1YHQ1

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhq100
1KD11 1W2BY 3CCMZ 1KQSY 1K9M1 1VQNZ 3CC71 3CCV1 1YJ9Z 3CXCZ 3G711 1YI2Z 3CCLZ 2OTL1 1VQ8Z 2QEXZ 1K731 1S72Z 1YJW1 3I561 3I551 3CCR1 1VQ51 1NJI2 3CD61 3CC7Z 3CCVZ 3CCE1 1Q7Y2 1VQK1 1Q7Y1 3CC41 3G71Z 2OTLZ 1M901 1YHQZ 1VQ41 1KC82 1YJWZ 3I56Z 3I55Z 1KC81 3CCRZ 1KD12 1JJ2Z 1QVGY 1VQ5Z 3CPWZ 1N8R2 3CCS1 1VQO1 1VQ61 1Q862 3CMA1 3CD6Z 1K8A2 3CCEZ 1VQKZ 3CC4Z 1M1K2 1M902 1QVGZ 1VQ4Z 1Q822 3CC21 1YJN1 3CCJ1 1JJ2Y 3CCSZ 1VQOZ 3CPWY 1NJI1 1VQ6Z 3CMAZ 1VQL1 1VQP1 1VQ71 1QVFZ 3G4S1 3OW2Z 3CCQ1 3CME1 1VQM1 3CC2Z 1YJNZ 1N8R1 3CCJZ 3CCU1 1YIT1 1Q861 1VQ91 1K8A1 1VQLZ 1VQPZ 1Q812 1VQ7Z 1M1K1 3G6E1 1QVFY 3G4SZ 1Q821 3OW2Y 3CCQZ 3CMEZ 1VQMZ 3CCUZ 1YIJ1 1YITZ 2OTJ1 1VQ9Z 1K9M2 2QA41 3G6EZ 1K732 1YHQ1 1W2BZ 1YIJZ 1KQSZ 3CCM1 2OTJZ 1VQN1 1Q811 2QA4Z 1YJ91 1YI21 3CCL1 1VQ81 3CXCY 2QEX1 1S721
chains in the Genus database with same CATH superfamily
3EERA 3MZKB 4HH4A 2QRDB 2JA8I 1ML8A 2JIQA 2HU9A 3J7A4 3S17I 3CC71 2OOXB 2VUMI 1N2FA 3J80f 1Z01A 3LUSA 1YI2Z 4NBHA 2GTIA 2VPWA 1VQ8Z 2PM9A 2QEXZ 5C3EI 3I561 3PO3I 2KI7B 3GTKI 2Y0SA 3GKQA 3KIHA 3CD61 3CCE1 2HF1A 1Q7Y1 2GU2A 3IR7A 3VB9A 2VUGA 3HOZI 3M4OI 2K3RA 3S1RI 2RIQA 1VQ5Z 4E2WA 4RS4A 2LIYA 5CM2M 3S2DI 3HOXI 1VQ61 1Q862 1Q16A 1DL6A 2AYDA 2KPIA 3D9XA 4BXXI 4DK1A 4RVDA 2JA7I 3CCSZ 3F3FC 1TWCI 5A2Qb 4NFRA 2NAPA 1VQL1 3VMIA 2VPYA 1QVFZ 3S1NI 2IZ3A 4HGYA 3CME1 1WJ2A 1YJNZ 1YIT1 4NBFA 1VQPZ 1NUIA 1S7MA 2E2HI 1M1K1 3EEDA 1Q821 1RLYA 3RZOI 2JA6I 3T4NB 2JA5I 5IT9b 1Y8CA 2VF1A 2JNYA 2OTJ1 2WAQA 2H85A 2QA41 4S1TA 4NB9A 3G6EZ 1I50I 3NH8A 1TWHI 1K732 4BBRI 2F4OA 4A93I 2RPRA 3GCFA 3GTJI 2JIPA 5IP7I 1YUKA 1Y1VI 2PMZA 3GTPI 2QLVB 1M902 1RO0A 1KD11 2M48A 1P9NA 2YADA 3CCMZ 2G2KA 1VQNZ 3H3VJ 3BG0B 4RVHA 3VMGA 3CCV1 4NBGA 3G711 4A3CI 3S14I 2V8IA 2V3VA 1S72Z 1YJW1 2QRCB 3I551 4RVGA 1LQLA 2WB1A 4A3DI 3CC7Z 4QTUA 2OOYB 2NVQI 4CL1A 2E9HA 1YHQZ 1VQ41 1KC82 3I56Z 3I4NI 2E2II 1I3QI 3Q87A 1VQO1 2ZAEB 5C44I 3CD6Z 1K8A2 3CCEZ 2DE7A 1USPB 1QVGZ 1X3WA 3KIFA 1PFTA 3RZDI 3CCJ1 3NDIA 4E33A 2IZ4A 1NJI1 4A3JI 1VQ6Z 2VPZA 2Q51A 1WZNA 