1YHQ1

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhq100
1K9M1 3CD61 1YJNZ 3CCJZ 3CC4Z 2QEX1 1M901 3G6E1 1Q812 3OW2Y 1YIJZ 1YJ9Z 3CCUZ 1JJ2Y 1KQSZ 3CC21 3CXCY 1S721 3CCSZ 3CC71 1YHQ1 1YIT1 1VQ8Z 3G4S1 1YJWZ 1M1K2 3OW2Z 1VQOZ 3CCVZ 3CMEZ 3CCM1 1VQ5Z 2QA4Z 1M1K1 1JJ2Z 1VQ41 3CXCZ 1YI2Z 1K732 1VQPZ 3CCEZ 3CMAZ 1VQMZ 3I551 2OTJZ 1K731 1VQN1 1VQ61 1QVGY 1VQ71 3CCL1 1VQK1 2OTLZ 1YJN1 3CC41 1KC82 3CC2Z 1K8A1 3CCR1 3CC7Z 1VQL1 1YIJ1 1KC81 1QVGZ 1YJ91 3CCQZ 1Q822 3I561 1KD12 1Q821 3CCMZ 1VQ4Z 1KD11 3CD6Z 1VQO1 2QEXZ 1VQ91 3G6EZ 2QA41 3G711 1QVFY 1YI21 3CPWY 1VQNZ 1K8A2 3CCJ1 1Q861 3CCLZ 1NJI2 1VQKZ 2OTJ1 1S72Z 1W2BY 1YITZ 1YHQZ 1NJI1 3G4SZ 1Q7Y2 3CCU1 3CCRZ 2OTL1 1VQLZ 3CCS1 1QVFZ 1Q7Y1 3CPWZ 1VQ81 1Q811 1YJW1 3I56Z 1W2BZ 1N8R2 3CCV1 3CME1 1VQ51 3I55Z 1Q862 3CCQ1 1N8R1 1VQ6Z 1VQP1 1VQ7Z 3CCE1 1VQ9Z 1K9M2 3CMA1 3G71Z 1KQSY 1VQM1 1M902
chains in the Genus database with same CATH superfamily
3S1NI 3CCJZ 2QREB 1K83I 3HKZA 3GTJI 3G6E1 1X0TA 3FKII 1VLAA 1YUAA 3CXCY 3CCSZ 1QXFA 2W03A 2JIMA 1VQ8Z 3I07A 2NVQI 3I4NI 2AKLA 2KI7B 4NBBA 1M1K2 1Z03A 3CMEZ 2QA4Z 1JJ2Z 3S2DI 3M3YI 1K732 2LIYA 5C4XI 1Y1VS 1VQMZ 2E2HI 1N2FA 3IX0A 1PFTA 1VQN1 1RO2A 1QVGY 2VF1A 1QF8A 3K7AI 3EEDA 4NBDA 1VQK1 2OZKA 1Z01A 4RS4A 4NB9A 3S1QI 4BXXI 2IZ4A 5D1OA 1VQL1 1YIJ1 1YUKA 2LEXA 5IP9I 2JNYA 4HH4A 3ESWA 1Q822 3I561 2PM9A 2O53A 2VPWA 1RLYA 1Z02A 1S7MA 3CCMZ 1I50I 4NBGA 1KD11 5D1PA 1P9NA 1QYPA 3G6EZ 4E31A 1Y1WI 3CCJ1 1NP6A 5D1OB 1WJ2A 1LQLA 2OOXB 3J81b 1X3WA 1FDIA 4DK1A 1Q7Y2 3J80b 3NH5A 3J7A4 2R7ZI 1Q16A 3Q87A 3CCRZ 3CCS1 3J81f 3HOWI 2VPZA 1VQ81 3H3VJ 4A3BI 5T64A 3QWUA 3J80f 2WB1A 3GKQA 4E2WA 1N8R2 3CME1 2DE6A 2ZAEB 2PK7A 3HOUI 3S17I 1VQ9Z 5C3EI 4A3KI 3G71Z 1TWHI 1VQM1 3CD61 5AN9F 2NVTI 2QEX1 1Q812 1YIJZ 2VUGA 3HOZI 2RIQA 3M4OI 3IFUA 4A3DI 4NBHA 3CCUZ 2AYDA 1JJ2Y 2E2II 4HGZA 1S721 2H85A 4MD7A 2F4OA 3G4S1 2YADA 5IT9f 3S1RI 3CCM1 2VUMI 3VMGA 2I3CA 3I551 3GTGI 3S2HI 3HOVI 2DE7A 1Y1VI 3CC41 3CQZI 2E9HA 2RHBA 1K8A1 3CCR1 3MZKB 2K5RA 4DGLA 1TWCI 5CM2M 1YJ91 2QRDB 4RV9A 1ML8A 5C4JI 2P3YA 1KD12 1FDOA 3KIHA 1VQ4Z 3CD6Z 3H0GI 