1VQOZ

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqoZ00
2QA4Z 2OTJ1 1YJN1 3CCE1 3CME1 1Q812 3I55Z 2OTL1 1Q7Y2 3CCRZ 3CC41 3CCQZ 1YITZ 3CCV1 1YJ9Z 3CC7Z 1QVGY 3CCM1 3CCUZ 1NJI1 1KC81 2QEXZ 1VQM1 1S721 3CC21 3CCJ1 3CCSZ 1YJWZ 1KD11 3CMA1 1VQNZ 1YHQ1 1M1K1 1VQ8Z 1N8R2 3G4S1 1K9M1 1VQ9Z 1VQ51 3CCLZ 1VQPZ 3I561 1VQ71 1YI2Z 1YJ91 1KQSZ 1VQO1 1VQ61 1Q821 1KQSY 3CD61 1YJNZ 3G711 3CCEZ 3CMEZ 2OTJZ 1VQ41 3CCU1 2OTLZ 2QEX1 1M901 1YJW1 1NJI2 1K8A1 1KC82 3CC4Z 3G6E1 3CCVZ 1YIJ1 1KD12 1VQKZ 2QA41 1Q861 1K731 3CCMZ 1M1K2 1JJ2Z 3I551 1JJ2Y 1K9M2 1VQMZ 1S72Z 3CMAZ 3CC2Z 3CCR1 3CCQ1 1YIT1 1W2BZ 3CPWZ 3CC71 1VQLZ 1YHQZ 3CPWY 3CXCZ 3G4SZ 1Q7Y1 3CXCY 1VQ5Z 3CCS1 1Q822 1VQN1 3I56Z 1VQ7Z 1VQ81 1M902 1QVGZ 1K8A2 1VQK1 1VQ91 1VQOZ 1VQ6Z 3CD6Z 3G71Z 3CCL1 1VQ4Z 1Q862 3CCJZ 1K732 3OW2Z 1VQP1 1YI21 3OW2Y 1N8R1 1Q811 1W2BY 1QVFZ 3G6EZ 1QVFY 1YIJZ 1VQL1
chains in the Genus database with same CATH superfamily
1LQLA 2OTJ1 2Y0SA 4QTUA 1Q812 2JIOA 2OTL1 3T4NB 3S1NI 4RVHA 1Y1VS 3J81f 4NBAA 1YITZ 2YU9I 3CC7Z 4A3DI 4A3GI 2JUBA 2OZKA 2ZAEB 2JMOA 4A3LI 3CCUZ 2GU2A 1NJI1 3GTPI 2I3CA 2JNYA 3S1RI 1VQM1 4HH4A 1S721 3CC21 1JWHC 2DE6A 1YUKA 3MONA 1KD11 3IF8A 2KI7B 2R93I 1TWCI 5C3EI 1YHQ1 2F4MA 4A3CI 1N8R2 1K9M1 3PO3S 1VQ51 1VLAA 2H85A 1NUIA 3CCLZ 3JAMb 2VPYA 1NP6A 1K83I 2M6NA 1VQPZ 1KRLA 1YI2Z 2VPZA 1TWHI 2Q4ZA 3D2LA 2K3RA 1YJ91 3HKZA 3QWUA 1Q821 1YJNZ 3G711 3BG0B 4HGZA 4NOZA 1YJW1 3IX0A 4NBDA 3H3VJ 1AA6A 3CCVZ 1Z02A 1VQKZ 4QTTA 1K731 3S16I 3GTQI 2JIPA 3NH5A 1ZH1A 2V45A 1YIT1 3CPWZ 3CC71 2BJOA 3CPWY 4Y52I 2QREB 4A3MI 1WW9A 3G4SZ 3GKQA 3D6WA 5C4XI 1Q7Y1 3JAMf 3I07A 3RZDI 4RVGA 3I56Z 4A3II 4TNUA 1X3ZA 2HU9A 1M902 4E2YA 2V3VA 3CCL1 2JA8I 3MZKB 4E2XA 3OW2Z 1VQP1 4MD7A 1L1OC 1YI21 3OW2Y 2G2KA 3VMIA 2QKDA 4E2ZA 1USPB 1YIJZ 2QA4Z 2JA6I 3S15I 1YJN1 3VB9A 3I55Z 1FDOA 1P9NA 3CCRZ 2JA7I 5AN9F 3NDJA 3CCV1 1R9TI 1YJ9Z 3NH8A 1QVGY 2LEXA 2JS4A 5FLXb 2NVQI 3VMGA 1TWGI 3TDHB 1KC81 1ZB9A 4A3EI 3CCJ1 1YJWZ 3HOXI 4S1TA 1M1K1 1VQ8Z 1PFTA 2AYDA 3IR7A 3G4S1 2RPRA 3FKII 1Y1WI 3NDIA 2OOXB 3GTJI 3GTOI 4E32A 3I561 3CQZI 3Q87A 4MONA 4NH1C 