2AKLA 4MH4A 3TE5B 1KRLA 5IT9f 1TWFI 1SFOI 1Y1WI 3CCQ1 1N8R1 3CCU1 1I6HI 2V8JA 4A3EI 2EGTA 1VQLZ 3D6WA 2R92I 2V8KA 2JUBA 3J81b 1RQFA 3GTMS 4E30A 3CMEZ 3JAMf 2JIRA 1YITZ 4E2YA 3PO3S 3H0GI 4NB8A 1RO2A 1ZB8A 4MD8A 4NH1C 2JS4A 1SIWA 5D1OA 3FQQA 3GTQI 4TNUA 1QF8A 2OTJZ 1Q811 2QA4Z 2RBLA 1YJ91 2R6MA 2VPXA 3CCL1 3U50C 3S1QI 3NDJA 2BJOA 3MONA 4MRIA 4A3KI 3J80b 1K9M1 1RNIA 1NP6A 2P3YA 2NVTI 4E31A 3CXCZ 2OTL1 3VTNA 3IFUA 3M3YI 3CCR1 5D1PA 1K83I 4A3MI 3I07A 4A3GI 1TWGI 2IV2X 3CCVZ 2PK7A 1VQK1 4NOZA 1L1OC 3G71Z 3CC41 3FQMA 3HOUI 1YJWZ 2DE5A 3I55Z 1KC81 1R9TI 3NH5A 1ZH1A 4NBDA 3NFZA 2YU9I 3HKZA 5FLMI 3CMA1 1M1K2 4NBBA 1VQ4Z 1Q822 3CC21 4MXUA 4MD7A 1JJ2Y 1VQOZ 3CPWY 2J6AA 4A3II 1TWAI 3J81f 1VQ71 1AA6A 1FDOA 5A2Qf 3G4S1 4AYBA 2P28A 1VQM1 3K7AI 3CCJZ 4A3BI 1TFIA 3NH4A 3I4MI 1Q861 1VQ91 2R93I 2E2JI 3GTLI 3OW2Y 4Y7NI 3CCQZ 4A3FI 3FKII 3S16I 3CCUZ 1YIJ1 4Y52I 2V45A 2F4MA 1JWHC 4XX2A 2O4HA 3D2LA 2OZKA 3GTMI 5FLXb 2JIMA 5T6BA 2R7ZI 4A3LI 1YHQ1 2LEXA 1RO4A 4X6AI 1WW9A 2E7ZA 1YI21 1X0TA 1ZB9A 1VQ81 2QEX1 3CQZI 1KD12 3GTGI 2M6NA 1W2BY 1KQSY 4RV9A 1YJ9Z 3CCLZ 3HOYI 2QREB 2B63I 2LFUA 1K731 5C4JI 4HGZA 1VQ51 2I3CA 3QWUA 1NJI2 3HOWI 3VMHA 4DGLA 1Q7Y2 3PO2I 3S1MI 2OTLZ 2JMOA 1WIIA 1M901 1Z02A 3CCRZ 1JJ2Z 1QVGY 1QXFA 3CPWZ 1N8R2 5IP9I 3CCS1 2GTHA 2QR1B 1VQKZ 5LL6f 3CC4Z 2W04A 1WCMI 4NBCA 1YJN1 2JR6A 2RHBA 1YUAA 3ESWA 1FDIA 4MD9A 3CMAZ 1VQP1 5D1OB 2NVYI 2O53A 4E2XA 5AN9F 3OW2Z 4BBSI 2W03A 3CC2Z 4BY7I 1Z03A 4RVFA 5C4XI 4NBEA 5FLXf 1K8A1 3IX0A 1Q812 3MZLB 1VQ7Z 3JAMb 3G6E1 1QVFY 3G4SZ 3GTOI 1VLAA 4E32A 1VQMZ 3P5JB 2Q4ZA 2QKDA 3IF8A 1VQ9Z 1K9M2 1USPA 1X3ZA 2NVXI 4MONA 1QYPA 3S15I 2RT9A 3S2HI 1Y1VS 3BG1B 4E2ZA 1W2BZ 4NBAA 5T64A 1YIJZ 4DQYB 1KQSZ 4BY1I 3CCM1 3F3PC 3HOVI 1VQN1 2K5RA 3TDHB 2DE6A 4QTTA 4EWCA 3CXCY 5T67A 2JIOA 1S721
chains in the Genus database with same CATH topology