2V3VA 1VQO1 2QEXZ 1VQ91 2E2JI 3S1MI 3G711 3D2LA 1ZB9A 3MZLB 3TE5B 1YI21 3JAMb 1USPA 3CCLZ 2OTJ1 1JWHC 1S72Z 2WAQA 1NJI1 3F3FC 3G4SZ 1WZNA 2Y0SA 3CCU1 4BY1I 2NAPA 2OTL1 4NBCA 2RPRA 1RQFA 2HF1A 5T67A 2JA7I 1TWAI 1ZB8A 3PO3S 3I55Z 1Q862 3CCQ1 2V8KA 2R6MA 1USPB 2R92I 3VMIA 4DQYB 4QTTA 2GU2A 4A3JI 1RO0A 4Y52I 1TWFI 4XX2A 1R9TI 2JA5I 3CC4Z 1NUIA 1M901 4E30A 4S1TA 3S15I 1YJ9Z 4E2YA 1KRLA 4A3EI 1KQSZ 2Q4ZA 3U50C 4A3II 4NFRA 3HOYI 3NH4A 1I3QI 2HU9A 1YJWZ 4RVHA 2F4MA 2QRCB 3OW2Z 1VQOZ 3CCVZ 4A3MI 1VQ41 3GTMS 1YI2Z 1VQPZ 3CCEZ 3HOXI 3CMAZ 2NVXI 2OTJZ 3GTPI 4RVDA 2KPIA 1VQ71 1DL6A 3CCL1 4HGYA 2OTLZ 1RO4A 1YJN1 1WIIA 3CC2Z 5FLXb 3CC7Z 2J6AA 2V8JA 1KC81 4NBEA 3CCQZ 3GCFA 3BG1B 5FLXf 4A3FI 1RNIA 3RZOI 2O4HA 4E2XA 4RVFA 4MD9A 4A93I 1AA6A 2JA8I 2QLVB 5LL6f 2JIRA 4NBAA 1NJI2 3F3PC 3KIFA 3T4NB 4X6AI 1QVFZ 3CPWZ 2M6NA 1Q811 4MXUA 2DE5A 4BBRI 1YJW1 4E2ZA 1W2BZ 4RVGA 3GTLI 3CCV1 1L1OC 2JR6A 4AYBA 1ZH1A 5IP7I 1VQP1 1VQ7Z 3CCE1 2V8IA 2OOYB 3CMA1 2QKDA 2QR1B 1KQSY 1M902 2RBLA 1K9M1 1TFIA 1YJNZ 5A2Qb 3PO3I 4MD8A 3JAMf 3LUSA 3FQQA 1Y8CA 3OW2Y 3D9XA 2JIOA 5A2Qf 2BJOA 1WW9A 3CC21 3CC71 5T6BA 1SIWA 1YHQ1 1YIT1 4A3LI 2IV2X 3IR7A 2YU9I 4NBFA 4Y7NI 2JA6I 1VQ5Z 1M1K1 5FLMI 3P5JB 3NDIA 3CXCZ 3GTOI 3RZDI 2P28A 1TWGI 2K3RA 1K731 1I6HI 4NB8A 2EGTA 1VQ61 4MONA 4TNUA 4E33A 3GTMI 1WCMI 3PO2I 2LFUA 3TDHB 3VB9A 3FQMA 2GTIA 2V45A 5C44I 3GTKI 1KC82 2JIPA 3S16I 3VMHA 1X3ZA 2IZ3A 4EWCA 1QVGZ 4MH4A 2R93I 4MRIA 2E7ZA 3GTQI 2Q51A 1Q821 2VPYA 2M48A 4NH1C 4CL1A 3D6WA 3EERA 2QA41 1QVFY 4BY7I 3CPWY 1VQNZ 1K8A2 4A3CI 1Q861 2NVYI 3S14I 1VQKZ 3IF8A 2PMZA 3NH8A 1W2BY 1YHQZ 3NFZA 1YITZ 2RT9A 2G2KA 3NDJA 1VQLZ 4QTUA 1Q7Y1 2JUBA 1SFOI 4E32A 4A3GI 3I56Z 3VTNA 5IT9b 3I4MI 3MONA 2GTHA 2W04A 1VQ51 3BG0B 2JS4A 1N8R1 2JMOA 2JIQA 2B63I 1VQ6Z 4BBSI 1K9M2 2VPXA 4NOZA
chains in the Genus database with same CATH topology
