1YHQ1

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhq100
3CD6Z 3G4SZ 1KD11 1VQ7Z 2OTLZ 1JJ2Z 1KQSZ 3CCLZ 3OW2Z 1K9M2 1KQSY 3CCQZ 1S721 1N8R1 1YJW1 3CCJ1 1K731 2OTJ1 1VQ4Z 1W2BY 1YI2Z 1YJ9Z 3CCRZ 3G6E1 1KD12 3CPWZ 1KC82 3CPWY 1YJ91 3CC4Z 3CCJZ 1VQ41 3CXCY 3CCQ1 1YI21 1S72Z 1KC81 2OTJZ 1QVGY 1Q821 1VQNZ 3CCR1 1YJNZ 1Q7Y1 1VQ5Z 3I56Z 3CC7Z 1VQ9Z 1VQ71 1YIJ1 2QEXZ 1VQL1 2OTL1 1K8A1 1VQKZ 3G711 1VQPZ 1K9M1 1VQM1 1YITZ 3CD61 1QVFY 3CCE1 1VQ91 1VQLZ 3CCVZ 1QVFZ 1VQN1 3CC2Z 1M1K1 1YIJZ 3CC71 3I561 3CXCZ 3I551 1VQ51 1YJN1 1JJ2Y 1VQO1 3G6EZ 3G71Z 1VQP1 1VQMZ 1YIT1 1Q7Y2 1VQK1 1M1K2 1Q861 3CC41 3CCU1 1Q812 3CCS1 1VQ81 1YHQZ 3CMAZ 1Q822 1NJI2 3CCM1 3CMEZ 2QEX1 3CMA1 1YHQ1 3CCL1 3CCSZ 1VQ8Z 3CCUZ 1W2BZ 3CME1 1Q811 1YJWZ 3CCMZ 1M902 2QA4Z 1VQ61 1VQOZ 1N8R2 3CC21 3CCEZ 3CCV1 3OW2Y 1VQ6Z 3G4S1 2QA41 3I55Z 1K8A2 1QVGZ 1M901 1NJI1 1K732 1Q862
chains in the Genus database with same CATH superfamily
2V8KA 3CD6Z 3D9XA 2R6MA 4NOZA 1I50I 2RIQA 1QF8A 1VQ7Z 2WB1A 1WJ2A 2AYDA 2V8JA 1KQSZ 3M3YI 2O53A 4BY7I 1YJW1 3CCJ1 1K731 2R92I 4NBHA 1YI2Z 4MH4A 1YJ9Z 2LIYA 2Q51A 3CPWY 1S72Z 4DK1A 1YI21 4A3GI 1KC81 3J81f 3CCR1 1YJNZ 3S15I 1VQ9Z 3GTLI 1R9TI 1Y1VI 2PK7A 1ZB8A 1VQKZ 2V8IA 1YITZ 2JIQA 3S1NI 1PFTA 1USPA 3CCVZ 2DE6A 2V3VA 3FQQA 3I551 1VQ51 1Z02A 5C3EI 4A3CI 3J80b 1VQMZ 1Q7Y2 3PO3I 3VMIA 1AA6A 3FQMA 1Q812 3VMGA 4A3FI 2AKLA 1TWHI 3H3VJ 3GTMI 3ESWA 1TWGI 3J7A4 2RPRA 2J6AA 3GTPI 3CMA1 2JA8I 1YHQ1 1JWHC 1QXFA 1VLAA 4NB9A 5IT9b 3CME1 4NH1C 5A2Qf 3F3PC 3U50C 2QA4Z 1RQFA 5D1OA 4AYBA 3S1QI 1TWAI 3CC21 1RO4A 3S2HI 3CCEZ 3CCV1 3NH4A 5FLXb 2RT9A 2K3RA 3VMHA 2YU9I 1YUAA 2QA41 3I55Z 3LUSA 3BG1B 1Q862 1NUIA 2NAPA 1KD11 4Y52I 1YUKA 2VUGA 1JJ2Z 3NDJA 3S1RI 3KIFA 3T4NB 2JIPA 1K9M2 5FLMI 4NBGA 5IP7I 1TWFI 3NH8A 3CCQZ 1N8R1 2NVQI 2OTJ1 2V45A 2Q4ZA 3GCFA 1K83I 2KPIA 1TFIA 3CPWZ 2E7ZA 2LFUA 2NVYI 1YJ91 3CC4Z 1VQ41 3GTJI 3CXCY 3CCQ1 1WCMI 2EGTA 1QVGY 2BJOA 1Q821 4A3BI 2R93I 1VQNZ 3CC7Z 3RZOI 1YIJ1 2QEXZ 3GTOI 2PMZA 1S7MA 3MONA 2QR1B 1VQM1 2VPZA 1VQ91 2JA6I 1SIWA 3CC2Z 3I561 3HOUI 3CXCZ 2W04A 4HGZA 1VQO1 4RVGA 3G71Z 1VQP1 