEB 3RZOI 3IF8A 1RNIA 2WB1A 3GTMI 1VQ7Z 1JJ2Y 3CCSZ 3KIHA 3GTLI 3G4SZ 1Q7Y2 4A3DI 4E2XA 1WCMI 2H85A 4CL1A 2O4HA 3HOVI 2E2HI 5IT9f 3NH5A 2E2II 5AN9F 2QA4Z 4TNUA 3RZDI 3CD6Z 3CCVZ 3J80f 2GTHA 3CCR1 4HGZA 2JA8I 3CMA1 3CPWY 2KI7B 1YJW1 4RVHA 3GTQI 4DGLA 2R92I 2JA5I 3HKZA 5T67A 4E32A 3CXCZ 5FLXf 1VLAA 3I4NI 1SFOI 4MD8A 3CC71 2EGTA 1Z03A 1Y1WI 2QEX1 2RBLA 2VF1A 1Q7Y1 2J6AA 2JMOA 2P3YA 2P28A 4MD7A 3H3VJ 2E2JI 2OOYB 3TDHB 1Y1VI 1K9M2 1VQ81 3GTMS 1Q812 4NBHA 3NDJA 5T64A 3S16I 4A3II 3NH8A 5D1OA 2IZ3A 3J80b 1YJWZ 1KQSY 3J81f 4NH1C 1W2BY 1Q862 2HU9A 1I3QI 2E9HA 4A3GI 2M48A 3ESWA 1TWHI 3G711 5C44I 2PK7A 3CQZI 3VMGA 3CC7Z 2PMZA 5FLXb 1R9TI 2QEXZ 2QLVB 4NBDA 3VTNA 2G2KA 3I4MI 2BJOA 3S15I 4BY1I 2JA7I 3HOXI 1USPA 1ZH1A 3H0GI 4A3EI 1S721 1L1OC 1ZB8A 1P9NA 1N8R1 3VMHA 4A3MI 3CPWZ 5C4JI 1M1K1 2QR1B 2RIQA 5T6BA 3T4NB 4NBCA 3HOYI 4NBEA 1VQ8Z 1KC82 1RLYA 3FQQA 2K5RA 4E33A 1Q811 3IX0A 3VMIA 3M4OI 3S2DI 5D1OB 3F3FC 1YUAA 2NVXI 1Q822 4MRIA 2YU9I 2DE6A 2QRCB 1KD12 3S1QI 3Q87A 1QVGZ 3J81b 1M902 3G71Z 4QTTA 2AKLA 3GKQA 3KIFA 4E30A 3GTGI 1Y1VS 2V8JA 3CCQ1 4MONA 3S14I 1NJI2 1RO4A 1PFTA 1S7MA 3MONA 3MZKB 1S72Z 3CCL1 3QWUA 4A3CI 3S17I 1I6HI 4BBRI 5A2Qb 1RO0A 1QYPA 1KQSZ 1X3ZA 3S2HI 1W2BZ 1Z01A 3NDIA 1LQLA 3D9XA 1KC81 3CCM1 3CCU1 3PO3I 2O53A 3HOWI 3HOZI 4HH4A 2R93I 4MD9A 1QVGY 2LIYA 1ZB9A 1KD11 1M901 1QVFY 2QKDA 4AYBA 3FKII 4MXUA 3M3YI 4RV9A 3I561 3CCQZ 2W04A 1NJI1 5IT9b 1K8A2 5D1PA 3CCLZ 3EEDA 2W03A 1YHQ1 2VUMI 1NP6A 3VB9A 1X3WA 3CC41 2IZ4A 3S1NI 1NUIA 2NVQI 3J7A4 1TFIA 3CCMZ 3CCUZ 3I551 3P5JB 3I07A 2OTJ1 4RVGA 1YIT1 3LUSA 2JNYA 1QF8A 2F4MA 4E31A 3OW2Y 3GTOI 4HGYA 1VQLZ 2V8IA 3NFZA 4Y52I 2JA6I 1YI21 4BBSI 2JS4A 4NFRA 4XX2A 4NB8A 2LFUA 4NBAA 3I56Z 1VQM1 4A3LI 1N2FA 3BG0B 3MZLB 5FLMI 1K9M1 1K8A1 3PO3S 4A3KI 3CCJ1 2GTIA 2RHBA 1YHQZ 2Y0SA 1K732 3GTKI 1VQO1 4S1TA 2JR6A 3G6EZ 3CC4Z 3JAMf 1Q861 4BXXI 3HOUI 1YIJ1 1VQ61 1K83I 3U50C 2Q51A 2YADA 4DQYB 3I55Z 2OTLZ 2F4OA 4RVFA 5C4XI 1QVFZ 2KPIA 3FQMA 2OTJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 