3EERA 3MZKB 4HH4A 2QRDB 2JA8I 1ML8A 2HU9A 3J7A4 3S17I 3CC71 2OOXB 2VUMI 1N2FA 3J80f 1Z01A 3LUSA 1YI2Z 4NBHA 2GTIA 1VQ8Z 2PM9A 2QEXZ 5C3EI 3I561 3PO3I 2KI7B 3GTKI 2Y0SA 3GKQA 3KIHA 3CD61 3CCE1 2HF1A 1Q7Y1 2GU2A 3VB9A 2VUGA 3HOZI 3M4OI 2K3RA 3S1RI 2RIQA 1VQ5Z 4E2WA 4RS4A 2LIYA 5CM2M 3S2DI 3HOXI 1VQ61 1Q862 1DL6A 2KPIA 3D9XA 4BXXI 4DK1A 4RVDA 2JA7I 3CCSZ 3F3FC 1TWCI 5A2Qb 4NFRA 1VQL1 3VMIA 1QVFZ 3S1NI 2IZ3A 4HGYA 3CME1 1YJNZ 1YIT1 4NBFA 1VQPZ 1NUIA 1S7MA 2E2HI 1M1K1 3EEDA 1Q821 1RLYA 3RZOI 2JA6I 3T4NB 2JA5I 5IT9b 2VF1A 2JNYA 2OTJ1 2WAQA 2H85A 2QA41 4S1TA 4NB9A 3G6EZ 1I50I 3NH8A 1TWHI 1K732 4BBRI 2F4OA 4A93I 2RPRA 3GCFA 3GTJI 5IP7I 1YUKA 1Y1VI 2PMZA 3GTPI 2QLVB 1M902 1RO0A 1KD11 2M48A 1P9NA 2YADA 3CCMZ 2G2KA 1VQNZ 3H3VJ 3BG0B 4RVHA 3VMGA 3CCV1 4NBGA 3G711 4A3CI 3S14I 2V8IA 1S72Z 1YJW1 2QRCB 3I551 4RVGA 1LQLA 2WB1A 4A3DI 3CC7Z 4QTUA 2OOYB 2NVQI 4CL1A 2E9HA 1YHQZ 1VQ41 1KC82 3I56Z 3I4NI 2E2II 1I3QI 3Q87A 1VQO1 2ZAEB 5C44I 3CD6Z 1K8A2 3CCEZ 2DE7A 1USPB 1QVGZ 1X3WA 3KIFA 1PFTA 3RZDI 3CCJ1 3NDIA 4E33A 2IZ4A 1NJI1 4A3JI 1VQ6Z 2Q51A 2AKLA 4MH4A 3TE5B 1KRLA 5IT9f 1TWFI 1SFOI 1Y1WI 3CCQ1 1N8R1 3CCU1 1I6HI 2V8JA 4A3EI 2EGTA 1VQLZ 3D6WA 2R92I 2V8KA 2JUBA 3J81b 1RQFA 3GTMS 4E30A 3CMEZ 3JAMf 1YITZ 4E2YA 3PO3S 3H0GI 4NB8A 1RO2A 1ZB8A 4MD8A 4NH1C 2JS4A 5D1OA 3FQQA 3GTQI 4TNUA 1QF8A 2OTJZ 1Q811 2QA4Z 2RBLA 1YJ91 2R6MA 3CCL1 3U50C 3S1QI 3NDJA 2BJOA 3MONA 4MRIA 4A3KI 3J80b 1K9M1 1RNIA 1NP6A 2P3YA 2NVTI 4E31A 3CXCZ 2OTL1 3VTNA 3IFUA 3M3YI 3CCR1 5D1PA 1K83I 4A3MI 3I07A 4A3GI 1TWGI 3CCVZ 2PK7A 1VQK1 4NOZA 1L1OC 3G71Z 3CC41 3FQMA 3HOUI 1YJWZ 2DE5A 3I55Z 1KC81 1R9TI 3NH5A 1ZH1A 4NBDA 3NFZA 2YU9I 3HKZA 5FLMI 3CMA1 1M1K2 4NBBA 1VQ4Z 1Q822 3CC21 4MXUA 4MD7A 1JJ2Y 1VQOZ 3CPWY 2J6AA 4A3II 1TWAI 3J81f 1VQ71 5A2Qf 3G4S1 4AYBA 2P28A 1VQM1 3K7AI 3CCJZ 4A3BI 1TFIA 3NH4A 3I4MI 1Q861 1VQ91 2R93I 2E2JI 3GTLI 3OW2Y 4Y7NI 3CCQZ 4A3FI 3FKII 3S16I 3CCUZ 1YIJ1 4Y52I 2F4MA 1JWHC 4XX2A 2O4HA 2OZKA 3GTMI 5FLXb 5T6BA 2R7ZI 4A3LI 1YHQ1 1RO4A 4X6AI 1WW9A 1YI21 1X0TA 1ZB9A 1VQ81 2QEX1 3CQZI 1KD12 3GTGI 2M6NA 1W2BY 1KQSY 4RV9A 1YJ9Z 3CCLZ 3HOYI 2QREB 2B63I 2LFUA 1K731 5C4JI 4HGZA 1VQ51 2I3CA 3QWUA 1NJI2 3HOWI 3VMHA 4DGLA 1Q7Y2 3PO2I 3S1MI 2OTLZ 2JMOA 1WIIA 1M901 1Z02A 3CCRZ 1JJ2Z 1QVGY 3CPWZ 1N8R2 5IP9I 3CCS1 2GTHA 2QR1B 1VQKZ 5LL6f 3CC4Z 2W04A 1WCMI 4NBCA 1YJN1 