2GTHA 1YIT1 1M1K2 2B63I 1Q861 2QREB 1LQLA 3CCU1 1FDIA 1RLYA 1YHQZ 2H85A 3CMAZ 4CL1A 3S2DI 2HF1A 3HOZI 2VPWA 3CCM1 5IP9I 3CMEZ 2E2HI 3S1MI 3CCUZ 1X3WA 3FKII 2OZKA 3HKZA 2E2JI 2M6NA 1TWCI 1Q811 4E2XA 1VQOZ 3I4MI 2QRCB 2I3CA 1I6HI 3VTNA 1NP6A 1KRLA 4BBRI 1Z03A 4TNUA 3GTQI 2E2II 3PO3S 1X3ZA 5LL6f 1QVGZ 1P9NA 2IZ4A 3MZKB 4NBEA 1DL6A 1Q16A 4E2ZA 4DQYB 3PO2I 4E2WA 1FDOA 2Y0SA 2O4HA 3CCLZ 1WZNA 3OW2Z 2W03A 4RVDA 2F4OA 1S721 1N2FA 4MD8A 4E32A 3IR7A 3TE5B 3CCRZ 3HOVI 1KD12 2JA7I 3J81b 5FLXf 1KC82 4Y7NI 2RHBA 4MONA 3CCJZ 4BBSI 3D2LA 2GTIA 4A3DI 1X0TA 3GKQA 4RS4A 2VUMI 1VQ5Z 1VQL1 1VQ71 1RO2A 4RVFA 4NBDA 1RO0A 1RNIA 3EERA 2OOXB 4MRIA 4NBFA 3G711 1VQPZ 4MXUA 1K9M1 2DE5A 3HOWI 3CD61 3CCE1 3H0GI 3K7AI 2P28A 1QVFZ 4A3EI 1YIJZ 1Y1VS 1YJN1 1JJ2Y 2JIRA 4QTUA 2LEXA 4E33A 1VQK1 4HH4A 3GTGI 2DE7A 2JR6A 3HOXI 3S17I 3KIHA 3J80f 1Q822 1NJI2 2JIOA 3TDHB 2NVTI 1Z01A 2OOYB 4EWCA 3CCL1 1WIIA 2JA5I 3NFZA 1ZB9A 3IFUA 4S1TA 1Y8CA 3RZDI 3M4OI 3GTMS 4NB8A 1YJWZ 1M902 3Q87A 4A3LI 1VQ61 5C44I 2VPYA 2JMOA 4MD9A 3GTKI 3D6WA 2IZ3A 4BY1I 4XX2A 2QKDA 3P5JB 1WW9A 5T64A 1K732 2K5RA 3I4NI 4X6AI 4A3KI 3G4SZ 3S16I 4A3MI 4NBBA 1USPB 2OTLZ 2PM9A 2P3YA 3EEDA 5AN9F 1KQSY 2IV2X 1QYPA 2JNYA 4NFRA 1I3QI 2ZAEB 1VQ4Z 1W2BY 3MZLB 4MD7A 2NVXI 2QLVB 3G6E1 2KI7B 5D1OB 2VPXA 3I07A 3S14I 4RVHA 3QWUA 5CM2M 2G2KA 2QRDB 2OTJZ 4DGLA 4NBCA 5C4XI 1Q7Y1 3I56Z 2OTL1 3HOYI 1K8A1 2WAQA 3F3FC 2GU2A 4E30A 3JAMb 1QVFY 2E9HA 5A2Qb 1VQLZ 3NH5A 1VQN1 1M1K1 3CC71 3IF8A 2R7ZI 2VF1A 3G6EZ 3CQZI 3JAMf 4A93I 3BG0B 3VB9A 2YADA 5IT9f 3CC41 5T67A 3CCS1 1VQ81 2JS4A 2M48A 3IX0A 1NJI1 2QEX1 4E2YA 3CCSZ 1VQ8Z 4QTTA 4BXXI 1W2BZ 2HU9A 4E31A 3CCMZ 5C4JI 5T6BA 4A3JI 2JIMA 2RBLA 1N8R2 4HGYA 4NBAA 1ZH1A 2JUBA 3NDIA 4RV9A 1L1OC 4A3II 3OW2Y 1VQ6Z 3G4S1 1ML8A 1K8A2 1SFOI 1M901 2F4MA 5D1PA 1Y1WI
chains in the Genus database with same CATH topology