3S1NI 3CCJZ 2QREB 1K83I 3HKZA 3GTJI 3G6E1 1X0TA 3FKII 1VLAA 1YUAA 3CXCY 3CCSZ 2W03A 1VQ8Z 3I07A 2NVQI 3I4NI 2AKLA 2KI7B 4NBBA 1M1K2 1Z03A 3CMEZ 2QA4Z 1JJ2Z 3S2DI 3M3YI 1K732 2LIYA 5C4XI 1Y1VS 1VQMZ 2E2HI 1N2FA 3IX0A 1PFTA 1VQN1 1RO2A 1QVGY 2VF1A 1QF8A 3K7AI 3EEDA 4NBDA 1VQK1 2OZKA 1Z01A 4RS4A 4NB9A 3S1QI 4BXXI 2IZ4A 5D1OA 1VQL1 1YIJ1 1YUKA 5IP9I 2JNYA 4HH4A 3ESWA 1Q822 3I561 2PM9A 2O53A 1RLYA 1Z02A 1S7MA 3CCMZ 1I50I 4NBGA 1KD11 5D1PA 1P9NA 1QYPA 3G6EZ 4E31A 1Y1WI 3CCJ1 1NP6A 5D1OB 2OOXB 1LQLA 3J81b 1X3WA 4DK1A 1Q7Y2 3J80b 3NH5A 3J7A4 2R7ZI 3Q87A 3CCRZ 3CCS1 3J81f 3HOWI 1VQ81 3H3VJ 4A3BI 5T64A 3QWUA 3J80f 2WB1A 3GKQA 4E2WA 1N8R2 3CME1 2DE6A 2ZAEB 2PK7A 3HOUI 3S17I 1VQ9Z 5C3EI 4A3KI 3G71Z 1VQM1 1TWHI 3CD61 5AN9F 2NVTI 2QEX1 1Q812 1YIJZ 2VUGA 3HOZI 2RIQA 3M4OI 3IFUA 4A3DI 4NBHA 3CCUZ 1JJ2Y 2E2II 4HGZA 1S721 2H85A 4MD7A 2F4OA 3G4S1 2YADA 5IT9f 3S1RI 3CCM1 2VUMI 3VMGA 2I3CA 3I551 3GTGI 3S2HI 3HOVI 2DE7A 1Y1VI 3CC41 3CQZI 2E9HA 2RHBA 1K8A1 3CCR1 3MZKB 2K5RA 4DGLA 1TWCI 5CM2M 1YJ91 2QRDB 4RV9A 1ML8A 5C4JI 2P3YA 1KD12 3KIHA 1VQ4Z 3CD6Z 3H0GI 1VQO1 2QEXZ 1VQ91 2E2JI 3S1MI 3G711 1ZB9A 3MZLB 3TE5B 1YI21 3JAMb 1USPA 3CCLZ 2OTJ1 1JWHC 1S72Z 2WAQA 1NJI1 3F3FC 3G4SZ 2Y0SA 3CCU1 4BY1I 2OTL1 4NBCA 2RPRA 1RQFA 2HF1A 5T67A 2JA7I 1TWAI 1ZB8A 3PO3S 3I55Z 1Q862 3CCQ1 2V8KA 2R6MA 1USPB 2R92I 3VMIA 4DQYB 4QTTA 2GU2A 4A3JI 1RO0A 4Y52I 1TWFI 4XX2A 1R9TI 2JA5I 3CC4Z 1NUIA 1M901 4E30A 4S1TA 3S15I 1YJ9Z 4E2YA 1KRLA 4A3EI 1KQSZ 2Q4ZA 3U50C 4A3II 4NFRA 3HOYI 3NH4A 1I3QI 2HU9A 1YJWZ 4RVHA 2F4MA 2QRCB 3OW2Z 1VQOZ 3CCVZ 4A3MI 1VQ41 3GTMS 1YI2Z 1VQPZ 3CCEZ 3HOXI 3CMAZ 2NVXI 2OTJZ 3GTPI 4RVDA 2KPIA 1VQ71 1DL6A 3CCL1 4HGYA 2OTLZ 1RO4A 1YJN1 1WIIA 3CC2Z 5FLXb 3CC7Z 2J6AA 2V8JA 1KC81 4NBEA 3CCQZ 3GCFA 3BG1B 5FLXf 4A3FI 1RNIA 3RZOI 2O4HA 4E2XA 4RVFA 4MD9A 4A93I 2JA8I 2QLVB 5LL6f 4NBAA 1NJI2 3F3PC 3KIFA 3T4NB 4X6AI 1QVFZ 3CPWZ 2M6NA 1Q811 4MXUA 2DE5A 4BBRI 1YJW1 4E2ZA 1W2BZ 4RVGA 3GTLI 3CCV1 1L1OC 2JR6A 4AYBA 1ZH1A 5IP7I 1VQP1 1VQ7Z 3CCE1 2V8IA 2OOYB 3CMA1 2QKDA 2QR1B 1KQSY 1M902 2RBLA 1K9M1 1TFIA 1YJNZ 5A2Qb 3PO3I 4MD8A 3JAMf 3LUSA 3FQQA 3OW2Y 3D9XA 5A2Qf 2BJOA 1WW9A 3CC21 3CC71 5T6BA 1YHQ1 1YIT1 4A3LI 2YU9I 4NBFA 4Y7NI 2JA6I 1VQ5Z 1M1K1 5FLMI 3P5JB 3NDIA 3CXCZ 3GTOI 3RZDI 2P28A 1TWGI 2K3RA 1K731 1I6HI 4NB8A 2EGTA 1VQ61 4MONA 4TNUA 4E33A 3GTMI 1WCMI 