2;  1YIT Z;  1VQK 1;  1YJ9 Z;  1YJW Z;  1KQS Y;  1YJN Z;  1W2B Y;  1Q86 2;  1QVG Y;  1VQ4 1;  1VQ9 Z;  1YI2 Z;  1KD1 1;  3CME Z;  1M90 1;  1QVF Y;  3G71 1;  1VQN 1;  1VQM Z;  1VQP 1;  3CC7 Z;  3I56 1;  3CCQ Z;  2QEX Z;  1NJI 1;  1VQ7 Z;  1K8A 2;  1JJ2 Y;  3CCJ Z;  3CCS Z;  3CCL Z;  3G4S Z;  1Q7Y 2;  1K73 1;  1VQO Z;  1YHQ 1;  1S72 1;  3CCE 1;  1N8R 1;  3CC4 1;  1Q82 1;  3CPW Z;  3CC2 1;  1YIJ Z;  1VQ6 Z;  1M1K 1;  1VQL 1;  3OW2 Z;  2QA4 Z;  1VQ5 1;  3CD6 Z;  3CCM Z;  1VQ8 Z;  1KC8 2;  3CCU Z;  3I55 1;  3CCV Z;  3CCR 1;  2OTJ 1;  1Q81 1;  1YIT 1;  1VQK Z;  3CMA 1;  3CPW Y;  1N8R 2;  1YJ9 1;  1YJW 1;  1YJN 1;  1VQ4 Z;  1Q82 2;  3OW2 Y;  3G6E 1;  1VQL Z;  1M1K 2;  1VQ9 1;  1KD1 2;  1QVG Z;  3CXC Z;  1M90 2;  3G71 Z;  1VQN Z;  1YI2 1;  3CME 1;  1VQP Z;  1VQM 1;  3I56 Z;  3CCR Z;  3CC7 1;  3CCQ 1;  1NJI 2;  2OTL 1;  1K9M 1;  2QEX 1;  1K8A 1;  1VQ7 1;  3CMA Z;  3CCJ 1;  3CCS 1;  1YHQ Z;  1S72 Z;  3CCL 1;  1Q7Y 1;  1K73 2;  3G4S 1;  3CCE Z;  1JJ2 Z;  1VQO 1;  3CXC Y;  3G6E Z;  3CC4 Z;  1Q86 1;  3CC2 Z;  1KQS Z;  1W2B Z;  1YIJ 1;  1VQ6 1;  1VQ5 Z;  2QA4 1;  3I55 Z;  2OTL Z;  1QVF Z;  1KC8 1;  3CCM 1;  1K9M 2;  3CD6 1;  1VQ8 1;  3CCU 1;  2OTJ Z;  3CCV 1; 
#chains in the Genus database with same CATH topology
 5LL6 f;  1YIT Z;  3GTP I;  1VQK 1;  1KRL A;  3GCF A;  4BY7 I;  1USP B;  2I3C A;  3S1M I;  4E2W A;  1VQ4 1;  1JWH C;  1TWA I;  1YI2 Z;  1VQN 1;  1VQM Z;  3TE5 B;  1VQP 1;  1FDO A;  4RVD A;  4Y7N I;  3S1R I;  3NH4 A;  2R7Z I;  3CCJ Z;  2NAP A;  3BG1 B;  4NOZ A;  1K73 1;  1VQO Z;  2HF1 A;  3CCE 1;  1WW9 A;  3GTJ I;  5CM2 M;  4NBF A;  2V8K A;  1Z02 A;  1Q82 1;  2B63 I;  5IP7 I;  1X0T A;  3CC2 1;  2JUB A;  1YIJ Z;  1VQ6 Z;  1VQL 1;  1WII A;  3K7A I;  3OW2 Z;  3JAM b;  3EER A;  1VQ5 1;  1QXF A;  2PM9 A;  4A3J I;  4E2Y A;  4A3F I;  2VUG A;  1TWF I;  4DK1 A;  2AYD A;  4NB9 A;  2QRE B;  1VQK Z;  2RPR A;  4NBB A;  1N8R 2;  1YJ9 1;  1YJN 1;  1VQ4 Z;  3F3P C;  4RS4 A;  3G6E 1;  1M1K 2;  