2V8KA 3CD6Z 3D9XA 2R6MA 4NOZA 1I50I 2RIQA 1QF8A 1VQ7Z 2WB1A 2V8JA 1KQSZ 3M3YI 2O53A 4BY7I 1YJW1 3CCJ1 1K731 2R92I 4NBHA 1YI2Z 4MH4A 1YJ9Z 2LIYA 2Q51A 3CPWY 1S72Z 4DK1A 1YI21 4A3GI 1KC81 3J81f 3CCR1 1YJNZ 3S15I 1VQ9Z 3GTLI 1R9TI 1Y1VI 2PK7A 1ZB8A 1VQKZ 2V8IA 1YITZ 3S1NI 1PFTA 1USPA 3CCVZ 2DE6A 3FQQA 3I551 1VQ51 1Z02A 5C3EI 4A3CI 3J80b 1VQMZ 1Q7Y2 3PO3I 3VMIA 3FQMA 1Q812 3VMGA 4A3FI 2AKLA 1TWHI 3H3VJ 3GTMI 3ESWA 1TWGI 3J7A4 2RPRA 2J6AA 3GTPI 3CMA1 2JA8I 1YHQ1 1JWHC 1VLAA 4NB9A 5IT9b 3CME1 4NH1C 5A2Qf 3F3PC 3U50C 2QA4Z 1RQFA 5D1OA 4AYBA 3S1QI 1TWAI 3CC21 1RO4A 3S2HI 3CCEZ 3CCV1 3NH4A 5FLXb 2RT9A 2K3RA 3VMHA 2YU9I 1YUAA 2QA41 3I55Z 3LUSA 3BG1B 1Q862 1NUIA 1KD11 4Y52I 1YUKA 2VUGA 1JJ2Z 3NDJA 3S1RI 3KIFA 3T4NB 1K9M2 5FLMI 4NBGA 5IP7I 1TWFI 3NH8A 3CCQZ 1N8R1 2NVQI 2OTJ1 2Q4ZA 3GCFA 1K83I 2KPIA 1TFIA 3CPWZ 2LFUA 2NVYI 1YJ91 3CC4Z 1VQ41 3GTJI 3CXCY 3CCQ1 1WCMI 2EGTA 1QVGY 2BJOA 1Q821 4A3BI 2R93I 1VQNZ 3CC7Z 3RZOI 1YIJ1 2QEXZ 3GTOI 2PMZA 1S7MA 3MONA 2QR1B 1VQM1 1VQ91 2JA6I 3CC2Z 3I561 3HOUI 3CXCZ 2W04A 4HGZA 1VQO1 4RVGA 1VQP1 3G71Z 2GTHA 1YIT1 1M1K2 2B63I 1Q861 2QREB 1LQLA 3CCU1 1RLYA 1YHQZ 2H85A 3CMAZ 4CL1A 3S2DI 2HF1A 3HOZI 3CCM1 5IP9I 3CMEZ 2E2HI 3S1MI 3CCUZ 1X3WA 3FKII 2OZKA 3HKZA 2E2JI 2M6NA 1TWCI 1Q811 4E2XA 1VQOZ 3I4MI 2QRCB 2I3CA 1I6HI 3VTNA 1NP6A 1KRLA 4BBRI 1Z03A 4TNUA 3GTQI 2E2II 3PO3S 1X3ZA 5LL6f 1QVGZ 1P9NA 2IZ4A 3MZKB 4NBEA 1DL6A 4E2ZA 4DQYB 3PO2I 4E2WA 2Y0SA 2O4HA 3CCLZ 3OW2Z 2W03A 4RVDA 2F4OA 1S721 1N2FA 4MD8A 4E32A 3TE5B 3CCRZ 3HOVI 1KD12 2JA7I 3J81b 5FLXf 1KC82 4Y7NI 2RHBA 4MONA 3CCJZ 4BBSI 2GTIA 4A3DI 1X0TA 3GKQA 4RS4A 2VUMI 1VQ5Z 1VQL1 1VQ71 1RO2A 4RVFA 4NBDA 1RO0A 1RNIA 3EERA 2OOXB 4MRIA 4NBFA 3G711 1VQPZ 4MXUA 1K9M1 2DE5A 3HOWI 3CD61 3CCE1 3H0GI 3K7AI 2P28A 1QVFZ 4A3EI 1YIJZ 1Y1VS 1YJN1 1JJ2Y 4QTUA 4E33A 1VQK1 4HH4A 3GTGI 2DE7A 2JR6A 3HOXI 3S17I 3KIHA 3J80f 1Q822 1NJI2 3TDHB 2NVTI 1Z01A 2OOYB 4EWCA 3CCL1 1WIIA 2JA5I 3NFZA 1ZB9A 3IFUA 4S1TA 3M4OI 3RZDI 3GTMS 4NB8A 1YJWZ 1M902 3Q87A 4A3LI 1VQ61 5C44I 2JMOA 4MD9A 3GTKI 3D6WA 2IZ3A 4BY1I 4XX2A 2QKDA 3P5JB 1WW9A 5T64A 1K732 2K5RA 3I4NI 4X6AI 4A3KI 3G4SZ 3S16I 4A3MI 4NBBA 1USPB 2OTLZ 2PM9A 2P3YA 3EEDA 5AN9F 1KQSY 1QYPA 2JNYA 4NFRA 1I3QI 2ZAEB 1VQ4Z 1W2BY 3MZLB 4MD7A 2NVXI 2QLVB 3G6E1 2KI7B 5D1OB 3I07A 3S14I 4RVHA 3QWUA 5CM2M 2G2KA 2QRDB 2OTJZ 4DGLA 4NBCA 