2JR6A 2RHBA 1YUAA 3ESWA 3CMAZ 4MD9A 1VQP1 5D1OB 2NVYI 2O53A 4E2XA 5AN9F 3OW2Z 4BBSI 2W03A 3CC2Z 4BY7I 1Z03A 4RVFA 5C4XI 4NBEA 5FLXf 1K8A1 3IX0A 1Q812 3MZLB 1VQ7Z 3JAMb 3G6E1 1QVFY 3G4SZ 3GTOI 1VLAA 4E32A 1VQMZ 3P5JB 2Q4ZA 2QKDA 3IF8A 1VQ9Z 1K9M2 1USPA 1X3ZA 2NVXI 4MONA 1QYPA 3S15I 2RT9A 3S2HI 1Y1VS 3BG1B 4E2ZA 1W2BZ 4NBAA 5T64A 1YIJZ 4DQYB 1KQSZ 4BY1I 3CCM1 3F3PC 3HOVI 1VQN1 2K5RA 3TDHB 2DE6A 4QTTA 4EWCA 3CXCY 5T67A 1S721
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 1;  1W2B Y;  3CCM Z;  1KQS Y;  1K9M 1;  1VQN Z;  3CC7 1;  3CCV 1;  1YJ9 Z;  3CXC Z;  3G71 1;  1YI2 Z;  3CCL Z;  2OTL 1;  1VQ8 Z;  2QEX Z;  1K73 1;  1S72 Z;  1YJW 1;  3I56 1;  3I55 1;  3CCR 1;  1VQ5 1;  1NJI 2;  3CD6 1;  3CC7 Z;  3CCV Z;  3CCE 1;  1Q7Y 2;  1VQK 1;  1Q7Y 1;  3CC4 1;  3G71 Z;  2OTL Z;  1M90 1;  1YHQ Z;  1VQ4 1;  1KC8 2;  1YJW Z;  3I56 Z;  3I55 Z;  1KC8 1;  3CCR Z;  1KD1 2;  1JJ2 Z;  1QVG Y;  1VQ5 Z;  3CPW Z;  1N8R 2;  3CCS 1;  1VQO 1;  1VQ6 1;  1Q86 2;  3CMA 1;  3CD6 Z;  1K8A 2;  3CCE Z;  1VQK Z;  3CC4 Z;  1M1K 2;  1M90 2;  1QVG Z;  1VQ4 Z;  1Q82 2;  3CC2 1;  1YJN 1;  3CCJ 1;  1JJ2 Y;  3CCS Z;  1VQO Z;  3CPW Y;  1NJI 1;  1VQ6 Z;  3CMA Z;  1VQL 1;  1VQP 1;  1VQ7 1;  1QVF Z;  3G4S 1;  3OW2 Z;  3CCQ 1;  3CME 1;  1VQM 1;  3CC2 Z;  1YJN Z;  1N8R 1;  3CCJ Z;  3CCU 1;  1YIT 1;  1Q86 1;  1VQ9 1;  1K8A 1;  1VQL Z;  1VQP Z;  1Q81 2;  1VQ7 Z;  1M1K 1;  3G6E 1;  1QVF Y;  3G4S Z;  1Q82 1;  3OW2 Y;  3CCQ Z;  3CME Z;  1VQM Z;  3CCU Z;  1YIJ 1;  1YIT Z;  2OTJ 1;  1VQ9 Z;  1K9M 2;  2QA4 1;  3G6E Z;  1K73 2;  1YHQ 1;  1W2B Z;  1YIJ Z;  1KQS Z;  3CCM 1;  2OTJ Z;  1VQN 1;  1Q81 1;  2QA4 Z;  1YJ9 1;  1YI2 1;  3CCL 1;  1VQ8 1;  3CXC Y;  2QEX 1;  1S72 1; 
#chains in the Genus database with same CATH topology
 3EER A;  3MZK B;  4HH4 A;  2QRD B;  2JA8 I;  1ML8 A;  2JIQ A;  2HU9 A;  3J7A 4;  3S17 I;  3CC7 1;  2OOX B;  2VUM I;  1N2F A;  3J80 f;  1Z01 A;  3LUS A;  1YI2 Z;  4NBH A;  2GTI A;  2VPW A;  1VQ8 Z;  2PM9 A;  2QEX Z;  5C3E I;  3I56 1;  3PO3 I;  2KI7 B;  3GTK I;  2Y0S A;  3GKQ A;  3KIH A;  3CD6 1;  3CCE 1;  2HF1 A;  