1VQ9 1;  1TWC I;  1VQN Z;  3CME 1;  1YUK A;  5C3E I;  1VQP Z;  3D6W A;  3CCR Z;  4X6A I;  2VPY A;  2R6M A;  2OTL 1;  1VQ7 1;  2Q4Z A;  3CMA Z;  3CCS 1;  4A3B I;  1RQF A;  3G4S 1;  2DE7 A;  3CCE Z;  1JJ2 Z;  2NVY I;  1DL6 A;  3CXC Y;  4A93 I;  2OOX B;  4EWC A;  3CC2 Z;  4NBG A;  2RT9 A;  4E2Z A;  2DE5 A;  1VQ5 Z;  2OZK A;  1ML8 A;  2QA4 1;  4MH4 A;  2K3R A;  2M6N A;  3CD6 1;  2NVT I;  5A2Q f;  3CCV 1;  2WAQ A;  1RO2 A;  2GU2 A;  1Y8C A;  2QRD B;  1YJ9 Z;  1YJN Z;  1TWG I;  2V45 A;  3PO2 I;  3IFU A;  1VQ9 Z;  5IP9 I;  1I50 I;  3CME Z;  4QTU A;  2ZAE B;  3RZO I;  3IF8 A;  1RNI A;  2WB1 A;  3GTM I;  1VQ7 Z;  1JJ2 Y;  3CCS Z;  3KIH A;  3GTL I;  2VPX A;  3G4S Z;  1Q7Y 2;  4A3D I;  4E2X A;  1WCM I;  2H85 A;  4CL1 A;  2O4H A;  3HOV I;  2E2H I;  5IT9 f;  3NH5 A;  2E2I I;  5AN9 F;  2QA4 Z;  4TNU A;  3RZD I;  3CD6 Z;  3CCV Z;  3J80 f;  2GTH A;  3CCR 1;  4HGZ A;  2JA8 I;  3CMA 1;  3CPW Y;  2KI7 B;  1YJW 1;  4RVH A;  3GTQ I;  4DGL A;  2R92 I;  2JA5 I;  3HKZ A;  5T67 A;  4E32 A;  3CXC Z;  5FLX f;  1VLA A;  3I4N I;  1SFO I;  4MD8 A;  3CC7 1;  2EGT A;  1Z03 A;  1Y1W I;  2JIM A;  2QEX 1;  2RBL A;  2VF1 A;  1Q7Y 1;  2J6A A;  2JMO A;  2VPW A;  2P3Y A;  2P28 A;  4MD7 A;  3H3V J;  2E2J I;  2OOY B;  2JIP A;  3TDH B;  1Y1V I;  1K9M 2;  1VQ8 1;  3GTM S;  1Q81 2;  4NBH A;  3NDJ A;  5T64 A;  3S16 I;  4A3I I;  3NH8 A;  5D1O A;  2IZ3 A;  3J80 b;  1YJW Z;  1KQS Y;  3J81 f;  4NH1 C;  1W2B Y;  1Q86 2;  2HU9 A;  1I3Q I;  2E7Z A;  2VPZ A;  2E9H A;  4A3G I;  2M48 A;  3ESW A;  1TWH I;  3G71 1;  5C44 I;  2PK7 A;  3CQZ I;  3VMG A;  3CC7 Z;  2PMZ A;  5FLX b;  1R9T I;  2QEX Z;  2JIO A;  2QLV B;  4NBD A;  3VTN A;  2G2K A;  1FDI A;  3I4M I;  2BJO A;  3S15 I;  4BY1 I;  2JA7 I;  3HOX I;  1USP A;  1ZH1 A;  3H0G I;  4A3E I;  1S72 1;  1L1O C;  1ZB8 A;  1P9N A;  1N8R 1;  3VMH A;  4A3M I;  3CPW Z;  5C4J I;  2JIR A;  1M1K 1;  2QR1 B;  1Q16 A;  2RIQ A;  5T6B A;  3T4N B;  4NBC A;  3HOY I;  4NBE A;  1VQ8 Z;  1KC8 2;  1RLY A;  3FQQ A;  2K5R