3S2HI

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2hI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2hI02
2JR6A 1I3QI 1WCMI 1Y1VS 4A3II 3H0GI 3S2HI 2R92I 1ZB9A 2J6AA 4MH4A 3HOZI 3GKQA 3PO2I 3U50C 5CM2M 3S14I 1TFIA 2DE5A 2F4OA 5C4XI 5C3EI 3GTGI 4NBEA 3S17I 3I4NI 3HOXI 2YU9I 1USPA 4QTTA 3GTOI 4A3BI 1TWHI 3VB9A 3I4MI 2F4MA 2DE7A 4XX2A 4NBCA 4NBGA 4A93I 2PK7A 1DL6A 2RBLA 4BY1I 3VMIA 4A3LI 4NBDA 3GTLI 3GTQI 5C4JI 3GTPI 3EERA 3CQZI 2E2HI 4BBSI 1I6HI 2NVXI 1RO4A 2JA7I 4BBRI 4Y52I 3PO3I 1ZB8A 3K7AI 4X6AI 2K5RA 2AKLA 4BY7I 2BJOA 2NVYI 2JA8I 1USPB 3S1RI 1K83I 1X3ZA 4A3EI 3HOWI 1I50I 2VUMI 1ML8A 1TWAI 2KPIA 2JS4A 3PO3S 3RZOI 3GTMI 3S15I 1VLAA 1NUIA 2JA5I 4A3FI 4A3KI 3H3VJ 4QTUA 3VMHA 1LQLA 2JA6I 1SFOI 2JNYA 3HOUI 3M4OI 1L1OC 4BXXI 4Y7NI 4A3CI 4NB8A 1N2FA 3GTJI 1Y1VI 1WW9A 4NBHA 2R7ZI 2HF1A 3GTMS 3I07A 4NBFA 2NVQI 4A3GI 3HOYI 2B63I 3S1NI 4A3JI 4NOZA 3S1MI 3GCFA 3Q87A 2R93I 2DE6A 1TWCI 4NBAA 5C44I 4A3MI 3LUSA 2E2II 3S16I 1TWFI 3S2DI 3D6WA 1YUAA 1QYPA 1X3WA 5IP7I 5IP9I 4NBBA 1PFTA 2P3YA 3VMGA 2NVTI 1TWGI 1R9TI 3GTKI 1RLYA 2E2JI 3S1QI 3M3YI 3ESWA 5FLMI 3RZDI 3FKII 4A3DI 3HOVI 4NB9A 1Y1WI
chains in the Genus database with same CATH superfamily
3I56Z 3CCSZ 4MD8A 3H0GI 4HH4A 1YITZ 1VQM1 1JWHC 1ZB9A 1VQK1 1JJ2Z 3GKQA 2GU2A 2PMZA 2OTL1 3PO2I 3U50C 5CM2M 4RVFA 3S17I 2QRDB 3I4NI 2OOYB 4MD7A 4A3BI 3VB9A 1AA6A 1KQSZ 2QA4Z 1Q812 4CL1A 1QF8A 3NH5A 3GTPI 3KIFA 5D1PA 4RVDA 2JUBA 1RO4A 3G711 4MD9A 4HGYA 3CCQ1 1KD12 1QVGZ 3K7AI 2K5RA 1YIJZ 2BJOA 2Q51A 3P5JB 3HOWI 3NDJA 1ML8A 2JIOA 3CMEZ 1YI21 2QKDA 2VUGA 3S15I 3CD6Z 3F3FC 2JA5I 5T64A 3BG1B 1SFOI 2WAQA 4HGZA 1VQ6Z 1KC81 3G6EZ 2QREB 2O4HA 4Y7NI 4NB8A 1YJ91 1M902 1VQ51 1NJI1 1VQP1 2LEXA 2VPWA 2WB1A 4TNUA 4A3JI 1RO0A 4E2XA 3GCFA 1Q7Y2 1K9M2 3CC4Z 1YIT1 3NDIA 3S2DI 5FLXb 2OTJ1 1QYPA 1M1K1 4DK1A 1X3WA 2M6NA 1RQFA 3CMA1 4S1TA 3MZKB 5D1OB 1VQ91 3VMGA 3I55Z 1TWGI 1R9TI 2KI7B 1VQLZ 1S7MA 1RLYA 3M3YI 2QEXZ 4MXUA 3RZDI 3FKII 4E31A 2QA41 4A3DI 4NB9A 1Y1WI 2JR6A 1VQ7Z 1YHQ1 1X0TA 4A3II 