3GTMI 3MZLB 4A3JI 3NFZA 3CMEZ 3I4MI 3BG1B 2JIQA 5IT9b 5C4JI 3CC4Z 1YIJ1 2QA41 1Q861 1SIWA 1RO2A 2LFUA 5FLXf 3I551 3U50C 5T6BA 1S7MA 1QYPA 2QR1B 2VUMI 3CCR1 4NFRA 4BBSI 1W2BZ 3KIHA 5CM2M 4MXUA 2NVTI 4XX2A 2QLVB 3GTMS 2GTHA 4BXXI 3S17I 2JR6A 2VUGA 2P28A 2Q51A 3GCFA 1QXFA 1QF8A 1Z01A 1VQ81 1K8A2 1VQ6Z 1YUAA 2WB1A 3CD6Z 4NBGA 3KIFA 3S2DI 5D1OB 5T64A 3CCJZ 4A3BI 4NBEA 5D1PA 1N8R1 5IT9f 1RNIA 3J7A4 3G6EZ 3IFUA 2OOYB 5LL6f 3CME1 2RIQA 2QRDB 1TWFI 3CC41 2PMZA 3CCQZ 4RS4A 5IP9I 4X6AI 1I3QI 2R7ZI 1X0TA 2J6AA 4DGLA 2V8IA 3J80b 3HOUI 1WJ2A 1VQNZ 2PM9A 3RZOI 4DQYB 2HF1A 1VQ9Z 4NBCA 1N2FA 4E33A 2GTIA 2O53A 4AYBA 4EWCA 3ESWA 3HOYI 1VQ61 5C44I 2NVYI 3CD61 3CCEZ 3FQQA 2E2HI 2QEX1 1M901 1NJI2 3EEDA 3G6E1 3EERA 4A3FI 1KD12 1ML8A 3CCMZ 1JJ2Z 2P3YA 1JJ2Y 3J80f 1K9M2 3GTGI 2IV2X 4BY7I 3CMAZ 3S1QI 1Z03A 3CCQ1 2LIYA 2VPXA 2V8JA 5T67A 4RV9A 3CXCZ 3CXCY 1I50I 1USPA 2RBLA 1SFOI 1Q822 3I4NI 1VQN1 1VQ7Z 4HGYA 1X3WA 3HOWI 2KPIA 1VQ91 1VQOZ 1RQFA 2VPWA 2JA5I 2RHBA 1VQ4Z 1DL6A 2EGTA 3S14I 1K732 4MD8A 1RO0A 2DE7A 1Q811 3M3YI 1W2BY 2IZ3A 4CL1A 2JIRA 3HOZI 1VQL1 2RT9A 2DE5A 3CCE1 4MD9A 2R92I 2O4HA 2F4OA 1Q7Y2 2QRCB 3PO2I 2M48A 2E7ZA 4NB9A 1TWAI 4BBRI 2E9HA 3VTNA 3CCM1 4A3KI 2QEXZ 3H0GI 5A2Qb 4NBFA 3CCSZ 3CMA1 2E2II 4E31A 3K7AI 2NAPA 4MH4A 3TE5B 3GTLI 2IZ4A 4NBHA 3LUSA 4E30A 4RVFA 1VQ71 4NBBA 3F3PC 1RO4A 2JIMA 2W04A 1KQSZ 2K5RA 1VQO1 2OTJZ 1KQSY 1VQ41 1FDIA 3CCU1 2OTLZ 4RVDA 2B63I 1K8A1 1KC82 2PK7A 2YADA 2AKLA 3S1MI 1Q16A 1M1K2 2W03A 4BY1I 5A2Qf 1VQMZ 2E2JI 2NVXI 1S72Z 5FLMI 3CC2Z 3M4OI 1WCMI 3J81b 4MRIA 1I6HI 5D1OA 1VQLZ 1YHQZ 1RLYA 5IP7I 4A93I 1VQ5Z 4E2WA 1WZNA 1Y1VI 4Y7NI 3CCS1 3S2HI 1WIIA 2WAQA 1ZB8A 3VMHA 1QVGZ 1VQK1 3F3FC 3D9XA 3HOVI 3G71Z 1Q862 3FQMA 3GTKI 1TFIA 2VF1A 1Y8CA 3P5JB 4NB8A 3NH4A 4DK1A 2V8KA 1QVFZ 3PO3I 2R6MA 1QVFY
chains in the Genus database with same CATH topology