A;  4E33 A;  1Q81 1;  3IX0 A;  3VMI A;  3M4O I;  3S2D I;  5D1O B;  3F3F C;  1YUA A;  2NVX I;  1Q82 2;  4MRI A;  2YU9 I;  2DE6 A;  2QRC B;  1KD1 2;  3S1Q I;  3Q87 A;  1QVG Z;  3J81 b;  1M90 2;  2IV2 X;  3G71 Z;  4QTT A;  2AKL A;  3GKQ A;  3KIF A;  4E30 A;  3GTG I;  1Y1V S;  2V8J A;  3CCQ 1;  4MON A;  3S14 I;  1NJI 2;  1RO4 A;  3IR7 A;  1PFT A;  1S7M A;  3MON A;  3MZK B;  1S72 Z;  3CCL 1;  3QWU A;  4A3C I;  3S17 I;  1I6H I;  4BBR I;  5A2Q b;  1RO0 A;  1QYP A;  1KQS Z;  1X3Z A;  3S2H I;  1W2B Z;  1Z01 A;  3NDI A;  1LQL A;  3D9X A;  1WZN A;  1KC8 1;  3CCM 1;  3CCU 1;  1SIW A;  3PO3 I;  2O53 A;  3HOW I;  3HOZ I;  4HH4 A;  2R93 I;  4MD9 A;  1QVG Y;  2LEX A;  2V3V A;  2LIY A;  1ZB9 A;  1KD1 1;  1M90 1;  1QVF Y;  2QKD A;  4AYB A;  3FKI I;  4MXU A;  3M3Y I;  4RV9 A;  3I56 1;  3CCQ Z;  2W04 A;  1NJI 1;  5IT9 b;  1K8A 2;  5D1P A;  3CCL Z;  3EED A;  2W03 A;  1YHQ 1;  2VUM I;  1NP6 A;  2JIQ A;  3VB9 A;  1WJ2 A;  1X3W A;  3CC4 1;  2IZ4 A;  3S1N I;  1NUI A;  2NVQ I;  3J7A 4;  3D2L A;  1TFI A;  3CCM Z;  3CCU Z;  3I55 1;  3P5J B;  3I07 A;  2OTJ 1;  4RVG A;  1YIT 1;  3LUS A;  2JNY A;  1QF8 A;  2F4M A;  4E31 A;  3OW2 Y;  3GTO I;  4HGY A;  1VQL Z;  2V8I A;  3NFZ A;  4Y52 I;  2JA6 I;  1YI2 1;  4BBS I;  2JS4 A;  4NFR A;  4XX2 A;  4NB8 A;  2LFU A;  4NBA A;  3I56 Z;  1VQM 1;  4A3L I;  1N2F A;  3BG0 B;  3MZL B;  5FLM I;  1K9M 1;  1K8A 1;  3PO3 S;  4A3K I;  3CCJ 1;  2GTI A;  2RHB A;  1YHQ Z;  2Y0S A;  1K73 2;  3GTK I;  1VQO 1;  4S1T A;  2JR6 A;  3G6E Z;  3CC4 Z;  3JAM f;  1Q86 1;  4BXX I;  3HOU I;  1YIJ 1;  1VQ6 1;  1K83 I;  3U50 C;  2Q51 A;  2YAD A;  4DQY B;  3I55 Z;  2OTL Z;  2F4O A;  4RVF A;  5C4X I;  1QVF Z;  2KPI A;  3FQM A;  2OTJ Z;  1AA6 A; 
#chains in the Genus database with same CATH homology