2R92I 1VQOZ 2QLVB 2M48A 3F3PC 1TFIA 3GTGI 4NBEA 1VQ4Z 3EEDA 1YJWZ 3CPWY 1K8A1 4AYBA 1QVFZ 5LL6f 1Z02A 2IZ4A 1WZNA 2JIPA 3CD61 2EGTA 4EWCA 4XX2A 4NBCA 4NBGA 4A93I 3CCV1 1DL6A 4BY1I 1RNIA 3CCMZ 3GTLI 3GTQI 1VQ61 3G6E1 2ZAEB 1Q861 2NAPA 4Y52I 2YADA 4X6AI 3FQQA 2RT9A 2JA8I 1USPB 2LIYA 1W2BZ 1WJ2A 1KC82 3S1RI 1K83I 3CXCZ 3CC41 1I50I 2RPRA 2VUMI 1NJI2 1TWAI 2KPIA 2V8JA 2JS4A 1NUIA 4A3FI 4QTUA 3VMHA 2JA6I 2JNYA 3HOUI 3FQMA 3M4OI 1L1OC 3I551 2AYDA 1P9NA 1Y1VI 2QEX1 1M1K2 4NBHA 5D1OA 2G2KA 1N8R1 3S1NI 1Q16A 4DQYB 1K731 3S1MI 3Q87A 3J80b 3CCRZ 1VQ71 4NBAA 5C44I 5FLXf 4A3MI 1VQN1 2GTIA 2E7ZA 2RHBA 2V8IA 1VQ41 3CCLZ 3MZLB 2JIRA 2JMOA 5IT9b 3CCEZ 2E2JI 4E30A 3I561 2I3CA 3CCM1 3CCS1 2NVQI 1I3QI 1K8A2 3G4SZ 2JIMA 3MONA 2K3RA 3S2HI 3IX0A 2J6AA 4RVHA 4MH4A 3CCUZ 1VQMZ 2DE5A 5C4XI 5C3EI 3TE5B 1Q862 2YU9I 1USPA 3GTOI 2R6MA 2F4MA 2DE7A 2VPYA 3D2LA 4A3LI 1VQ8Z 4NBDA 3CC2Z 5C4JI 2VPXA 3HKZA 2NVXI 2V3VA 2JA7I 4BBRI 1YIJ1 1Q821 2E9HA 2NVYI 3JAMb 5A2Qb 3CME1 3CCJZ 3CPWZ 1NP6A 2HU9A 3NH8A 1YUKA 5T67A 1N8R2 3RZOI 1VLAA 1K732 3H3VJ 3CCL1 5T6BA 1LQLA 2H85A 1KRLA 3KIHA 4A3CI 3CCE1 3VTNA 3T4NB 1WW9A 3BG0B 1K9M1 2VPZA 3QWUA 4E2WA 3J80f 2HF1A 2O53A 1VQPZ 4A3GI 4NOZA 3OW2Y 3J7A4 2DE6A 1TWCI 4E2YA 1Y8CA 1RO2A 1ZH1A 3S16I 2E2II 3J81b 2W04A 1TWFI 3CCU1 1JJ2Y 2P28A 5IT9f 2Y0SA 2OTJZ 5IP9I 2OZKA 1W2BY 1VQL1 1PFTA 3CC7Z 3CMAZ 4RS4A 3CXCY 3GTKI 1VQ9Z 3S1QI 3ESWA 1QXFA 1KQSY 1VQ81 3CC21 3NH4A 4RV9A 1WCMI 3IR7A 1Z01A 1VQO1 1Y1VS 2V8KA 1YJNZ 1YHQZ 2IZ3A 2RIQA 1QVGY 3HOZI 1YJW1 3S14I 2F4OA 2JIQA 1S72Z 3CCJ1 2PM9A 3HOXI 1Q822 1WIIA 4QTTA 1FDOA 1TWHI 4E33A 3I4MI 2PK7A 2RBLA 3VMIA 4MRIA 3CCVZ 3NFZA 3EERA 3CQZI 2E2HI 4BBSI 1I6HI 3JAMf 1VQKZ 5A2Qf 1ZB8A 3PO3I 2QR1B 2GTHA 2AKLA 4BY7I 2OTLZ 2Q4ZA 1X3ZA 4A3EI 1Q811 4NFRA 3PO3S 3GTMI 1KD11 4A3KI 1Z03A 3CC71 2VF1A 2IV2X 4BXXI 1N2FA 2QRCB 3GTJI 3G71Z 4RVGA 3CCQZ 4DGLA 2R7ZI 3GTMS 3I07A 4NBFA 4NH1C 3IF8A 3CCR1 1FDIA 3HOYI 2B63I 5AN9F 3J81f 2R93I 4MONA 1YJN1 3LUSA 1YI2Z 2OOXB 3IFUA 1M901 3D9XA 1VQNZ 3D6WA 1YUAA 2LFUA 4E32A 3TDHB 1S721 5IP7I 2V45A 2W03A 1SIWA 4NBBA 2P3YA 2NVTI 1Q7Y1 1YJ9Z 1QVFY 1VQ5Z 5FLMI 4E2ZA 3OW2Z 3G4S1 3HOVI