1LQLA 2OTJ1 2Y0SA 4QTUA 1Q812 2OTL1 3T4NB 3S1NI 4RVHA 1Y1VS 3J81f 4NBAA 1YITZ 2YU9I 3CC7Z 4A3DI 4A3GI 2JUBA 2OZKA 2ZAEB 2JMOA 4A3LI 3CCUZ 2GU2A 1NJI1 3GTPI 2I3CA 2JNYA 3S1RI 1VQM1 4HH4A 1S721 3CC21 1JWHC 2DE6A 1YUKA 3MONA 1KD11 3IF8A 2KI7B 2R93I 1TWCI 5C3EI 1YHQ1 2F4MA 4A3CI 1N8R2 1K9M1 3PO3S 1VQ51 1VLAA 2H85A 1NUIA 3CCLZ 3JAMb 1NP6A 1K83I 2M6NA 1VQPZ 1KRLA 1YI2Z 1TWHI 2Q4ZA 2K3RA 1YJ91 3HKZA 3QWUA 1Q821 1YJNZ 3G711 3BG0B 4HGZA 4NOZA 1YJW1 3IX0A 4NBDA 3H3VJ 3CCVZ 1Z02A 1VQKZ 4QTTA 1K731 3S16I 3GTQI 3NH5A 1ZH1A 1YIT1 3CPWZ 3CC71 2BJOA 3CPWY 4Y52I 2QREB 4A3MI 1WW9A 3G4SZ 3GKQA 3D6WA 5C4XI 1Q7Y1 3JAMf 3I07A 3RZDI 4RVGA 3I56Z 4A3II 4TNUA 1X3ZA 2HU9A 1M902 4E2YA 3CCL1 2JA8I 3MZKB 4E2XA 3OW2Z 1VQP1 4MD7A 1L1OC 1YI21 3OW2Y 2G2KA 3VMIA 2QKDA 4E2ZA 1USPB 1YIJZ 2QA4Z 2JA6I 3S15I 1YJN1 3VB9A 3I55Z 1P9NA 3CCRZ 2JA7I 5AN9F 3NDJA 3CCV1 1R9TI 1YJ9Z 3NH8A 1QVGY 2JS4A 5FLXb 2NVQI 3VMGA 1TWGI 3TDHB 1KC81 1ZB9A 4A3EI 3CCJ1 1YJWZ 3HOXI 4S1TA 1M1K1 1VQ8Z 1PFTA 3G4S1 2RPRA 3FKII 1Y1WI 3NDIA 2OOXB 3GTJI 3GTOI 4E32A 3I561 3CQZI 3Q87A 4MONA 4NH1C 3GTMI 3MZLB 4A3JI 3NFZA 3CMEZ 3I4MI 3BG1B 5IT9b 5C4JI 3CC4Z 1YIJ1 2QA41 1Q861 1RO2A 2LFUA 5FLXf 3I551 3U50C 5T6BA 1S7MA 1QYPA 2QR1B 2VUMI 3CCR1 4NFRA 4BBSI 1W2BZ 3KIHA 5CM2M 4MXUA 2NVTI 4XX2A 2QLVB 3GTMS 2GTHA 4BXXI 3S17I 2JR6A 2VUGA 2P28A 2Q51A 3GCFA 1QF8A 1Z01A 1VQ81 1K8A2 1VQ6Z 1YUAA 2WB1A 3CD6Z 4NBGA 3KIFA 3S2DI 5D1OB 5T64A 3CCJZ 4A3BI 4NBEA 5D1PA 1N8R1 5IT9f 1RNIA 3J7A4 3G6EZ 3IFUA 2OOYB 5LL6f 3CME1 2RIQA 2QRDB 1TWFI 3CC41 2PMZA 3CCQZ 4RS4A 5IP9I 4X6AI 1I3QI 2R7ZI 1X0TA 2J6AA 4DGLA 2V8IA 3J80b 3HOUI 1VQNZ 2PM9A 3RZOI 4DQYB 2HF1A 1VQ9Z 4NBCA 1N2FA 4E33A 2GTIA 2O53A 4AYBA 4EWCA 3ESWA 3HOYI 1VQ61 5C44I 2NVYI 3CD61 3CCEZ 3FQQA 2E2HI 2QEX1 1M901 1NJI2 3EEDA 3G6E1 3EERA 4A3FI 1KD12 1ML8A 3CCMZ 1JJ2Z 2P3YA 1JJ2Y 3J80f 1K9M2 3GTGI 4BY7I 3CMAZ 3S1QI 1Z03A 3CCQ1 2LIYA 2V8JA 5T67A 4RV9A 3CXCZ 3CXCY 1I50I 1USPA 2RBLA 1SFOI 1Q822 3I4NI 1VQN1 1VQ7Z 4HGYA 1X3WA 3HOWI 2KPIA 1VQ91 1VQOZ 1RQFA 2JA5I 2RHBA 1VQ4Z 1DL6A 2EGTA 3S14I 1K732 4MD8A 1RO0A 2DE7A 1Q811 3M3YI 1W2BY 2IZ3A 4CL1A 3HOZI 1VQL1 2RT9A 2DE5A 3CCE1 4MD9A 2R92I 2O4HA 2F4OA 1Q7Y2 2QRCB 3PO2I 2M48A 4NB9A 1TWAI 4BBRI 2E9HA 3VTNA 3CCM1 4A3KI 2QEXZ 3H0GI 5A2Qb 4NBFA 3CCSZ 3CMA1 2E2II 4E31A 3K7AI 4MH4A 3TE5B 3GTLI 2IZ4A 4NBHA 3LUSA 4E30A 4RVFA 1VQ71 