3PO2I 2LFUA 3TDHB 3VB9A 3FQMA 2GTIA 5C44I 3GTKI 1KC82 3S16I 3VMHA 1X3ZA 2IZ3A 4EWCA 1QVGZ 4MH4A 2R93I 4MRIA 3GTQI 2Q51A 1Q821 2M48A 4NH1C 4CL1A 3D6WA 3EERA 2QA41 1QVFY 4BY7I 3CPWY 1VQNZ 1K8A2 4A3CI 1Q861 2NVYI 3S14I 1VQKZ 3IF8A 2PMZA 3NH8A 1W2BY 1YHQZ 3NFZA 1YITZ 2RT9A 2G2KA 3NDJA 1VQLZ 4QTUA 1Q7Y1 2JUBA 1SFOI 4E32A 4A3GI 3I56Z 3VTNA 5IT9b 3I4MI 3MONA 2GTHA 2W04A 1VQ51 3BG0B 2JS4A 1N8R1 2JMOA 2B63I 1VQ6Z 4BBSI 1K9M2 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 1;  3CD6 1;  1YJN Z;  3CCJ Z;  3CC4 Z;  2QEX 1;  1M90 1;  3G6E 1;  1Q81 2;  3OW2 Y;  1YIJ Z;  1YJ9 Z;  3CCU Z;  1JJ2 Y;  1KQS Z;  3CC2 1;  3CXC Y;  1S72 1;  3CCS Z;  3CC7 1;  1YHQ 1;  1YIT 1;  1VQ8 Z;  3G4S 1;  1YJW Z;  1M1K 2;  3OW2 Z;  1VQO Z;  3CCV Z;  3CME Z;  3CCM 1;  1VQ5 Z;  2QA4 Z;  1M1K 1;  1JJ2 Z;  1VQ4 1;  3CXC Z;  1YI2 Z;  1K73 2;  1VQP Z;  3CCE Z;  3CMA Z;  1VQM Z;  3I55 1;  2OTJ Z;  1K73 1;  1VQN 1;  1VQ6 1;  1QVG Y;  1VQ7 1;  3CCL 1;  1VQK 1;  2OTL Z;  1YJN 1;  3CC4 1;  1KC8 2;  3CC2 Z;  1K8A 1;  3CCR 1;  3CC7 Z;  1VQL 1;  1YIJ 1;  1KC8 1;  1QVG Z;  1YJ9 1;  3CCQ Z;  1Q82 2;  3I56 1;  1KD1 2;  1Q82 1;  3CCM Z;  1VQ4 Z;  1KD1 1;  3CD6 Z;  1VQO 1;  2QEX Z;  1VQ9 1;  3G6E Z;  2QA4 1;  3G71 1;  1QVF Y;  1YI2 1;  3CPW Y;  1VQN Z;  1K8A 2;  3CCJ 1;  1Q86 1;  3CCL Z;  1NJI 2;  1VQK Z;  2OTJ 1;  1S72 Z;  1W2B Y;  1YIT Z;  1YHQ Z;  1NJI 1;  3G4S Z;  1Q7Y 2;  3CCU 1;  3CCR Z;  2OTL 1;  1VQL Z;  3CCS 1;  1QVF Z;  1Q7Y 1;  3CPW Z;  1VQ8 1;  1Q81 1;  1YJW 1;  3I56 Z;  1W2B Z;  1N8R 2;  3CCV 1;  3CME 1;  1VQ5 1;  3I55 Z;  1Q86 2;  3CCQ 1;  1N8R 1;  1VQ6 Z;  1VQP 1;  1VQ7 Z;  3CCE 1;  1VQ9 Z;  1K9M 2;  3CMA 1;  3G71 Z;  1KQS Y;  1VQM 1;  1M90 2; 
#chains in the Genus database with same CATH topology
 3S1N I;  3CCJ Z;  2QRE B;  1K83 I;  3HKZ A;  3GTJ I;  3G6E 1;  1X0T A;  3FKI I;  1VLA A;  1YUA A;  3CXC Y;  3CCS Z;  1QXF A;  2W03 A;  2JIM A;  1VQ8 Z;  3I07 A;  2NVQ I;  3I4N I;  2AKL A;  2KI7 B;  4NBB A;  1M1K 2;  1Z03 A;  3CME Z;  2QA4 Z;  1JJ2 Z;  3S2D I;  3M3Y I;  1K73 2;  2LIY A;  5C4X I;  1Y1V S;  1VQM Z;  