chains in the Genus database with same CATH topology
3I56Z 3CCSZ 4MD8A 3H0GI 4HH4A 1YITZ 1VQM1 1JWHC 1ZB9A 1VQK1 1JJ2Z 3GKQA 2GU2A 2PMZA 2OTL1 3PO2I 3U50C 5CM2M 4RVFA 3S17I 2QRDB 3I4NI 2OOYB 4MD7A 4A3BI 3VB9A 1KQSZ 2QA4Z 1Q812 4CL1A 1QF8A 3NH5A 3GTPI 3KIFA 5D1PA 4RVDA 2JUBA 1RO4A 3G711 4MD9A 4HGYA 3CCQ1 1KD12 1QVGZ 3K7AI 2K5RA 1YIJZ 2BJOA 2Q51A 3P5JB 3HOWI 3NDJA 1ML8A 3CMEZ 1YI21 2QKDA 2VUGA 3S15I 3CD6Z 3F3FC 2JA5I 5T64A 3BG1B 1SFOI 2WAQA 4HGZA 1VQ6Z 1KC81 3G6EZ 2QREB 2O4HA 4Y7NI 4NB8A 1YJ91 1M902 1VQ51 1NJI1 1VQP1 2WB1A 4TNUA 4A3JI 1RO0A 4E2XA 3GCFA 1Q7Y2 1K9M2 3CC4Z 1YIT1 3NDIA 3S2DI 5FLXb 2OTJ1 1QYPA 1M1K1 4DK1A 1X3WA 2M6NA 1RQFA 3CMA1 4S1TA 3MZKB 5D1OB 1VQ91 3VMGA 3I55Z 1TWGI 1R9TI 2KI7B 1VQLZ 1S7MA 1RLYA 3M3YI 2QEXZ 4MXUA 3RZDI 3FKII 4E31A 2QA41 4A3DI 4NB9A 1Y1WI 2JR6A 1VQ7Z 1YHQ1 1X0TA 4A3II 2R92I 1VQOZ 2QLVB 2M48A 3F3PC 1TFIA 3GTGI 4NBEA 1VQ4Z 3EEDA 1YJWZ 3CPWY 1K8A1 4AYBA 1QVFZ 5LL6f 1Z02A 2IZ4A 3CD61 2EGTA 4EWCA 4XX2A 4NBCA 4NBGA 4A93I 3CCV1 1DL6A 4BY1I 1RNIA 3CCMZ 3GTLI 3GTQI 1VQ61 3G6E1 2ZAEB 1Q861 4Y52I 2YADA 4X6AI 3FQQA 2RT9A 2JA8I 1USPB 2LIYA 1W2BZ 1KC82 3S1RI 1K83I 3CXCZ 3CC41 1I50I 2RPRA 2VUMI 1NJI2 1TWAI 2KPIA 2V8JA 2JS4A 1NUIA 4A3FI 4QTUA 3VMHA 2JA6I 2JNYA 3HOUI 3FQMA 3M4OI 1L1OC 3I551 1P9NA 1Y1VI 2QEX1 1M1K2 4NBHA 5D1OA 2G2KA 1N8R1 3S1NI 4DQYB 1K731 3S1MI 3Q87A 3J80b 3CCRZ 1VQ71 4NBAA 5C44I 5FLXf 4A3MI 1VQN1 2GTIA 2RHBA 2V8IA 1VQ41 3CCLZ 3MZLB 2JMOA 5IT9b 3CCEZ 2E2JI 4E30A 3I561 2I3CA 3CCM1 3CCS1 2NVQI 1I3QI 1K8A2 3G4SZ 3MONA 2K3RA 3S2HI 3IX0A 2J6AA 4RVHA 4MH4A 3CCUZ 1VQMZ 2DE5A 5C4XI 5C3EI 3TE5B 1Q862 2YU9I 1USPA 3GTOI 2R6MA 2F4MA 2DE7A 4A3LI 1VQ8Z 4NBDA 3CC2Z 5C4JI 3HKZA 2NVXI 2JA7I 4BBRI 1YIJ1 1Q821 2E9HA 2NVYI 3JAMb 5A2Qb 3CME1 3CCJZ 3CPWZ 1NP6A 2HU9A 3NH8A 1YUKA 5T67A 1N8R2 3RZOI 1VLAA 1K732 3H3VJ 3CCL1 5T6BA 1LQLA 2H85A 1KRLA 3KIHA 4A3CI 3CCE1 3VTNA 3T4NB 1WW9A 3BG0B 1K9M1 