4NBBA 3F3PC 1RO4A 2W04A 1KQSZ 2K5RA 1VQO1 2OTJZ 1KQSY 1VQ41 3CCU1 2OTLZ 4RVDA 2B63I 1K8A1 1KC82 2PK7A 2YADA 2AKLA 3S1MI 1M1K2 2W03A 4BY1I 5A2Qf 1VQMZ 2E2JI 2NVXI 1S72Z 5FLMI 3CC2Z 3M4OI 1WCMI 3J81b 4MRIA 1I6HI 5D1OA 1VQLZ 1YHQZ 1RLYA 5IP7I 4A93I 1VQ5Z 4E2WA 1Y1VI 4Y7NI 3CCS1 3S2HI 1WIIA 2WAQA 1ZB8A 3VMHA 1QVGZ 1VQK1 3F3FC 3D9XA 3HOVI 3G71Z 1Q862 3FQMA 3GTKI 1TFIA 2VF1A 3P5JB 4NB8A 3NH4A 4DK1A 2V8KA 1QVFZ 3PO3I 2R6MA 1QVFY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  2OTJ 1;  1YJN 1;  3CCE 1;  3CME 1;  1Q81 2;  3I55 Z;  2OTL 1;  1Q7Y 2;  3CCR Z;  3CC4 1;  3CCQ Z;  1YIT Z;  3CCV 1;  1YJ9 Z;  3CC7 Z;  1QVG Y;  3CCM 1;  3CCU Z;  1NJI 1;  1KC8 1;  2QEX Z;  1VQM 1;  1S72 1;  3CC2 1;  3CCJ 1;  3CCS Z;  1YJW Z;  1KD1 1;  3CMA 1;  1VQN Z;  1YHQ 1;  1M1K 1;  1VQ8 Z;  1N8R 2;  3G4S 1;  1K9M 1;  1VQ9 Z;  1VQ5 1;  3CCL Z;  1VQP Z;  3I56 1;  1VQ7 1;  1YI2 Z;  1YJ9 1;  1KQS Z;  1VQO 1;  1VQ6 1;  1Q82 1;  1KQS Y;  3CD6 1;  1YJN Z;  3G71 1;  3CCE Z;  3CME Z;  2OTJ Z;  1VQ4 1;  3CCU 1;  2OTL Z;  2QEX 1;  1M90 1;  1YJW 1;  1NJI 2;  1K8A 1;  1KC8 2;  3CC4 Z;  3G6E 1;  3CCV Z;  1YIJ 1;  1KD1 2;  1VQK Z;  2QA4 1;  1Q86 1;  1K73 1;  3CCM Z;  1M1K 2;  1JJ2 Z;  3I55 1;  1JJ2 Y;  1K9M 2;  1VQM Z;  1S72 Z;  3CMA Z;  3CC2 Z;  3CCR 1;  3CCQ 1;  1YIT 1;  1W2B Z;  3CPW Z;  3CC7 1;  1VQL Z;  1YHQ Z;  3CPW Y;  3CXC Z;  3G4S Z;  1Q7Y 1;  3CXC Y;  1VQ5 Z;  3CCS 1;  1Q82 2;  1VQN 1;  3I56 Z;  1VQ7 Z;  1VQ8 1;  1M90 2;  1QVG Z;  1K8A 2;  1VQK 1;  1VQ9 1;  1VQO Z;  1VQ6 Z;  3CD6 Z;  3G71 Z;  3CCL 1;  1VQ4 Z;  1Q86 2;  3CCJ Z;  1K73 2;  3OW2 Z;  1VQP 1;  1YI2 1;  3OW2 Y;  1N8R 1;  1Q81 1;  1W2B Y;  1QVF Z;  3G6E Z;  1QVF Y;  1YIJ Z;  1VQL 1; 
#chains in the Genus database with same CATH topology
 1LQL A;  2OTJ 1;  2Y0S A;  4QTU A;  1Q81 2;  2JIO A;  2OTL 1;  3T4N B;  3S1N I;  4RVH A;  1Y1V S;  3J81 f;  4NBA A;  1YIT Z;  2YU9 I;  3CC7 Z;  4A3D I;  4A3G I;  2JUB A;  2OZK A;  2ZAE B;  2JMO A;  4A3L I;  3CCU Z;  2GU2 A;  1NJI 1;  3GTP I;  2I3C A;  2JNY A;  3S1R I;  1VQM 1;  4HH4 A;  1S72 1;  3CC2 1;  1JWH C;  2DE6 