5C4XI 1Q7Y1 3I56Z 2OTL1 3HOYI 1K8A1 2WAQA 3F3FC 2GU2A 4E30A 3JAMb 1QVFY 2E9HA 5A2Qb 1VQLZ 3NH5A 1VQN1 1M1K1 3CC71 3IF8A 2R7ZI 2VF1A 3G6EZ 3CQZI 3JAMf 4A93I 3BG0B 3VB9A 2YADA 5IT9f 3CC41 5T67A 3CCS1 1VQ81 2JS4A 2M48A 3IX0A 1NJI1 2QEX1 4E2YA 3CCSZ 1VQ8Z 4QTTA 4BXXI 1W2BZ 2HU9A 4E31A 3CCMZ 5C4JI 5T6BA 4A3JI 2RBLA 1N8R2 4HGYA 4NBAA 1ZH1A 2JUBA 3NDIA 4RV9A 1L1OC 4A3II 3OW2Y 1VQ6Z 3G4S1 1ML8A 1K8A2 1SFOI 1M901 2F4MA 5D1PA 1Y1WI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Z;  3G4S Z;  1KD1 1;  1VQ7 Z;  2OTL Z;  1JJ2 Z;  1KQS Z;  3CCL Z;  3OW2 Z;  1K9M 2;  1KQS Y;  3CCQ Z;  1S72 1;  1N8R 1;  1YJW 1;  3CCJ 1;  1K73 1;  2OTJ 1;  1VQ4 Z;  1W2B Y;  1YI2 Z;  1YJ9 Z;  3CCR Z;  3G6E 1;  1KD1 2;  3CPW Z;  1KC8 2;  3CPW Y;  1YJ9 1;  3CC4 Z;  3CCJ Z;  1VQ4 1;  3CXC Y;  3CCQ 1;  1YI2 1;  1S72 Z;  1KC8 1;  2OTJ Z;  1QVG Y;  1Q82 1;  1VQN Z;  3CCR 1;  1YJN Z;  1Q7Y 1;  1VQ5 Z;  3I56 Z;  3CC7 Z;  1VQ9 Z;  1VQ7 1;  1YIJ 1;  2QEX Z;  1VQL 1;  2OTL 1;  1K8A 1;  1VQK Z;  3G71 1;  1VQP Z;  1K9M 1;  1VQM 1;  1YIT Z;  3CD6 1;  1QVF Y;  3CCE 1;  1VQ9 1;  1VQL Z;  3CCV Z;  1QVF Z;  1VQN 1;  3CC2 Z;  1M1K 1;  1YIJ Z;  3CC7 1;  3I56 1;  3CXC Z;  3I55 1;  1VQ5 1;  1YJN 1;  1JJ2 Y;  1VQO 1;  3G6E Z;  3G71 Z;  1VQP 1;  1VQM Z;  1YIT 1;  1Q7Y 2;  1VQK 1;  1M1K 2;  1Q86 1;  3CC4 1;  3CCU 1;  1Q81 2;  3CCS 1;  1VQ8 1;  1YHQ Z;  3CMA Z;  1Q82 2;  1NJI 2;  3CCM 1;  3CME Z;  2QEX 1;  3CMA 1;  1YHQ 1;  3CCL 1;  3CCS Z;  1VQ8 Z;  3CCU Z;  1W2B Z;  3CME 1;  1Q81 1;  1YJW Z;  3CCM Z;  1M90 2;  2QA4 Z;  1VQ6 1;  1VQO Z;  1N8R 2;  3CC2 1;  3CCE Z;  3CCV 1;  3OW2 Y;  1VQ6 Z;  3G4S 1;  2QA4 1;  3I55 Z;  1K8A 2;  1QVG Z;  1M90 1;  1NJI 1;  1K73 2;  1Q86 2; 
#chains in the Genus database with same CATH topology
 2V8K A;  3CD6 Z;  3D9X A;  2R6M A;  4NOZ A;  1I50 I;  2RIQ A;  1QF8 A;  1VQ7 Z;  2WB1 A;  1WJ2 A;  2AYD A;  2V8J A;  1KQS Z;  3M3Y I;  2O53 A;  4BY7 I;  1YJW 1;  3CCJ 1;  1K73 1;  2R92 I;  4NBH A;  1YI2 Z;  4MH4 A;  1YJ9 Z;  2LIY A;  2Q51 A;  3CPW Y;  1S72 Z;  4DK1 A;  1YI2 1;  4A3G I;  1KC8 1;  3J81 f;  3CCR 1;  1YJN