3QWUA 4E2WA 3J80f 2HF1A 2O53A 1VQPZ 4A3GI 4NOZA 3OW2Y 3J7A4 2DE6A 1TWCI 4E2YA 1RO2A 1ZH1A 3S16I 2E2II 3J81b 2W04A 1TWFI 3CCU1 1JJ2Y 2P28A 5IT9f 2Y0SA 2OTJZ 5IP9I 2OZKA 1W2BY 1VQL1 1PFTA 3CC7Z 3CMAZ 4RS4A 3CXCY 3GTKI 1VQ9Z 3S1QI 3ESWA 1KQSY 1VQ81 3CC21 3NH4A 4RV9A 1WCMI 1Z01A 1VQO1 1Y1VS 2V8KA 1YJNZ 1YHQZ 2IZ3A 2RIQA 1QVGY 3HOZI 1YJW1 3S14I 2F4OA 1S72Z 3CCJ1 2PM9A 3HOXI 1Q822 1WIIA 4QTTA 1TWHI 4E33A 3I4MI 2PK7A 2RBLA 3VMIA 4MRIA 3CCVZ 3NFZA 3EERA 3CQZI 2E2HI 4BBSI 1I6HI 3JAMf 1VQKZ 5A2Qf 1ZB8A 3PO3I 2QR1B 2GTHA 2AKLA 4BY7I 2OTLZ 2Q4ZA 1X3ZA 4A3EI 1Q811 4NFRA 3PO3S 3GTMI 1KD11 4A3KI 1Z03A 3CC71 2VF1A 4BXXI 1N2FA 2QRCB 3GTJI 3G71Z 4RVGA 3CCQZ 4DGLA 2R7ZI 3GTMS 3I07A 4NBFA 4NH1C 3IF8A 3CCR1 3HOYI 2B63I 5AN9F 3J81f 2R93I 4MONA 1YJN1 3LUSA 1YI2Z 2OOXB 3IFUA 1M901 3D9XA 1VQNZ 3D6WA 1YUAA 2LFUA 4E32A 3TDHB 1S721 5IP7I 2W03A 4NBBA 2P3YA 2NVTI 1Q7Y1 1YJ9Z 1QVFY 1VQ5Z 5FLMI 4E2ZA 3OW2Z 3G4S1 3HOVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR6 A;  1I3Q I;  1WCM I;  1Y1V S;  4A3I I;  3H0G I;  3S2H I;  2R92 I;  1ZB9 A;  2J6A A;  4MH4 A;  3HOZ I;  3GKQ A;  3PO2 I;  3U50 C;  5CM2 M;  3S14 I;  1TFI A;  2DE5 A;  2F4O A;  5C4X I;  5C3E I;  3GTG I;  4NBE A;  3S17 I;  3I4N I;  3HOX I;  2YU9 I;  1USP A;  4QTT A;  3GTO I;  4A3B I;  1TWH I;  3VB9 A;  3I4M I;  2F4M A;  2DE7 A;  4XX2 A;  4NBC A;  4NBG A;  4A93 I;  2PK7 A;  1DL6 A;  2RBL A;  4BY1 I;  3VMI A;  4A3L I;  4NBD A;  3GTL I;  3GTQ I;  5C4J I;  3GTP I;  3EER A;  3CQZ I;  2E2H I;  4BBS I;  1I6H I;  2NVX I;  1RO4 A;  2JA7 I;  4BBR I;  4Y52 I;  3PO3 I;  1ZB8 A;  3K7A I;  4X6A I;  2K5R A;  2AKL A;  4BY7 I;  2BJO A;  2NVY I;  2JA8 I;  1USP B;  3S1R I;  1K83 I;  1X3Z A;  4A3E I;  3HOW I;  1I50 I;  2VUM I;  1ML8 A;  1TWA I;  2KPI A;  2JS4 A;  3PO3 S;  3RZO I;  3GTM I;  3S15 I;  1VLA A;  1NUI A;  2JA5 I;  4A3F I;  4A3K I;  3H3V J;  4QTU A;  3VMH A;  1LQL A;  2JA6 I;  1SFO I;  2JNY A;  3HOU I;  3M4O I;  1L1O C;  4BXX I;  4Y7N I;  4A3C I;  4NB8 A;  1N2F A;  3GTJ I;  1Y1V I;  1WW9 A;  