2E2H I;  1N2F A;  3IX0 A;  1PFT A;  1VQN 1;  1RO2 A;  1QVG Y;  2VF1 A;  1QF8 A;  3K7A I;  3EED A;  4NBD A;  1VQK 1;  2OZK A;  1Z01 A;  4RS4 A;  4NB9 A;  3S1Q I;  4BXX I;  2IZ4 A;  5D1O A;  1VQL 1;  1YIJ 1;  1YUK A;  2LEX A;  5IP9 I;  2JNY A;  4HH4 A;  3ESW A;  1Q82 2;  3I56 1;  2PM9 A;  2O53 A;  2VPW A;  1RLY A;  1Z02 A;  1S7M A;  3CCM Z;  1I50 I;  4NBG A;  1KD1 1;  5D1P A;  1P9N A;  1QYP A;  3G6E Z;  4E31 A;  1Y1W I;  3CCJ 1;  1NP6 A;  5D1O B;  1WJ2 A;  1LQL A;  2OOX B;  3J81 b;  1X3W A;  1FDI A;  4DK1 A;  1Q7Y 2;  3J80 b;  3NH5 A;  3J7A 4;  2R7Z I;  1Q16 A;  3Q87 A;  3CCR Z;  3CCS 1;  3J81 f;  3HOW I;  2VPZ A;  1VQ8 1;  3H3V J;  4A3B I;  5T64 A;  3QWU A;  3J80 f;  2WB1 A;  3GKQ A;  4E2W A;  1N8R 2;  3CME 1;  2DE6 A;  2ZAE B;  2PK7 A;  3HOU I;  3S17 I;  1VQ9 Z;  5C3E I;  4A3K I;  3G71 Z;  1TWH I;  1VQM 1;  3CD6 1;  5AN9 F;  2NVT I;  2QEX 1;  1Q81 2;  1YIJ Z;  2VUG A;  3HOZ I;  2RIQ A;  3M4O I;  3IFU A;  4A3D I;  4NBH A;  3CCU Z;  2AYD A;  1JJ2 Y;  2E2I I;  4HGZ A;  1S72 1;  2H85 A;  4MD7 A;  2F4O A;  3G4S 1;  2YAD A;  5IT9 f;  3S1R I;  3CCM 1;  2VUM I;  3VMG A;  2I3C A;  3I55 1;  3GTG I;  3S2H I;  3HOV I;  2DE7 A;  1Y1V I;  3CC4 1;  3CQZ I;  2E9H A;  2RHB A;  1K8A 1;  3CCR 1;  3MZK B;  2K5R A;  4DGL A;  1TWC I;  5CM2 M;  1YJ9 1;  2QRD B;  4RV9 A;  1ML8 A;  5C4J I;  2P3Y A;  1KD1 2;  1FDO A;  3KIH A;  1VQ4 Z;  3CD6 Z;  3H0G I;  2V3V A;  1VQO 1;  2QEX Z;  1VQ9 1;  2E2J I;  3S1M I;  3G71 1;  3D2L A;  1ZB9 A;  3MZL B;  3TE5 B;  1YI2 1;  3JAM b;  1USP A;  3CCL Z;  2OTJ 1;  1JWH C;  1S72 Z;  2WAQ A;  1NJI 1;  3F3F C;  3G4S Z;  1WZN A;  2Y0S A;  3CCU 1;  4BY1 I;  2NAP A;  2OTL 1;  4NBC A;  2RPR A;  1RQF A;  2HF1 A;  5T67 A;  2JA7 I;  1TWA I;  1ZB8 A;  3PO3 S;  3I55 Z;  1Q86 2;  3CCQ 1;  2V8K A;  2R6M A;  1USP B;  2R92 I;  3VMI A;  4DQY B;  4QTT A;  2GU2 A;  4A3J I;  1RO0 A;  4Y52 I;  1TWF I;  4XX2 A;  1R9T I;  2JA5 I;  3CC4 Z;  1NUI A;  1M90 1;  4E30 A;  4S1T A;  3S15 I;  1YJ9 Z;  4E2Y A;  1KRL A;  4A3E I;  1KQS Z;  2Q4Z A;  3U50 C;  4A3I I;  4NFR A;  3HOY I;  3NH4 A;  1I3Q I;  2HU9 A;  