1Q7Y 1;  2GU2 A;  3IR7 A;  3VB9 A;  2VUG A;  3HOZ I;  3M4O I;  2K3R A;  3S1R I;  2RIQ A;  1VQ5 Z;  4E2W A;  4RS4 A;  2LIY A;  5CM2 M;  3S2D I;  3HOX I;  1VQ6 1;  1Q86 2;  1Q16 A;  1DL6 A;  2AYD A;  2KPI A;  3D9X A;  4BXX I;  4DK1 A;  4RVD A;  2JA7 I;  3CCS Z;  3F3F C;  1TWC I;  5A2Q b;  4NFR A;  2NAP A;  1VQL 1;  3VMI A;  2VPY A;  1QVF Z;  3S1N I;  2IZ3 A;  4HGY A;  3CME 1;  1WJ2 A;  1YJN Z;  1YIT 1;  4NBF A;  1VQP Z;  1NUI A;  1S7M A;  2E2H I;  1M1K 1;  3EED A;  1Q82 1;  1RLY A;  3RZO I;  2JA6 I;  3T4N B;  2JA5 I;  5IT9 b;  1Y8C A;  2VF1 A;  2JNY A;  2OTJ 1;  2WAQ A;  2H85 A;  2QA4 1;  4S1T A;  4NB9 A;  3G6E Z;  1I50 I;  3NH8 A;  1TWH I;  1K73 2;  4BBR I;  2F4O A;  4A93 I;  2RPR A;  3GCF A;  3GTJ I;  2JIP A;  5IP7 I;  1YUK A;  1Y1V I;  2PMZ A;  3GTP I;  2QLV B;  1M90 2;  1RO0 A;  1KD1 1;  2M48 A;  1P9N A;  2YAD A;  3CCM Z;  2G2K A;  1VQN Z;  3H3V J;  3BG0 B;  4RVH A;  3VMG A;  3CCV 1;  4NBG A;  3G71 1;  4A3C I;  3S14 I;  2V8I A;  2V3V A;  1S72 Z;  1YJW 1;  2QRC B;  3I55 1;  4RVG A;  1LQL A;  2WB1 A;  4A3D I;  3CC7 Z;  4QTU A;  2OOY B;  2NVQ I;  4CL1 A;  2E9H A;  1YHQ Z;  1VQ4 1;  1KC8 2;  3I56 Z;  3I4N I;  2E2I I;  1I3Q I;  3Q87 A;  1VQO 1;  2ZAE B;  5C44 I;  3CD6 Z;  1K8A 2;  3CCE Z;  2DE7 A;  1USP B;  1QVG Z;  1X3W A;  3KIF A;  1PFT A;  3RZD I;  3CCJ 1;  3NDI A;  4E33 A;  2IZ4 A;  1NJI 1;  4A3J I;  1VQ6 Z;  2VPZ A;  2Q51 A;  1WZN A;  2AKL A;  4MH4 A;  3TE5 B;  1KRL A;  5IT9 f;  1TWF I;  1SFO I;  1Y1W I;  3CCQ 1;  1N8R 1;  3CCU 1;  1I6H I;  2V8J A;  4A3E I;  2EGT A;  1VQL Z;  3D6W A;  2R92 I;  2V8K A;  2JUB A;  3J81 b;  1RQF A;  3GTM S;  4E30 A;  3CME Z;  3JAM f;  2JIR A;  1YIT Z;  4E2Y A;  3PO3 S;  3H0G I;  4NB8 A;  1RO2 A;  1ZB8 A;  4MD8 A;  4NH1 C;  2JS4 A;  1SIW A;  5D1O A;  3FQQ A;  3GTQ I;  4TNU A;  1QF8 A;  2OTJ Z;  1Q81 1;  2QA4 Z;  2RBL A;  1YJ9 1;  2R6M A;  2VPX A;  3CCL 1;  3U50 C;  3S1Q I;  3NDJ A;  2BJO A;  3MON A;  4MRI A;  4A3K I;  3J80 b;  1K9M 1;  1RNI A;  1NP6 A;  2P3Y A;  2NVT I;  4E31 A;  3CXC Z;  2OTL 1;  3VTN A;  3IFU A;  3M3Y I;  3CCR 1;  5D1P A;  1K83 I;  