4NBH A;  2R7Z I;  2HF1 A;  3GTM S;  3I07 A;  4NBF A;  2NVQ I;  4A3G I;  3HOY I;  2B63 I;  3S1N I;  4A3J I;  4NOZ A;  3S1M I;  3GCF A;  3Q87 A;  2R93 I;  2DE6 A;  1TWC I;  4NBA A;  5C44 I;  4A3M I;  3LUS A;  2E2I I;  3S16 I;  1TWF I;  3S2D I;  3D6W A;  1YUA A;  1QYP A;  1X3W A;  5IP7 I;  5IP9 I;  4NBB A;  1PFT A;  2P3Y A;  3VMG A;  2NVT I;  1TWG I;  1R9T I;  3GTK I;  1RLY A;  2E2J I;  3S1Q I;  3M3Y I;  3ESW A;  5FLM I;  3RZD I;  3FKI I;  4A3D I;  3HOV I;  4NB9 A;  1Y1W I; 
#chains in the Genus database with same CATH topology
 3I56 Z;  3CCS Z;  4MD8 A;  3H0G I;  4HH4 A;  1YIT Z;  1VQM 1;  1JWH C;  1ZB9 A;  1VQK 1;  1JJ2 Z;  3GKQ A;  2GU2 A;  2PMZ A;  2OTL 1;  3PO2 I;  3U50 C;  5CM2 M;  4RVF A;  3S17 I;  2QRD B;  3I4N I;  2OOY B;  4MD7 A;  4A3B I;  3VB9 A;  1AA6 A;  1KQS Z;  2QA4 Z;  1Q81 2;  4CL1 A;  1QF8 A;  3NH5 A;  3GTP I;  3KIF A;  5D1P A;  4RVD A;  2JUB A;  1RO4 A;  3G71 1;  4MD9 A;  4HGY A;  3CCQ 1;  1KD1 2;  1QVG Z;  3K7A I;  2K5R A;  1YIJ Z;  2BJO A;  2Q51 A;  3P5J B;  3HOW I;  3NDJ A;  1ML8 A;  2JIO A;  3CME Z;  1YI2 1;  2QKD A;  2VUG A;  3S15 I;  3CD6 Z;  3F3F C;  2JA5 I;  5T64 A;  3BG1 B;  1SFO I;  2WAQ A;  4HGZ A;  1VQ6 Z;  1KC8 1;  3G6E Z;  2QRE B;  2O4H A;  4Y7N I;  4NB8 A;  1YJ9 1;  1M90 2;  1VQ5 1;  1NJI 1;  1VQP 1;  2LEX A;  2VPW A;  2WB1 A;  4TNU A;  4A3J I;  1RO0 A;  4E2X A;  3GCF A;  1Q7Y 2;  1K9M 2;  3CC4 Z;  1YIT 1;  3NDI A;  3S2D I;  5FLX b;  2OTJ 1;  1QYP A;  1M1K 1;  4DK1 A;  1X3W A;  2M6N A;  1RQF A;  3CMA 1;  4S1T A;  3MZK B;  5D1O B;  1VQ9 1;  3VMG A;  3I55 Z;  1TWG I;  1R9T I;  2KI7 B;  1VQL Z;  1S7M A;  1RLY A;  3M3Y I;  2QEX Z;  4MXU A;  3RZD I;  3FKI I;  4E31 A;  2QA4 1;  4A3D I;  4NB9 A;  1Y1W I;  2JR6 A;  1VQ7 Z;  1YHQ 1;  1X0T A;  4A3I I;  2R92 I;  1VQO Z;  2QLV B;  2M48 A;  3F3P C;  1TFI A;  3GTG I;  4NBE A;  1VQ4 Z;  3EED A;  1YJW Z;  3CPW Y;  1K8A 1;  4AYB A;  1QVF Z;  5LL6 f;  1Z02 A;  2IZ4 A;  1WZN A;  2JIP A;  3CD6 1;  2EGT A;  4EWC A;  4XX2 A;  4NBC A;  4NBG A;  4A93 