1YJW Z;  4RVH A;  2F4M A;  2QRC B;  3OW2 Z;  1VQO Z;  3CCV Z;  4A3M I;  1VQ4 1;  3GTM S;  1YI2 Z;  1VQP Z;  3CCE Z;  3HOX I;  3CMA Z;  2NVX I;  2OTJ Z;  3GTP I;  4RVD A;  2KPI A;  1VQ7 1;  1DL6 A;  3CCL 1;  4HGY A;  2OTL Z;  1RO4 A;  1YJN 1;  1WII A;  3CC2 Z;  5FLX b;  3CC7 Z;  2J6A A;  2V8J A;  1KC8 1;  4NBE A;  3CCQ Z;  3GCF A;  3BG1 B;  5FLX f;  4A3F I;  1RNI A;  3RZO I;  2O4H A;  4E2X A;  4RVF A;  4MD9 A;  4A93 I;  1AA6 A;  2JA8 I;  2QLV B;  5LL6 f;  2JIR A;  4NBA A;  1NJI 2;  3F3P C;  3KIF A;  3T4N B;  4X6A I;  1QVF Z;  3CPW Z;  2M6N A;  1Q81 1;  4MXU A;  2DE5 A;  4BBR I;  1YJW 1;  4E2Z A;  1W2B Z;  4RVG A;  3GTL I;  3CCV 1;  1L1O C;  2JR6 A;  4AYB A;  1ZH1 A;  5IP7 I;  1VQP 1;  1VQ7 Z;  3CCE 1;  2V8I A;  2OOY B;  3CMA 1;  2QKD A;  2QR1 B;  1KQS Y;  1M90 2;  2RBL A;  1K9M 1;  1TFI A;  1YJN Z;  5A2Q b;  3PO3 I;  4MD8 A;  3JAM f;  3LUS A;  3FQQ A;  1Y8C A;  3OW2 Y;  3D9X A;  2JIO A;  5A2Q f;  2BJO A;  1WW9 A;  3CC2 1;  3CC7 1;  5T6B A;  1SIW A;  1YHQ 1;  1YIT 1;  4A3L I;  2IV2 X;  3IR7 A;  2YU9 I;  4NBF A;  4Y7N I;  2JA6 I;  1VQ5 Z;  1M1K 1;  5FLM I;  3P5J B;  3NDI A;  3CXC Z;  3GTO I;  3RZD I;  2P28 A;  1TWG I;  2K3R A;  1K73 1;  1I6H I;  4NB8 A;  2EGT A;  1VQ6 1;  4MON A;  4TNU A;  4E33 A;  3GTM I;  1WCM I;  3PO2 I;  2LFU A;  3TDH B;  3VB9 A;  3FQM A;  2GTI A;  2V45 A;  5C44 I;  3GTK I;  1KC8 2;  2JIP A;  3S16 I;  3VMH A;  1X3Z A;  2IZ3 A;  4EWC A;  1QVG Z;  4MH4 A;  2R93 I;  4MRI A;  2E7Z A;  3GTQ I;  2Q51 A;  1Q82 1;  2VPY A;  2M48 A;  4NH1 C;  4CL1 A;  3D6W A;  3EER A;  2QA4 1;  1QVF Y;  4BY7 I;  3CPW Y;  1VQN Z;  1K8A 2;  4A3C I;  1Q86 1;  2NVY I;  3S14 I;  1VQK Z;  3IF8 A;  2PMZ A;  3NH8 A;  1W2B Y;  1YHQ Z;  3NFZ A;  1YIT Z;  2RT9 A;  2G2K A;  3NDJ A;  1VQL Z;  4QTU A;  1Q7Y 1;  2JUB A;  1SFO I;  4E32 A;  4A3G I;  3I56 Z;  3VTN A;  5IT9 b;  3I4M I;  3MON A;  2GTH A;  2W04 A;  1VQ5 1;  3BG0 B;  2JS4 A;  1N8R 1;  2JMO A;  2JIQ A;  2B63 I;  1VQ6 Z;  4BBS I;  1K9M 2;  2VPX A;  4NOZ A; 
#chains in the Genus database with same CATH homology