Z;  3S15 I;  1VQ9 Z;  3GTL I;  1R9T I;  1Y1V I;  2PK7 A;  1ZB8 A;  1VQK Z;  2V8I A;  1YIT Z;  2JIQ A;  3S1N I;  1PFT A;  1USP A;  3CCV Z;  2DE6 A;  2V3V A;  3FQQ A;  3I55 1;  1VQ5 1;  1Z02 A;  5C3E I;  4A3C I;  3J80 b;  1VQM Z;  1Q7Y 2;  3PO3 I;  3VMI A;  1AA6 A;  3FQM A;  1Q81 2;  3VMG A;  4A3F I;  2AKL A;  1TWH I;  3H3V J;  3GTM I;  3ESW A;  1TWG I;  3J7A 4;  2RPR A;  2J6A A;  3GTP I;  3CMA 1;  2JA8 I;  1YHQ 1;  1JWH C;  1QXF A;  1VLA A;  4NB9 A;  5IT9 b;  3CME 1;  4NH1 C;  5A2Q f;  3F3P C;  3U50 C;  2QA4 Z;  1RQF A;  5D1O A;  4AYB A;  3S1Q I;  1TWA I;  3CC2 1;  1RO4 A;  3S2H I;  3CCE Z;  3CCV 1;  3NH4 A;  5FLX b;  2RT9 A;  2K3R A;  3VMH A;  2YU9 I;  1YUA A;  2QA4 1;  3I55 Z;  3LUS A;  3BG1 B;  1Q86 2;  1NUI A;  2NAP A;  1KD1 1;  4Y52 I;  1YUK A;  2VUG A;  1JJ2 Z;  3NDJ A;  3S1R I;  3KIF A;  3T4N B;  2JIP A;  1K9M 2;  5FLM I;  4NBG A;  5IP7 I;  1TWF I;  3NH8 A;  3CCQ Z;  1N8R 1;  2NVQ I;  2OTJ 1;  2V45 A;  2Q4Z A;  3GCF A;  1K83 I;  2KPI A;  1TFI A;  3CPW Z;  2E7Z A;  2LFU A;  2NVY I;  1YJ9 1;  3CC4 Z;  1VQ4 1;  3GTJ I;  3CXC Y;  3CCQ 1;  1WCM I;  2EGT A;  1QVG Y;  2BJO A;  1Q82 1;  4A3B I;  2R93 I;  1VQN Z;  3CC7 Z;  3RZO I;  1YIJ 1;  2QEX Z;  3GTO I;  2PMZ A;  1S7M A;  3MON A;  2QR1 B;  1VQM 1;  2VPZ A;  1VQ9 1;  2JA6 I;  1SIW A;  3CC2 Z;  3I56 1;  3HOU I;  3CXC Z;  2W04 A;  4HGZ A;  1VQO 1;  4RVG A;  3G71 Z;  1VQP 1;  2GTH A;  1YIT 1;  1M1K 2;  2B63 I;  1Q86 1;  2QRE B;  1LQL A;  3CCU 1;  1FDI A;  1RLY A;  1YHQ Z;  2H85 A;  3CMA Z;  4CL1 A;  3S2D I;  2HF1 A;  3HOZ I;  2VPW A;  3CCM 1;  5IP9 I;  3CME Z;  2E2H I;  3S1M I;  3CCU Z;  1X3W A;  3FKI I;  2OZK A;  3HKZ A;  2E2J I;  2M6N A;  1TWC I;  1Q81 1;  4E2X A;  1VQO Z;  3I4M I;  2QRC B;  2I3C A;  1I6H I;  3VTN A;  1NP6 A;  1KRL A;  4BBR I;  1Z03 A;  4TNU A;  3GTQ I;  2E2I I;  3PO3 S;  1X3Z A;  5LL6 f;  1QVG Z;  1P9N A;  2IZ4 A;  3MZK B;  4NBE A;  1DL6 A;  1Q16 A;  4E2Z A;  4DQY B;  3PO2 I;  4E2W A;  1FDO A;  2Y0S A;  2O4H A;  3CCL Z;  1WZN A;  3OW2 Z;  2W03 A;  4RVD A;  2F4O A;  1S72 1;  1N2F A;  4MD8 A;  4E32 A;  3IR7 A;  3TE5 