A;  1YUK A;  3MON A;  1KD1 1;  3IF8 A;  2KI7 B;  2R93 I;  1TWC I;  5C3E I;  1YHQ 1;  2F4M A;  4A3C I;  1N8R 2;  1K9M 1;  3PO3 S;  1VQ5 1;  1VLA A;  2H85 A;  1NUI A;  3CCL Z;  3JAM b;  2VPY A;  1NP6 A;  1K83 I;  2M6N A;  1VQP Z;  1KRL A;  1YI2 Z;  2VPZ A;  1TWH I;  2Q4Z A;  3D2L A;  2K3R A;  1YJ9 1;  3HKZ A;  3QWU A;  1Q82 1;  1YJN Z;  3G71 1;  3BG0 B;  4HGZ A;  4NOZ A;  1YJW 1;  3IX0 A;  4NBD A;  3H3V J;  1AA6 A;  3CCV Z;  1Z02 A;  1VQK Z;  4QTT A;  1K73 1;  3S16 I;  3GTQ I;  2JIP A;  3NH5 A;  1ZH1 A;  2V45 A;  1YIT 1;  3CPW Z;  3CC7 1;  2BJO A;  3CPW Y;  4Y52 I;  2QRE B;  4A3M I;  1WW9 A;  3G4S Z;  3GKQ A;  3D6W A;  5C4X I;  1Q7Y 1;  3JAM f;  3I07 A;  3RZD I;  4RVG A;  3I56 Z;  4A3I I;  4TNU A;  1X3Z A;  2HU9 A;  1M90 2;  4E2Y A;  2V3V A;  3CCL 1;  2JA8 I;  3MZK B;  4E2X A;  3OW2 Z;  1VQP 1;  4MD7 A;  1L1O C;  1YI2 1;  3OW2 Y;  2G2K A;  3VMI A;  2QKD A;  4E2Z A;  1USP B;  1YIJ Z;  2QA4 Z;  2JA6 I;  3S15 I;  1YJN 1;  3VB9 A;  3I55 Z;  1FDO A;  1P9N A;  3CCR Z;  2JA7 I;  5AN9 F;  3NDJ A;  3CCV 1;  1R9T I;  1YJ9 Z;  3NH8 A;  1QVG Y;  2LEX A;  2JS4 A;  5FLX b;  2NVQ I;  3VMG A;  1TWG I;  3TDH B;  1KC8 1;  1ZB9 A;  4A3E I;  3CCJ 1;  1YJW Z;  3HOX I;  4S1T A;  1M1K 1;  1VQ8 Z;  1PFT A;  2AYD A;  3IR7 A;  3G4S 1;  2RPR A;  3FKI I;  1Y1W I;  3NDI A;  2OOX B;  3GTJ I;  3GTO I;  4E32 A;  3I56 1;  3CQZ I;  3Q87 A;  4MON A;  4NH1 C;  3GTM I;  3MZL B;  4A3J I;  3NFZ A;  3CME Z;  3I4M I;  3BG1 B;  2JIQ A;  5IT9 b;  5C4J I;  3CC4 Z;  1YIJ 1;  2QA4 1;  1Q86 1;  1SIW A;  1RO2 A;  2LFU A;  5FLX f;  3I55 1;  3U50 C;  5T6B A;  1S7M A;  1QYP A;  2QR1 B;  2VUM I;  3CCR 1;  4NFR A;  4BBS I;  1W2B Z;  3KIH A;  5CM2 M;  4MXU A;  2NVT I;  4XX2 A;  2QLV B;  3GTM S;  2GTH A;  4BXX I;  3S17 I;  2JR6 A;  2VUG A;  2P28 A;  2Q51 A;  3GCF A;  1QXF A;  1QF8 A;  1Z01 A;  1VQ8 1;  1K8A 2;  1VQ6 Z;  1YUA A;  2WB1 A;  3CD6 Z;  4NBG A;  3KIF A;  3S2D I;  5D1O B;  5T64 A;  3CCJ Z;  4A3B I;  4NBE A;  5D1P A;  1N8R 1;  5IT9 f;  1RNI A;  3J7A 4;  3G6E Z;  3IFU A;  2OOY B;  5LL6 f;  3CME 1;  2RIQ A;  2QRD B;  1TWF I;  