 3S1N I;  3CCJ Z;  2QRE B;  1K83 I;  3HKZ A;  3GTJ I;  3G6E 1;  1X0T A;  3FKI I;  1VLA A;  1YUA A;  3CXC Y;  3CCS Z;  2W03 A;  1VQ8 Z;  3I07 A;  2NVQ I;  3I4N I;  2AKL A;  2KI7 B;  4NBB A;  1M1K 2;  1Z03 A;  3CME Z;  2QA4 Z;  1JJ2 Z;  3S2D I;  3M3Y I;  1K73 2;  2LIY A;  5C4X I;  1Y1V S;  1VQM Z;  2E2H I;  1N2F A;  3IX0 A;  1PFT A;  1VQN 1;  1RO2 A;  1QVG Y;  2VF1 A;  1QF8 A;  3K7A I;  3EED A;  4NBD A;  1VQK 1;  2OZK A;  1Z01 A;  4RS4 A;  4NB9 A;  3S1Q I;  4BXX I;  2IZ4 A;  5D1O A;  1VQL 1;  1YIJ 1;  1YUK A;  5IP9 I;  2JNY A;  4HH4 A;  3ESW A;  1Q82 2;  3I56 1;  2PM9 A;  2O53 A;  1RLY A;  1Z02 A;  1S7M A;  3CCM Z;  1I50 I;  4NBG A;  1KD1 1;  5D1P A;  1P9N A;  1QYP A;  3G6E Z;  4E31 A;  1Y1W I;  3CCJ 1;  1NP6 A;  5D1O B;  2OOX B;  1LQL A;  3J81 b;  1X3W A;  4DK1 A;  1Q7Y 2;  3J80 b;  3NH5 A;  3J7A 4;  2R7Z I;  3Q87 A;  3CCR Z;  3CCS 1;  3J81 f;  3HOW I;  1VQ8 1;  3H3V J;  4A3B I;  5T64 A;  3QWU A;  3J80 f;  2WB1 A;  3GKQ A;  4E2W A;  1N8R 2;  3CME 1;  2DE6 A;  2ZAE B;  2PK7 A;  3HOU I;  3S17 I;  1VQ9 Z;  5C3E I;  4A3K I;  3G71 Z;  1VQM 1;  1TWH I;  3CD6 1;  5AN9 F;  2NVT I;  2QEX 1;  1Q81 2;  1YIJ Z;  2VUG A;  3HOZ I;  2RIQ A;  3M4O I;  3IFU A;  4A3D I;  4NBH A;  3CCU Z;  1JJ2 Y;  2E2I I;  4HGZ A;  1S72 1;  2H85 A;  4MD7 A;  2F4O A;  3G4S 1;  2YAD A;  5IT9 f;  3S1R I;  3CCM 1;  2VUM I;  3VMG A;  2I3C A;  3I55 1;  3GTG I;  3S2H I;  3HOV I;  2DE7 A;  1Y1V I;  3CC4 1;  3CQZ I;  2E9H A;  2RHB A;  1K8A 1;  3CCR 1;  3MZK B;  2K5R A;  4DGL A;  1TWC I;  5CM2 M;  1YJ9 1;  2QRD B;  4RV9 A;  1ML8 A;  5C4J I;  2P3Y A;  1KD1 2;  3KIH A;  1VQ4 Z;  3CD6 Z;  3H0G I;  1VQO 1;  2QEX Z;  1VQ9 1;  2E2J I;  3S1M I;  3G71 1;  1ZB9 A;  3MZL B;  3TE5 B;  1YI2 1;  3JAM b;  1USP A;  3CCL Z;  2OTJ 1;  1JWH C;  1S72 Z;  2WAQ A;  1NJI 1;  3F3F C;  3G4S Z;  2Y0S A;  3CCU 1;  4BY1 I;  2OTL 1;  4NBC A;  2RPR A;  1RQF A;  2HF1 A;  5T67 A;  2JA7 I;  1TWA I;  1ZB8 A;  3PO3 S;  3I55 Z;  1Q86 2;  3CCQ 1;  2V8K A;  2R6M A;  1USP B;  2R92 I;  3VMI A;  4DQY B;  4QTT A;  2GU2 A;  4A3J I;  1RO0 A;  4Y52 I;  1TWF I;  4XX2 A;  1R9T I;  2JA5 I;  3CC4 Z;  