I;  3CCV 1;  1DL6 A;  4BY1 I;  1RNI A;  3CCM Z;  3GTL I;  3GTQ I;  1VQ6 1;  3G6E 1;  2ZAE B;  1Q86 1;  2NAP A;  4Y52 I;  2YAD A;  4X6A I;  3FQQ A;  2RT9 A;  2JA8 I;  1USP B;  2LIY A;  1W2B Z;  1WJ2 A;  1KC8 2;  3S1R I;  1K83 I;  3CXC Z;  3CC4 1;  1I50 I;  2RPR A;  2VUM I;  1NJI 2;  1TWA I;  2KPI A;  2V8J A;  2JS4 A;  1NUI A;  4A3F I;  4QTU A;  3VMH A;  2JA6 I;  2JNY A;  3HOU I;  3FQM A;  3M4O I;  1L1O C;  3I55 1;  2AYD A;  1P9N A;  1Y1V I;  2QEX 1;  1M1K 2;  4NBH A;  5D1O A;  2G2K A;  1N8R 1;  3S1N I;  1Q16 A;  4DQY B;  1K73 1;  3S1M I;  3Q87 A;  3J80 b;  3CCR Z;  1VQ7 1;  4NBA A;  5C44 I;  5FLX f;  4A3M I;  1VQN 1;  2GTI A;  2E7Z A;  2RHB A;  2V8I A;  1VQ4 1;  3CCL Z;  3MZL B;  2JIR A;  2JMO A;  5IT9 b;  3CCE Z;  2E2J I;  4E30 A;  3I56 1;  2I3C A;  3CCM 1;  3CCS 1;  2NVQ I;  1I3Q I;  1K8A 2;  3G4S Z;  2JIM A;  3MON A;  2K3R A;  3S2H I;  3IX0 A;  2J6A A;  4RVH A;  4MH4 A;  3CCU Z;  1VQM Z;  2DE5 A;  5C4X I;  5C3E I;  3TE5 B;  1Q86 2;  2YU9 I;  1USP A;  3GTO I;  2R6M A;  2F4M A;  2DE7 A;  2VPY A;  3D2L A;  4A3L I;  1VQ8 Z;  4NBD A;  3CC2 Z;  5C4J I;  2VPX A;  3HKZ A;  2NVX I;  2V3V A;  2JA7 I;  4BBR I;  1YIJ 1;  1Q82 1;  2E9H A;  2NVY I;  3JAM b;  5A2Q b;  3CME 1;  3CCJ Z;  3CPW Z;  1NP6 A;  2HU9 A;  3NH8 A;  1YUK A;  5T67 A;  1N8R 2;  3RZO I;  1VLA A;  1K73 2;  3H3V J;  3CCL 1;  5T6B A;  1LQL A;  2H85 A;  1KRL A;  3KIH A;  4A3C I;  3CCE 1;  3VTN A;  3T4N B;  1WW9 A;  3BG0 B;  1K9M 1;  2VPZ A;  3QWU A;  4E2W A;  3J80 f;  2HF1 A;  2O53 A;  1VQP Z;  4A3G I;  4NOZ A;  3OW2 Y;  3J7A 4;  2DE6 A;  1TWC I;  4E2Y A;  1Y8C A;  1RO2 A;  1ZH1 A;  3S16 I;  2E2I I;  3J81 b;  2W04 A;  1TWF I;  3CCU 1;  1JJ2 Y;  2P28 A;  5IT9 f;  2Y0S A;  2OTJ Z;  5IP9 I;  2OZK A;  1W2B Y;  1VQL 1;  1PFT A;  3CC7 Z;  3CMA Z;  4RS4 A;  3CXC Y;  3GTK I;  1VQ9 Z;  3S1Q I;  3ESW A;  1QXF A;  1KQS Y;  1VQ8 1;  3CC2 1;  3NH4 A;  4RV9 A;  1WCM I;  3IR7 A;  1Z01 A;  1VQO 1;  1Y1V S;  2V8K A;  1YJN Z;  1YHQ Z;  2IZ3 A;  2RIQ A;  1QVG Y;  3HOZ I;  1YJW 