 5LL6 f;  1YIT Z;  3GTP I;  1VQK 1;  1KRL A;  3GCF A;  4BY7 I;  1USP B;  2I3C A;  3S1M I;  4E2W A;  1VQ4 1;  1JWH C;  1TWA I;  1YI2 Z;  1VQN 1;  1VQM Z;  3TE5 B;  1VQP 1;  4RVD A;  4Y7N I;  3S1R I;  3NH4 A;  2R7Z I;  3CCJ Z;  3BG1 B;  4NOZ A;  1K73 1;  1VQO Z;  2HF1 A;  3CCE 1;  1WW9 A;  3GTJ I;  5CM2 M;  4NBF A;  2V8K A;  1Z02 A;  1Q82 1;  2B63 I;  5IP7 I;  1X0T A;  3CC2 1;  2JUB A;  1YIJ Z;  1VQ6 Z;  1VQL 1;  1WII A;  3K7A I;  3OW2 Z;  3JAM b;  3EER A;  1VQ5 1;  4A3J I;  2PM9 A;  4E2Y A;  4A3F I;  2VUG A;  1TWF I;  4DK1 A;  4NB9 A;  2QRE B;  1VQK Z;  2RPR A;  4NBB A;  1N8R 2;  1YJ9 1;  1YJN 1;  1VQ4 Z;  3F3P C;  4RS4 A;  3G6E 1;  1M1K 2;  1VQ9 1;  1TWC I;  1VQN Z;  3CME 1;  1YUK A;  5C3E I;  1VQP Z;  3D6W A;  3CCR Z;  4X6A I;  2R6M A;  2OTL 1;  1VQ7 1;  2Q4Z A;  3CMA Z;  3CCS 1;  4A3B I;  1RQF A;  3G4S 1;  2DE7 A;  3CCE Z;  1JJ2 Z;  2NVY I;  1DL6 A;  3CXC Y;  4A93 I;  2OOX B;  4EWC A;  3CC2 Z;  4NBG A;  2RT9 A;  4E2Z A;  2DE5 A;  1VQ5 Z;  2OZK A;  1ML8 A;  2QA4 1;  4MH4 A;  2K3R A;  2M6N A;  3CD6 1;  2NVT I;  5A2Q f;  3CCV 1;  2WAQ A;  1RO2 A;  2GU2 A;  2QRD B;  1YJ9 Z;  1YJN Z;  1TWG I;  3PO2 I;  3IFU A;  1VQ9 Z;  5IP9 I;  1I50 I;  3CME Z;  4QTU A;  2ZAE B;  3RZO I;  3IF8 A;  1RNI A;  2WB1 A;  3GTM I;  1VQ7 Z;  1JJ2 Y;  3CCS Z;  3KIH A;  3GTL I;  3G4S Z;  1Q7Y 2;  4A3D I;  4E2X A;  1WCM I;  2H85 A;  4CL1 A;  2O4H A;  3HOV I;  2E2H I;  5IT9 f;  3NH5 A;  2E2I I;  5AN9 F;  2QA4 Z;  4TNU A;  3RZD I;  3CD6 Z;  3CCV Z;  3J80 f;  2GTH A;  3CCR 1;  4HGZ A;  2JA8 I;  3CMA 1;  3CPW Y;  2KI7 B;  1YJW 1;  4RVH A;  3GTQ I;  4DGL A;  2R92 I;  2JA5 I;  3HKZ A;  5T67 A;  4E32 A;  3CXC Z;  5FLX f;  1VLA A;  3I4N I;  1SFO I;  4MD8 A;  3CC7 1;  2EGT A;  1Z03 A;  1Y1W I;  2QEX 1;  2RBL A;  2VF1 A;  1Q7Y 1;  2J6A A;  2JMO A;  2P3Y A;  2P28 A;  4MD7 A;  3H3V J;  2E2J I;  2OOY B;  3TDH B;  1Y1V I;  1K9M 2;  1VQ8 1;  3GTM S;  1Q81 2;  4NBH A;  3NDJ A;  5T64 A;  3S16 I;  4A3I I;  3NH8 A;  5D1O A;  2IZ3 A;  3J80 b;  1YJW Z;  1KQS Y;  3J81 f;  4NH1 C;  1W2B Y;  1Q86 2;  2HU9 A;  1I3Q I;  2E9H A;  4A3G I;  2M48 A;  3ESW A;  1TWH I;  3G71 1;  5C44 I;  2PK7 A;  3CQZ I;  3VMG A;  3CC7 Z;  2PMZ A;  5FLX b;  1R9T I;  2QEX Z;  2QLV B;  