3CC4 1;  2PMZ A;  3CCQ Z;  4RS4 A;  5IP9 I;  4X6A I;  1I3Q I;  2R7Z I;  1X0T A;  2J6A A;  4DGL A;  2V8I A;  3J80 b;  3HOU I;  1WJ2 A;  1VQN Z;  2PM9 A;  3RZO I;  4DQY B;  2HF1 A;  1VQ9 Z;  4NBC A;  1N2F A;  4E33 A;  2GTI A;  2O53 A;  4AYB A;  4EWC A;  3ESW A;  3HOY I;  1VQ6 1;  5C44 I;  2NVY I;  3CD6 1;  3CCE Z;  3FQQ A;  2E2H I;  2QEX 1;  1M90 1;  1NJI 2;  3EED A;  3G6E 1;  3EER A;  4A3F I;  1KD1 2;  1ML8 A;  3CCM Z;  1JJ2 Z;  2P3Y A;  1JJ2 Y;  3J80 f;  1K9M 2;  3GTG I;  2IV2 X;  4BY7 I;  3CMA Z;  3S1Q I;  1Z03 A;  3CCQ 1;  2LIY A;  2VPX A;  2V8J A;  5T67 A;  4RV9 A;  3CXC Z;  3CXC Y;  1I50 I;  1USP A;  2RBL A;  1SFO I;  1Q82 2;  3I4N I;  1VQN 1;  1VQ7 Z;  4HGY A;  1X3W A;  3HOW I;  2KPI A;  1VQ9 1;  1VQO Z;  1RQF A;  2VPW A;  2JA5 I;  2RHB A;  1VQ4 Z;  1DL6 A;  2EGT A;  3S14 I;  1K73 2;  4MD8 A;  1RO0 A;  2DE7 A;  1Q81 1;  3M3Y I;  1W2B Y;  2IZ3 A;  4CL1 A;  2JIR A;  3HOZ I;  1VQL 1;  2RT9 A;  2DE5 A;  3CCE 1;  4MD9 A;  2R92 I;  2O4H A;  2F4O A;  1Q7Y 2;  2QRC B;  3PO2 I;  2M48 A;  2E7Z A;  4NB9 A;  1TWA I;  4BBR I;  2E9H A;  3VTN A;  3CCM 1;  4A3K I;  2QEX Z;  3H0G I;  5A2Q b;  4NBF A;  3CCS Z;  3CMA 1;  2E2I I;  4E31 A;  3K7A I;  2NAP A;  4MH4 A;  3TE5 B;  3GTL I;  2IZ4 A;  4NBH A;  3LUS A;  4E30 A;  4RVF A;  1VQ7 1;  4NBB A;  3F3P C;  1RO4 A;  2JIM A;  2W04 A;  1KQS Z;  2K5R A;  1VQO 1;  2OTJ Z;  1KQS Y;  1VQ4 1;  1FDI A;  3CCU 1;  2OTL Z;  4RVD A;  2B63 I;  1K8A 1;  1KC8 2;  2PK7 A;  2YAD A;  2AKL A;  3S1M I;  1Q16 A;  1M1K 2;  2W03 A;  4BY1 I;  5A2Q f;  1VQM Z;  2E2J I;  2NVX I;  1S72 Z;  5FLM I;  3CC2 Z;  3M4O I;  1WCM I;  3J81 b;  4MRI A;  1I6H I;  5D1O A;  1VQL Z;  1YHQ Z;  1RLY A;  5IP7 I;  4A93 I;  1VQ5 Z;  4E2W A;  1WZN A;  1Y1V I;  4Y7N I;  3CCS 1;  3S2H I;  1WII A;  2WAQ A;  1ZB8 A;  3VMH A;  1QVG Z;  1VQK 1;  3F3F C;  3D9X A;  3HOV I;  3G71 Z;  1Q86 2;  3FQM A;  3GTK I;  1TFI A;  2VF1 A;  1Y8C A;  3P5J B;  4NB8 A;  3NH4 A;  4DK1 A;  2V8K A;  1QVF Z;  3PO3 I;  2R6M A;  1QVF Y; 
#chains in the Genus database with same CATH homology