1;  3S14 I;  2F4O A;  2JIQ A;  1S72 Z;  3CCJ 1;  2PM9 A;  3HOX I;  1Q82 2;  1WII A;  4QTT A;  1FDO A;  1TWH I;  4E33 A;  3I4M I;  2PK7 A;  2RBL A;  3VMI A;  4MRI A;  3CCV Z;  3NFZ A;  3EER A;  3CQZ I;  2E2H I;  4BBS I;  1I6H I;  3JAM f;  1VQK Z;  5A2Q f;  1ZB8 A;  3PO3 I;  2QR1 B;  2GTH A;  2AKL A;  4BY7 I;  2OTL Z;  2Q4Z A;  1X3Z A;  4A3E I;  1Q81 1;  4NFR A;  3PO3 S;  3GTM I;  1KD1 1;  4A3K I;  1Z03 A;  3CC7 1;  2VF1 A;  2IV2 X;  4BXX I;  1N2F A;  2QRC B;  3GTJ I;  3G71 Z;  4RVG A;  3CCQ Z;  4DGL A;  2R7Z I;  3GTM S;  3I07 A;  4NBF A;  4NH1 C;  3IF8 A;  3CCR 1;  1FDI A;  3HOY I;  2B63 I;  5AN9 F;  3J81 f;  2R93 I;  4MON A;  1YJN 1;  3LUS A;  1YI2 Z;  2OOX B;  3IFU A;  1M90 1;  3D9X A;  1VQN Z;  3D6W A;  1YUA A;  2LFU A;  4E32 A;  3TDH B;  1S72 1;  5IP7 I;  2V45 A;  2W03 A;  1SIW A;  4NBB A;  2P3Y A;  2NVT I;  1Q7Y 1;  1YJ9 Z;  1QVF Y;  1VQ5 Z;  5FLM I;  4E2Z A;  3OW2 Z;  3G4S 1;  3HOV I; 
#chains in the Genus database with same CATH homology
 3I56 Z;  3CCS Z;  4MD8 A;  3H0G I;  4HH4 A;  1YIT Z;  1VQM 1;  1JWH C;  1ZB9 A;  1VQK 1;  1JJ2 Z;  3GKQ A;  2GU2 A;  2PMZ A;  2OTL 1;  3PO2 I;  3U50 C;  5CM2 M;  4RVF A;  3S17 I;  2QRD B;  3I4N I;  2OOY B;  4MD7 A;  4A3B I;  3VB9 A;  1KQS Z;  2QA4 Z;  1Q81 2;  4CL1 A;  1QF8 A;  3NH5 A;  3GTP I;  3KIF A;  5D1P A;  4RVD A;  2JUB A;  1RO4 A;  3G71 1;  4MD9 A;  4HGY A;  3CCQ 1;  1KD1 2;  1QVG Z;  3K7A I;  2K5R A;  1YIJ Z;  2BJO A;  2Q51 A;  3P5J B;  3HOW I;  3NDJ A;  1ML8 A;  3CME Z;  1YI2 1;  2QKD A;  2VUG A;  3S15 I;  3CD6 Z;  3F3F C;  2JA5 I;  5T64 A;  3BG1 B;  1SFO I;  2WAQ A;  4HGZ A;  1VQ6 Z;  1KC8 1;  3G6E Z;  2QRE B;  2O4H A;  4Y7N I;  4NB8 A;  1YJ9 1;  1M90 2;  1VQ5 1;  1NJI 1;  1VQP 1;  2WB1 A;  4TNU A;  4A3J I;  1RO0 A;  4E2X A;  3GCF A;  1Q7Y 2;  1K9M 2;  3CC4 Z;  1YIT 1;  3NDI A;  3S2D I;  5FLX b;  2OTJ 1;  1QYP A;  1M1K 1;  4DK1 A;  1X3W A;  2M6N A;  1RQF A;  3CMA 1;  4S1T A;  3MZK B;  5D1O B;  1VQ9 1;  3VMG A;  3I55 Z;  1TWG I;  1R9T I;  2KI7 B;  1VQL Z;  1S7M