B;  3CCR Z;  3HOV I;  1KD1 2;  2JA7 I;  3J81 b;  5FLX f;  1KC8 2;  4Y7N I;  2RHB A;  4MON A;  3CCJ Z;  4BBS I;  3D2L A;  2GTI A;  4A3D I;  1X0T A;  3GKQ A;  4RS4 A;  2VUM I;  1VQ5 Z;  1VQL 1;  1VQ7 1;  1RO2 A;  4RVF A;  4NBD A;  1RO0 A;  1RNI A;  3EER A;  2OOX B;  4MRI A;  4NBF A;  3G71 1;  1VQP Z;  4MXU A;  1K9M 1;  2DE5 A;  3HOW I;  3CD6 1;  3CCE 1;  3H0G I;  3K7A I;  2P28 A;  1QVF Z;  4A3E I;  1YIJ Z;  1Y1V S;  1YJN 1;  1JJ2 Y;  2JIR A;  4QTU A;  2LEX A;  4E33 A;  1VQK 1;  4HH4 A;  3GTG I;  2DE7 A;  2JR6 A;  3HOX I;  3S17 I;  3KIH A;  3J80 f;  1Q82 2;  1NJI 2;  2JIO A;  3TDH B;  2NVT I;  1Z01 A;  2OOY B;  4EWC A;  3CCL 1;  1WII A;  2JA5 I;  3NFZ A;  1ZB9 A;  3IFU A;  4S1T A;  1Y8C A;  3RZD I;  3M4O I;  3GTM S;  4NB8 A;  1YJW Z;  1M90 2;  3Q87 A;  4A3L I;  1VQ6 1;  5C44 I;  2VPY A;  2JMO A;  4MD9 A;  3GTK I;  3D6W A;  2IZ3 A;  4BY1 I;  4XX2 A;  2QKD A;  3P5J B;  1WW9 A;  5T64 A;  1K73 2;  2K5R A;  3I4N I;  4X6A I;  4A3K I;  3G4S Z;  3S16 I;  4A3M I;  4NBB A;  1USP B;  2OTL Z;  2PM9 A;  2P3Y A;  3EED A;  5AN9 F;  1KQS Y;  2IV2 X;  1QYP A;  2JNY A;  4NFR A;  1I3Q I;  2ZAE B;  1VQ4 Z;  1W2B Y;  3MZL B;  4MD7 A;  2NVX I;  2QLV B;  3G6E 1;  2KI7 B;  5D1O B;  2VPX A;  3I07 A;  3S14 I;  4RVH A;  3QWU A;  5CM2 M;  2G2K A;  2QRD B;  2OTJ Z;  4DGL A;  4NBC A;  5C4X I;  1Q7Y 1;  3I56 Z;  2OTL 1;  3HOY I;  1K8A 1;  2WAQ A;  3F3F C;  2GU2 A;  4E30 A;  3JAM b;  1QVF Y;  2E9H A;  5A2Q b;  1VQL Z;  3NH5 A;  1VQN 1;  1M1K 1;  3CC7 1;  3IF8 A;  2R7Z I;  2VF1 A;  3G6E Z;  3CQZ I;  3JAM f;  4A93 I;  3BG0 B;  3VB9 A;  2YAD A;  5IT9 f;  3CC4 1;  5T67 A;  3CCS 1;  1VQ8 1;  2JS4 A;  2M48 A;  3IX0 A;  1NJI 1;  2QEX 1;  4E2Y A;  3CCS Z;  1VQ8 Z;  4QTT A;  4BXX I;  1W2B Z;  2HU9 A;  4E31 A;  3CCM Z;  5C4J I;  5T6B A;  4A3J I;  2JIM A;  2RBL A;  1N8R 2;  4HGY A;  4NBA A;  1ZH1 A;  2JUB A;  3NDI A;  4RV9 A;  1L1O C;  4A3I I;  3OW2 Y;  1VQ6 Z;  3G4S 1;  1ML8 A;  1K8A 2;  1SFO I;  1M90 1;  2F4M A;  5D1P A;  1Y1W I; 
#chains in the Genus database with same CATH homology