4A3M I;  3I07 A;  4A3G I;  1TWG I;  2IV2 X;  3CCV Z;  2PK7 A;  1VQK 1;  4NOZ A;  1L1O C;  3G71 Z;  3CC4 1;  3FQM A;  3HOU I;  1YJW Z;  2DE5 A;  3I55 Z;  1KC8 1;  1R9T I;  3NH5 A;  1ZH1 A;  4NBD A;  3NFZ A;  2YU9 I;  3HKZ A;  5FLM I;  3CMA 1;  1M1K 2;  4NBB A;  1VQ4 Z;  1Q82 2;  3CC2 1;  4MXU A;  4MD7 A;  1JJ2 Y;  1VQO Z;  3CPW Y;  2J6A A;  4A3I I;  1TWA I;  3J81 f;  1VQ7 1;  1AA6 A;  1FDO A;  5A2Q f;  3G4S 1;  4AYB A;  2P28 A;  1VQM 1;  3K7A I;  3CCJ Z;  4A3B I;  1TFI A;  3NH4 A;  3I4M I;  1Q86 1;  1VQ9 1;  2R93 I;  2E2J I;  3GTL I;  3OW2 Y;  4Y7N I;  3CCQ Z;  4A3F I;  3FKI I;  3S16 I;  3CCU Z;  1YIJ 1;  4Y52 I;  2V45 A;  2F4M A;  1JWH C;  4XX2 A;  2O4H A;  3D2L A;  2OZK A;  3GTM I;  5FLX b;  2JIM A;  5T6B A;  2R7Z I;  4A3L I;  1YHQ 1;  2LEX A;  1RO4 A;  4X6A I;  1WW9 A;  2E7Z A;  1YI2 1;  1X0T A;  1ZB9 A;  1VQ8 1;  2QEX 1;  3CQZ I;  1KD1 2;  3GTG I;  2M6N A;  1W2B Y;  1KQS Y;  4RV9 A;  1YJ9 Z;  3CCL Z;  3HOY I;  2QRE B;  2B63 I;  2LFU A;  1K73 1;  5C4J I;  4HGZ A;  1VQ5 1;  2I3C A;  3QWU A;  1NJI 2;  3HOW I;  3VMH A;  4DGL A;  1Q7Y 2;  3PO2 I;  3S1M I;  2OTL Z;  2JMO A;  1WII A;  1M90 1;  1Z02 A;  3CCR Z;  1JJ2 Z;  1QVG Y;  1QXF A;  3CPW Z;  1N8R 2;  5IP9 I;  3CCS 1;  2GTH A;  2QR1 B;  1VQK Z;  5LL6 f;  3CC4 Z;  2W04 A;  1WCM I;  4NBC A;  1YJN 1;  2JR6 A;  2RHB A;  1YUA A;  3ESW A;  1FDI A;  4MD9 A;  3CMA Z;  1VQP 1;  5D1O B;  2NVY I;  2O53 A;  4E2X A;  5AN9 F;  3OW2 Z;  4BBS I;  2W03 A;  3CC2 Z;  4BY7 I;  1Z03 A;  4RVF A;  5C4X I;  4NBE A;  5FLX f;  1K8A 1;  3IX0 A;  1Q81 2;  3MZL B;  1VQ7 Z;  3JAM b;  3G6E 1;  1QVF Y;  3G4S Z;  3GTO I;  1VLA A;  4E32 A;  1VQM Z;  3P5J B;  2Q4Z A;  2QKD A;  3IF8 A;  1VQ9 Z;  1K9M 2;  1USP A;  1X3Z A;  2NVX I;  4MON A;  1QYP A;  3S15 I;  2RT9 A;  3S2H I;  1Y1V S;  3BG1 B;  4E2Z A;  1W2B Z;  4NBA A;  5T64 A;  1YIJ Z;  4DQY B;  1KQS Z;  4BY1 I;  3CCM 1;  3F3P C;  3HOV I;  1VQN 1;  2K5R A;  3TDH B;  2DE6 A;  4QTT A;  4EWC A;  3CXC Y;  5T67 A;  2JIO A;  1S72 1; 
#chains in the Genus database with same CATH homology