4NBD A;  3VTN A;  2G2K A;  3I4M I;  2BJO A;  3S15 I;  4BY1 I;  2JA7 I;  3HOX I;  1USP A;  1ZH1 A;  3H0G I;  4A3E I;  1S72 1;  1L1O C;  1ZB8 A;  1P9N A;  1N8R 1;  3VMH A;  4A3M I;  3CPW Z;  5C4J I;  1M1K 1;  2QR1 B;  2RIQ A;  5T6B A;  3T4N B;  4NBC A;  3HOY I;  4NBE A;  1VQ8 Z;  1KC8 2;  1RLY A;  3FQQ A;  2K5R A;  4E33 A;  1Q81 1;  3IX0 A;  3VMI A;  3M4O I;  3S2D I;  5D1O B;  3F3F C;  1YUA A;  2NVX I;  1Q82 2;  4MRI A;  2YU9 I;  2DE6 A;  2QRC B;  1KD1 2;  3S1Q I;  3Q87 A;  1QVG Z;  3J81 b;  1M90 2;  3G71 Z;  4QTT A;  2AKL A;  3GKQ A;  3KIF A;  4E30 A;  3GTG I;  1Y1V S;  2V8J A;  3CCQ 1;  4MON A;  3S14 I;  1NJI 2;  1RO4 A;  1PFT A;  1S7M A;  3MON A;  3MZK B;  1S72 Z;  3CCL 1;  3QWU A;  4A3C I;  3S17 I;  1I6H I;  4BBR I;  5A2Q b;  1RO0 A;  1QYP A;  1KQS Z;  1X3Z A;  3S2H I;  1W2B Z;  1Z01 A;  3NDI A;  1LQL A;  3D9X A;  1KC8 1;  3CCM 1;  3CCU 1;  3PO3 I;  2O53 A;  3HOW I;  3HOZ I;  4HH4 A;  2R93 I;  4MD9 A;  1QVG Y;  2LIY A;  1ZB9 A;  1KD1 1;  1M90 1;  1QVF Y;  2QKD A;  4AYB A;  3FKI I;  4MXU A;  3M3Y I;  4RV9 A;  3I56 1;  3CCQ Z;  2W04 A;  1NJI 1;  5IT9 b;  1K8A 2;  5D1P A;  3CCL Z;  3EED A;  2W03 A;  1YHQ 1;  2VUM I;  1NP6 A;  3VB9 A;  1X3W A;  3CC4 1;  2IZ4 A;  3S1N I;  1NUI A;  2NVQ I;  3J7A 4;  1TFI A;  3CCM Z;  3CCU Z;  3I55 1;  3P5J B;  3I07 A;  2OTJ 1;  4RVG A;  1YIT 1;  3LUS A;  2JNY A;  1QF8 A;  2F4M A;  4E31 A;  3OW2 Y;  3GTO I;  4HGY A;  1VQL Z;  2V8I A;  3NFZ A;  4Y52 I;  2JA6 I;  1YI2 1;  4BBS I;  2JS4 A;  4NFR A;  4XX2 A;  4NB8 A;  2LFU A;  4NBA A;  3I56 Z;  1VQM 1;  4A3L I;  1N2F A;  3BG0 B;  3MZL B;  5FLM I;  1K9M 1;  1K8A 1;  3PO3 S;  4A3K I;  3CCJ 1;  2GTI A;  2RHB A;  1YHQ Z;  2Y0S A;  1K73 2;  3GTK I;  1VQO 1;  4S1T A;  2JR6 A;  3G6E Z;  3CC4 Z;  3JAM f;  1Q86 1;  4BXX I;  3HOU I;  1YIJ 1;  1VQ6 1;  1K83 I;  3U50 C;  2Q51 A;  2YAD A;  4DQY B;  3I55 Z;  2OTL Z;  2F4O A;  4RVF A;  5C4X I;  1QVF Z;  2KPI A;  3FQM A;  2OTJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...