 2V8K A;  3CD6 Z;  3D9X A;  2R6M A;  4NOZ A;  1I50 I;  2RIQ A;  1QF8 A;  1VQ7 Z;  2WB1 A;  2V8J A;  1KQS Z;  3M3Y I;  2O53 A;  4BY7 I;  1YJW 1;  3CCJ 1;  1K73 1;  2R92 I;  4NBH A;  1YI2 Z;  4MH4 A;  1YJ9 Z;  2LIY A;  2Q51 A;  3CPW Y;  1S72 Z;  4DK1 A;  1YI2 1;  4A3G I;  1KC8 1;  3J81 f;  3CCR 1;  1YJN Z;  3S15 I;  1VQ9 Z;  3GTL I;  1R9T I;  1Y1V I;  2PK7 A;  1ZB8 A;  1VQK Z;  2V8I A;  1YIT Z;  3S1N I;  1PFT A;  1USP A;  3CCV Z;  2DE6 A;  3FQQ A;  3I55 1;  1VQ5 1;  1Z02 A;  5C3E I;  4A3C I;  3J80 b;  1VQM Z;  1Q7Y 2;  3PO3 I;  3VMI A;  3FQM A;  1Q81 2;  3VMG A;  4A3F I;  2AKL A;  1TWH I;  3H3V J;  3GTM I;  3ESW A;  1TWG I;  3J7A 4;  2RPR A;  2J6A A;  3GTP I;  3CMA 1;  2JA8 I;  1YHQ 1;  1JWH C;  1VLA A;  4NB9 A;  5IT9 b;  3CME 1;  4NH1 C;  5A2Q f;  3F3P C;  3U50 C;  2QA4 Z;  1RQF A;  5D1O A;  4AYB A;  3S1Q I;  1TWA I;  3CC2 1;  1RO4 A;  3S2H I;  3CCE Z;  3CCV 1;  3NH4 A;  5FLX b;  2RT9 A;  2K3R A;  3VMH A;  2YU9 I;  1YUA A;  2QA4 1;  3I55 Z;  3LUS A;  3BG1 B;  1Q86 2;  1NUI A;  1KD1 1;  4Y52 I;  1YUK A;  2VUG A;  1JJ2 Z;  3NDJ A;  3S1R I;  3KIF A;  3T4N B;  1K9M 2;  5FLM I;  4NBG A;  5IP7 I;  1TWF I;  3NH8 A;  3CCQ Z;  1N8R 1;  2NVQ I;  2OTJ 1;  2Q4Z A;  3GCF A;  1K83 I;  2KPI A;  1TFI A;  3CPW Z;  2LFU A;  2NVY I;  1YJ9 1;  3CC4 Z;  1VQ4 1;  3GTJ I;  3CXC Y;  3CCQ 1;  1WCM I;  2EGT A;  1QVG Y;  2BJO A;  1Q82 1;  4A3B I;  2R93 I;  1VQN Z;  3CC7 Z;  3RZO I;  1YIJ 1;  2QEX Z;  3GTO I;  2PMZ A;  1S7M A;  3MON A;  2QR1 B;  1VQM 1;  1VQ9 1;  2JA6 I;  3CC2 Z;  3I56 1;  3HOU I;  3CXC Z;  2W04 A;  4HGZ A;  1VQO 1;  4RVG A;  1VQP 1;  3G71 Z;  2GTH A;  1YIT 1;  1M1K 2;  2B63 I;  1Q86 1;  2QRE B;  1LQL A;  3CCU 1;  1RLY A;  1YHQ Z;  2H85 A;  3CMA Z;  4CL1 A;  3S2D I;  2HF1 A;  3HOZ I;  3CCM 1;  5IP9 I;  3CME Z;  2E2H I;  3S1M I;  3CCU Z;  1X3W A;  3FKI I;  2OZK A;  3HKZ A;  2E2J I;  2M6N A;  1TWC I;  1Q81 1;  4E2X A;  1VQO Z;  3I4M I;  2QRC B;  2I3C A;  1I6H I;  3VTN A;  1NP6 A;  1KRL A;  4BBR I;  1Z03 A;  4TNU A;  3GTQ I;  2E2I I;  3PO3 S;  1X3Z A;  5LL6 f;  1QVG Z;  1P9N A;  2IZ4 A;  3MZK B;  4NBE A;  1DL6 A;  4E2Z A;  4DQY B;  