 3EER A;  3MZK B;  4HH4 A;  2QRD B;  2JA8 I;  1ML8 A;  2HU9 A;  3J7A 4;  3S17 I;  3CC7 1;  2OOX B;  2VUM I;  1N2F A;  3J80 f;  1Z01 A;  3LUS A;  1YI2 Z;  4NBH A;  2GTI A;  1VQ8 Z;  2PM9 A;  2QEX Z;  5C3E I;  3I56 1;  3PO3 I;  2KI7 B;  3GTK I;  2Y0S A;  3GKQ A;  3KIH A;  3CD6 1;  3CCE 1;  2HF1 A;  1Q7Y 1;  2GU2 A;  3VB9 A;  2VUG A;  3HOZ I;  3M4O I;  2K3R A;  3S1R I;  2RIQ A;  1VQ5 Z;  4E2W A;  4RS4 A;  2LIY A;  5CM2 M;  3S2D I;  3HOX I;  1VQ6 1;  1Q86 2;  1DL6 A;  2KPI A;  3D9X A;  4BXX I;  4DK1 A;  4RVD A;  2JA7 I;  3CCS Z;  3F3F C;  1TWC I;  5A2Q b;  4NFR A;  1VQL 1;  3VMI A;  1QVF Z;  3S1N I;  2IZ3 A;  4HGY A;  3CME 1;  1YJN Z;  1YIT 1;  4NBF A;  1VQP Z;  1NUI A;  1S7M A;  2E2H I;  1M1K 1;  3EED A;  1Q82 1;  1RLY A;  3RZO I;  2JA6 I;  3T4N B;  2JA5 I;  5IT9 b;  2VF1 A;  2JNY A;  2OTJ 1;  2WAQ A;  2H85 A;  2QA4 1;  4S1T A;  4NB9 A;  3G6E Z;  1I50 I;  3NH8 A;  1TWH I;  1K73 2;  4BBR I;  2F4O A;  4A93 I;  2RPR A;  3GCF A;  3GTJ I;  5IP7 I;  1YUK A;  1Y1V I;  2PMZ A;  3GTP I;  2QLV B;  1M90 2;  1RO0 A;  1KD1 1;  2M48 A;  1P9N A;  2YAD A;  3CCM Z;  2G2K A;  1VQN Z;  3H3V J;  3BG0 B;  4RVH A;  3VMG A;  3CCV 1;  4NBG A;  3G71 1;  4A3C I;  3S14 I;  2V8I A;  1S72 Z;  1YJW 1;  2QRC B;  3I55 1;  4RVG A;  1LQL A;  2WB1 A;  4A3D I;  3CC7 Z;  4QTU A;  2OOY B;  2NVQ I;  4CL1 A;  2E9H A;  1YHQ Z;  1VQ4 1;  1KC8 2;  3I56 Z;  3I4N I;  2E2I I;  1I3Q I;  3Q87 A;  1VQO 1;  2ZAE B;  5C44 I;  3CD6 Z;  1K8A 2;  3CCE Z;  2DE7 A;  1USP B;  1QVG Z;  1X3W A;  3KIF A;  1PFT A;  3RZD I;  3CCJ 1;  3NDI A;  4E33 A;  2IZ4 A;  1NJI 1;  4A3J I;  1VQ6 Z;  2Q51 A;  2AKL A;  4MH4 A;  3TE5 B;  1KRL A;  5IT9 f;  1TWF I;  1SFO I;  1Y1W I;  3CCQ 1;  1N8R 1;  3CCU 1;  1I6H I;  2V8J A;  4A3E I;  2EGT A;  1VQL Z;  3D6W A;  2R92 I;  2V8K A;  2JUB A;  3J81 b;  1RQF A;  3GTM S;  4E30 A;  3CME Z;  3JAM f;  1YIT Z;  4E2Y A;  3PO3 S;  3H0G I;  4NB8 A;  1RO2 A;  1ZB8 A;  4MD8 A;  4NH1 C;  2JS4 A;  5D1O A;  3FQQ A;  3GTQ I;  4TNU A;  1QF8 A;  2OTJ Z;  1Q81 1;  2QA4 Z;  2RBL A;  1YJ9 1;  2R6M A;  3CCL 1;  3U50 C;  3S1Q I;  3NDJ A;  2BJO A;  3MON A;  4MRI A;  4A3K I;  