 1LQL A;  2OTJ 1;  2Y0S A;  4QTU A;  1Q81 2;  2OTL 1;  3T4N B;  3S1N I;  4RVH A;  1Y1V S;  3J81 f;  4NBA A;  1YIT Z;  2YU9 I;  3CC7 Z;  4A3D I;  4A3G I;  2JUB A;  2OZK A;  2ZAE B;  2JMO A;  4A3L I;  3CCU Z;  2GU2 A;  1NJI 1;  3GTP I;  2I3C A;  2JNY A;  3S1R I;  1VQM 1;  4HH4 A;  1S72 1;  3CC2 1;  1JWH C;  2DE6 A;  1YUK A;  3MON A;  1KD1 1;  3IF8 A;  2KI7 B;  2R93 I;  1TWC I;  5C3E I;  1YHQ 1;  2F4M A;  4A3C I;  1N8R 2;  1K9M 1;  3PO3 S;  1VQ5 1;  1VLA A;  2H85 A;  1NUI A;  3CCL Z;  3JAM b;  1NP6 A;  1K83 I;  2M6N A;  1VQP Z;  1KRL A;  1YI2 Z;  1TWH I;  2Q4Z A;  2K3R A;  1YJ9 1;  3HKZ A;  3QWU A;  1Q82 1;  1YJN Z;  3G71 1;  3BG0 B;  4HGZ A;  4NOZ A;  1YJW 1;  3IX0 A;  4NBD A;  3H3V J;  3CCV Z;  1Z02 A;  1VQK Z;  4QTT A;  1K73 1;  3S16 I;  3GTQ I;  3NH5 A;  1ZH1 A;  1YIT 1;  3CPW Z;  3CC7 1;  2BJO A;  3CPW Y;  4Y52 I;  2QRE B;  4A3M I;  1WW9 A;  3G4S Z;  3GKQ A;  3D6W A;  5C4X I;  1Q7Y 1;  3JAM f;  3I07 A;  3RZD I;  4RVG A;  3I56 Z;  4A3I I;  4TNU A;  1X3Z A;  2HU9 A;  1M90 2;  4E2Y A;  3CCL 1;  2JA8 I;  3MZK B;  4E2X A;  3OW2 Z;  1VQP 1;  4MD7 A;  1L1O C;  1YI2 1;  3OW2 Y;  2G2K A;  3VMI A;  2QKD A;  4E2Z A;  1USP B;  1YIJ Z;  2QA4 Z;  2JA6 I;  3S15 I;  1YJN 1;  3VB9 A;  3I55 Z;  1P9N A;  3CCR Z;  2JA7 I;  5AN9 F;  3NDJ A;  3CCV 1;  1R9T I;  1YJ9 Z;  3NH8 A;  1QVG Y;  2JS4 A;  5FLX b;  2NVQ I;  3VMG A;  1TWG I;  3TDH B;  1KC8 1;  1ZB9 A;  4A3E I;  3CCJ 1;  1YJW Z;  3HOX I;  4S1T A;  1M1K 1;  1VQ8 Z;  1PFT A;  3G4S 1;  2RPR A;  3FKI I;  1Y1W I;  3NDI A;  2OOX B;  3GTJ I;  3GTO I;  4E32 A;  3I56 1;  3CQZ I;  3Q87 A;  4MON A;  4NH1 C;  3GTM I;  3MZL B;  4A3J I;  3NFZ A;  3CME Z;  3I4M I;  3BG1 B;  5IT9 b;  5C4J I;  3CC4 Z;  1YIJ 1;  2QA4 1;  1Q86 1;  1RO2 A;  2LFU A;  5FLX f;  3I55 1;  3U50 C;  5T6B A;  1S7M A;  1QYP A;  2QR1 B;  2VUM I;  3CCR 1;  4NFR A;  4BBS I;  1W2B Z;  3KIH A;  5CM2 M;  4MXU A;  2NVT I;  4XX2 A;  2QLV B;  3GTM S;  2GTH A;  4BXX I;  3S17 I;  2JR6 A;  2VUG A;  2P28 A;  2Q51 A;  3GCF A;  1QF8 A;  1Z01 A;  1VQ8 1;  1K8A 2;  1VQ6 Z;  1YUA A;  2WB1 A;  3CD6 Z;  4NBG A;  3KIF A;  3S2D I;  5D1O B;  5T64 A;  