3PO2 I;  4E2W A;  2Y0S A;  2O4H A;  3CCL Z;  3OW2 Z;  2W03 A;  4RVD A;  2F4O A;  1S72 1;  1N2F A;  4MD8 A;  4E32 A;  3TE5 B;  3CCR Z;  3HOV I;  1KD1 2;  2JA7 I;  3J81 b;  5FLX f;  1KC8 2;  4Y7N I;  2RHB A;  4MON A;  3CCJ Z;  4BBS I;  2GTI A;  4A3D I;  1X0T A;  3GKQ A;  4RS4 A;  2VUM I;  1VQ5 Z;  1VQL 1;  1VQ7 1;  1RO2 A;  4RVF A;  4NBD A;  1RO0 A;  1RNI A;  3EER A;  2OOX B;  4MRI A;  4NBF A;  3G71 1;  1VQP Z;  4MXU A;  1K9M 1;  2DE5 A;  3HOW I;  3CD6 1;  3CCE 1;  3H0G I;  3K7A I;  2P28 A;  1QVF Z;  4A3E I;  1YIJ Z;  1Y1V S;  1YJN 1;  1JJ2 Y;  4QTU A;  4E33 A;  1VQK 1;  4HH4 A;  3GTG I;  2DE7 A;  2JR6 A;  3HOX I;  3S17 I;  3KIH A;  3J80 f;  1Q82 2;  1NJI 2;  3TDH B;  2NVT I;  1Z01 A;  2OOY B;  4EWC A;  3CCL 1;  1WII A;  2JA5 I;  3NFZ A;  1ZB9 A;  3IFU A;  4S1T A;  3M4O I;  3RZD I;  3GTM S;  4NB8 A;  1YJW Z;  1M90 2;  3Q87 A;  4A3L I;  1VQ6 1;  5C44 I;  2JMO A;  4MD9 A;  3GTK I;  3D6W A;  2IZ3 A;  4BY1 I;  4XX2 A;  2QKD A;  3P5J B;  1WW9 A;  5T64 A;  1K73 2;  2K5R A;  3I4N I;  4X6A I;  4A3K I;  3G4S Z;  3S16 I;  4A3M I;  4NBB A;  1USP B;  2OTL Z;  2PM9 A;  2P3Y A;  3EED A;  5AN9 F;  1KQS Y;  1QYP A;  2JNY A;  4NFR A;  1I3Q I;  2ZAE B;  1VQ4 Z;  1W2B Y;  3MZL B;  4MD7 A;  2NVX I;  2QLV B;  3G6E 1;  2KI7 B;  5D1O B;  3I07 A;  3S14 I;  4RVH A;  3QWU A;  5CM2 M;  2G2K A;  2QRD B;  2OTJ Z;  4DGL A;  4NBC A;  5C4X I;  1Q7Y 1;  3I56 Z;  2OTL 1;  3HOY I;  1K8A 1;  2WAQ A;  3F3F C;  2GU2 A;  4E30 A;  3JAM b;  1QVF Y;  2E9H A;  5A2Q b;  1VQL Z;  3NH5 A;  1VQN 1;  1M1K 1;  3CC7 1;  3IF8 A;  2R7Z I;  2VF1 A;  3G6E Z;  3CQZ I;  3JAM f;  4A93 I;  3BG0 B;  3VB9 A;  2YAD A;  5IT9 f;  3CC4 1;  5T67 A;  3CCS 1;  1VQ8 1;  2JS4 A;  2M48 A;  3IX0 A;  1NJI 1;  2QEX 1;  4E2Y A;  3CCS Z;  1VQ8 Z;  4QTT A;  4BXX I;  1W2B Z;  2HU9 A;  4E31 A;  3CCM Z;  5C4J I;  5T6B A;  4A3J I;  2RBL A;  1N8R 2;  4HGY A;  4NBA A;  1ZH1 A;  2JUB A;  3NDI A;  4RV9 A;  1L1O C;  4A3I I;  3OW2 Y;  1VQ6 Z;  3G4S 1;  1ML8 A;  1K8A 2;  1SFO I;  1M90 1;  2F4M A;  5D1P A;  1Y1W I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...