3J80 b;  1K9M 1;  1RNI A;  1NP6 A;  2P3Y A;  2NVT I;  4E31 A;  3CXC Z;  2OTL 1;  3VTN A;  3IFU A;  3M3Y I;  3CCR 1;  5D1P A;  1K83 I;  4A3M I;  3I07 A;  4A3G I;  1TWG I;  3CCV Z;  2PK7 A;  1VQK 1;  4NOZ A;  1L1O C;  3G71 Z;  3CC4 1;  3FQM A;  3HOU I;  1YJW Z;  2DE5 A;  3I55 Z;  1KC8 1;  1R9T I;  3NH5 A;  1ZH1 A;  4NBD A;  3NFZ A;  2YU9 I;  3HKZ A;  5FLM I;  3CMA 1;  1M1K 2;  4NBB A;  1VQ4 Z;  1Q82 2;  3CC2 1;  4MXU A;  4MD7 A;  1JJ2 Y;  1VQO Z;  3CPW Y;  2J6A A;  4A3I I;  1TWA I;  3J81 f;  1VQ7 1;  5A2Q f;  3G4S 1;  4AYB A;  2P28 A;  1VQM 1;  3K7A I;  3CCJ Z;  4A3B I;  1TFI A;  3NH4 A;  3I4M I;  1Q86 1;  1VQ9 1;  2R93 I;  2E2J I;  3GTL I;  3OW2 Y;  4Y7N I;  3CCQ Z;  4A3F I;  3FKI I;  3S16 I;  3CCU Z;  1YIJ 1;  4Y52 I;  2F4M A;  1JWH C;  4XX2 A;  2O4H A;  2OZK A;  3GTM I;  5FLX b;  5T6B A;  2R7Z I;  4A3L I;  1YHQ 1;  1RO4 A;  4X6A I;  1WW9 A;  1YI2 1;  1X0T A;  1ZB9 A;  1VQ8 1;  2QEX 1;  3CQZ I;  1KD1 2;  3GTG I;  2M6N A;  1W2B Y;  1KQS Y;  4RV9 A;  1YJ9 Z;  3CCL Z;  3HOY I;  2QRE B;  2B63 I;  2LFU A;  1K73 1;  5C4J I;  4HGZ A;  1VQ5 1;  2I3C A;  3QWU A;  1NJI 2;  3HOW I;  3VMH A;  4DGL A;  1Q7Y 2;  3PO2 I;  3S1M I;  2OTL Z;  2JMO A;  1WII A;  1M90 1;  1Z02 A;  3CCR Z;  1JJ2 Z;  1QVG Y;  3CPW Z;  1N8R 2;  5IP9 I;  3CCS 1;  2GTH A;  2QR1 B;  1VQK Z;  5LL6 f;  3CC4 Z;  2W04 A;  1WCM I;  4NBC A;  1YJN 1;  2JR6 A;  2RHB A;  1YUA A;  3ESW A;  3CMA Z;  4MD9 A;  1VQP 1;  5D1O B;  2NVY I;  2O53 A;  4E2X A;  5AN9 F;  3OW2 Z;  4BBS I;  2W03 A;  3CC2 Z;  4BY7 I;  1Z03 A;  4RVF A;  5C4X I;  4NBE A;  5FLX f;  1K8A 1;  3IX0 A;  1Q81 2;  3MZL B;  1VQ7 Z;  3JAM b;  3G6E 1;  1QVF Y;  3G4S Z;  3GTO I;  1VLA A;  4E32 A;  1VQM Z;  3P5J B;  2Q4Z A;  2QKD A;  3IF8 A;  1VQ9 Z;  1K9M 2;  1USP A;  1X3Z A;  2NVX I;  4MON A;  1QYP A;  3S15 I;  2RT9 A;  3S2H I;  1Y1V S;  3BG1 B;  4E2Z A;  1W2B Z;  4NBA A;  5T64 A;  1YIJ Z;  4DQY B;  1KQS Z;  4BY1 I;  3CCM 1;  3F3P C;  3HOV I;  1VQN 1;  2K5R A;  3TDH B;  2DE6 A;  4QTT A;  4EWC A;  3CXC Y;  5T67 A;  1S72 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...