1NUI A;  1M90 1;  4E30 A;  4S1T A;  3S15 I;  1YJ9 Z;  4E2Y A;  1KRL A;  4A3E I;  1KQS Z;  2Q4Z A;  3U50 C;  4A3I I;  4NFR A;  3HOY I;  3NH4 A;  1I3Q I;  2HU9 A;  1YJW Z;  4RVH A;  2F4M A;  2QRC B;  3OW2 Z;  1VQO Z;  3CCV Z;  4A3M I;  1VQ4 1;  3GTM S;  1YI2 Z;  1VQP Z;  3CCE Z;  3HOX I;  3CMA Z;  2NVX I;  2OTJ Z;  3GTP I;  4RVD A;  2KPI A;  1VQ7 1;  1DL6 A;  3CCL 1;  4HGY A;  2OTL Z;  1RO4 A;  1YJN 1;  1WII A;  3CC2 Z;  5FLX b;  3CC7 Z;  2J6A A;  2V8J A;  1KC8 1;  4NBE A;  3CCQ Z;  3GCF A;  3BG1 B;  5FLX f;  4A3F I;  1RNI A;  3RZO I;  2O4H A;  4E2X A;  4RVF A;  4MD9 A;  4A93 I;  2JA8 I;  2QLV B;  5LL6 f;  4NBA A;  1NJI 2;  3F3P C;  3KIF A;  3T4N B;  4X6A I;  1QVF Z;  3CPW Z;  2M6N A;  1Q81 1;  4MXU A;  2DE5 A;  4BBR I;  1YJW 1;  4E2Z A;  1W2B Z;  4RVG A;  3GTL I;  3CCV 1;  1L1O C;  2JR6 A;  4AYB A;  1ZH1 A;  5IP7 I;  1VQP 1;  1VQ7 Z;  3CCE 1;  2V8I A;  2OOY B;  3CMA 1;  2QKD A;  2QR1 B;  1KQS Y;  1M90 2;  2RBL A;  1K9M 1;  1TFI A;  1YJN Z;  5A2Q b;  3PO3 I;  4MD8 A;  3JAM f;  3LUS A;  3FQQ A;  3OW2 Y;  3D9X A;  5A2Q f;  2BJO A;  1WW9 A;  3CC2 1;  3CC7 1;  5T6B A;  1YHQ 1;  1YIT 1;  4A3L I;  2YU9 I;  4NBF A;  4Y7N I;  2JA6 I;  1VQ5 Z;  1M1K 1;  5FLM I;  3P5J B;  3NDI A;  3CXC Z;  3GTO I;  3RZD I;  2P28 A;  1TWG I;  2K3R A;  1K73 1;  1I6H I;  4NB8 A;  2EGT A;  1VQ6 1;  4MON A;  4TNU A;  4E33 A;  3GTM I;  1WCM I;  3PO2 I;  2LFU A;  3TDH B;  3VB9 A;  3FQM A;  2GTI A;  5C44 I;  3GTK I;  1KC8 2;  3S16 I;  3VMH A;  1X3Z A;  2IZ3 A;  4EWC A;  1QVG Z;  4MH4 A;  2R93 I;  4MRI A;  3GTQ I;  2Q51 A;  1Q82 1;  2M48 A;  4NH1 C;  4CL1 A;  3D6W A;  3EER A;  2QA4 1;  1QVF Y;  4BY7 I;  3CPW Y;  1VQN Z;  1K8A 2;  4A3C I;  1Q86 1;  2NVY I;  3S14 I;  1VQK Z;  3IF8 A;  2PMZ A;  3NH8 A;  1W2B Y;  1YHQ Z;  3NFZ A;  1YIT Z;  2RT9 A;  2G2K A;  3NDJ A;  1VQL Z;  4QTU A;  1Q7Y 1;  2JUB A;  1SFO I;  4E32 A;  4A3G I;  3I56 Z;  3VTN A;  5IT9 b;  3I4M I;  3MON A;  2GTH A;  2W04 A;  1VQ5 1;  3BG0 B;  2JS4 A;  1N8R 1;  2JMO A;  2B63 I;  1VQ6 Z;  4BBS I;  1K9M 2;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...