3CCJ Z;  4A3B I;  4NBE A;  5D1P A;  1N8R 1;  5IT9 f;  1RNI A;  3J7A 4;  3G6E Z;  3IFU A;  2OOY B;  5LL6 f;  3CME 1;  2RIQ A;  2QRD B;  1TWF I;  3CC4 1;  2PMZ A;  3CCQ Z;  4RS4 A;  5IP9 I;  4X6A I;  1I3Q I;  2R7Z I;  1X0T A;  2J6A A;  4DGL A;  2V8I A;  3J80 b;  3HOU I;  1VQN Z;  2PM9 A;  3RZO I;  4DQY B;  2HF1 A;  1VQ9 Z;  4NBC A;  1N2F A;  4E33 A;  2GTI A;  2O53 A;  4AYB A;  4EWC A;  3ESW A;  3HOY I;  1VQ6 1;  5C44 I;  2NVY I;  3CD6 1;  3CCE Z;  3FQQ A;  2E2H I;  2QEX 1;  1M90 1;  1NJI 2;  3EED A;  3G6E 1;  3EER A;  4A3F I;  1KD1 2;  1ML8 A;  3CCM Z;  1JJ2 Z;  2P3Y A;  1JJ2 Y;  3J80 f;  1K9M 2;  3GTG I;  4BY7 I;  3CMA Z;  3S1Q I;  1Z03 A;  3CCQ 1;  2LIY A;  2V8J A;  5T67 A;  4RV9 A;  3CXC Z;  3CXC Y;  1I50 I;  1USP A;  2RBL A;  1SFO I;  1Q82 2;  3I4N I;  1VQN 1;  1VQ7 Z;  4HGY A;  1X3W A;  3HOW I;  2KPI A;  1VQ9 1;  1VQO Z;  1RQF A;  2JA5 I;  2RHB A;  1VQ4 Z;  1DL6 A;  2EGT A;  3S14 I;  1K73 2;  4MD8 A;  1RO0 A;  2DE7 A;  1Q81 1;  3M3Y I;  1W2B Y;  2IZ3 A;  4CL1 A;  3HOZ I;  1VQL 1;  2RT9 A;  2DE5 A;  3CCE 1;  4MD9 A;  2R92 I;  2O4H A;  2F4O A;  1Q7Y 2;  2QRC B;  3PO2 I;  2M48 A;  4NB9 A;  1TWA I;  4BBR I;  2E9H A;  3VTN A;  3CCM 1;  4A3K I;  2QEX Z;  3H0G I;  5A2Q b;  4NBF A;  3CCS Z;  3CMA 1;  2E2I I;  4E31 A;  3K7A I;  4MH4 A;  3TE5 B;  3GTL I;  2IZ4 A;  4NBH A;  3LUS A;  4E30 A;  4RVF A;  1VQ7 1;  4NBB A;  3F3P C;  1RO4 A;  2W04 A;  1KQS Z;  2K5R A;  1VQO 1;  2OTJ Z;  1KQS Y;  1VQ4 1;  3CCU 1;  2OTL Z;  4RVD A;  2B63 I;  1K8A 1;  1KC8 2;  2PK7 A;  2YAD A;  2AKL A;  3S1M I;  1M1K 2;  2W03 A;  4BY1 I;  5A2Q f;  1VQM Z;  2E2J I;  2NVX I;  1S72 Z;  5FLM I;  3CC2 Z;  3M4O I;  1WCM I;  3J81 b;  4MRI A;  1I6H I;  5D1O A;  1VQL Z;  1YHQ Z;  1RLY A;  5IP7 I;  4A93 I;  1VQ5 Z;  4E2W A;  1Y1V I;  4Y7N I;  3CCS 1;  3S2H I;  1WII A;  2WAQ A;  1ZB8 A;  3VMH A;  1QVG Z;  1VQK 1;  3F3F C;  3D9X A;  3HOV I;  3G71 Z;  1Q86 2;  3FQM A;  3GTK I;  1TFI A;  2VF1 A;  3P5J B;  4NB8 A;  3NH4 A;  4DK1 A;  2V8K A;  1QVF Z;  3PO3 I;  2R6M A;  1QVF Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...