A;  1RLY A;  3M3Y I;  2QEX Z;  4MXU A;  3RZD I;  3FKI I;  4E31 A;  2QA4 1;  4A3D I;  4NB9 A;  1Y1W I;  2JR6 A;  1VQ7 Z;  1YHQ 1;  1X0T A;  4A3I I;  2R92 I;  1VQO Z;  2QLV B;  2M48 A;  3F3P C;  1TFI A;  3GTG I;  4NBE A;  1VQ4 Z;  3EED A;  1YJW Z;  3CPW Y;  1K8A 1;  4AYB A;  1QVF Z;  5LL6 f;  1Z02 A;  2IZ4 A;  3CD6 1;  2EGT A;  4EWC A;  4XX2 A;  4NBC A;  4NBG A;  4A93 I;  3CCV 1;  1DL6 A;  4BY1 I;  1RNI A;  3CCM Z;  3GTL I;  3GTQ I;  1VQ6 1;  3G6E 1;  2ZAE B;  1Q86 1;  4Y52 I;  2YAD A;  4X6A I;  3FQQ A;  2RT9 A;  2JA8 I;  1USP B;  2LIY A;  1W2B Z;  1KC8 2;  3S1R I;  1K83 I;  3CXC Z;  3CC4 1;  1I50 I;  2RPR A;  2VUM I;  1NJI 2;  1TWA I;  2KPI A;  2V8J A;  2JS4 A;  1NUI A;  4A3F I;  4QTU A;  3VMH A;  2JA6 I;  2JNY A;  3HOU I;  3FQM A;  3M4O I;  1L1O C;  3I55 1;  1P9N A;  1Y1V I;  2QEX 1;  1M1K 2;  4NBH A;  5D1O A;  2G2K A;  1N8R 1;  3S1N I;  4DQY B;  1K73 1;  3S1M I;  3Q87 A;  3J80 b;  3CCR Z;  1VQ7 1;  4NBA A;  5C44 I;  5FLX f;  4A3M I;  1VQN 1;  2GTI A;  2RHB A;  2V8I A;  1VQ4 1;  3CCL Z;  3MZL B;  2JMO A;  5IT9 b;  3CCE Z;  2E2J I;  4E30 A;  3I56 1;  2I3C A;  3CCM 1;  3CCS 1;  2NVQ I;  1I3Q I;  1K8A 2;  3G4S Z;  3MON A;  2K3R A;  3S2H I;  3IX0 A;  2J6A A;  4RVH A;  4MH4 A;  3CCU Z;  1VQM Z;  2DE5 A;  5C4X I;  5C3E I;  3TE5 B;  1Q86 2;  2YU9 I;  1USP A;  3GTO I;  2R6M A;  2F4M A;  2DE7 A;  4A3L I;  1VQ8 Z;  4NBD A;  3CC2 Z;  5C4J I;  3HKZ A;  2NVX I;  2JA7 I;  4BBR I;  1YIJ 1;  1Q82 1;  2E9H A;  2NVY I;  3JAM b;  5A2Q b;  3CME 1;  3CCJ Z;  3CPW Z;  1NP6 A;  2HU9 A;  3NH8 A;  1YUK A;  5T67 A;  1N8R 2;  3RZO I;  1VLA A;  1K73 2;  3H3V J;  3CCL 1;  5T6B A;  1LQL A;  2H85 A;  1KRL A;  3KIH A;  4A3C I;  3CCE 1;  3VTN A;  3T4N B;  1WW9 A;  3BG0 B;  1K9M 1;  3QWU A;  4E2W A;  3J80 f;  2HF1 A;  2O53 A;  1VQP Z;  4A3G I;  4NOZ A;  3OW2 Y;  3J7A 4;  2DE6 A;  1TWC I;  4E2Y A;  1RO2 A;  1ZH1 A;  3S16 I;  2E2I I;  3J81 b;  2W04 A;  1TWF I;  3CCU 1;  1JJ2 Y;  2P28 A;  5IT9 f;  2Y0S A;  2OTJ Z;  5IP9 I;  2OZK A;  1W2B Y;  1VQL 1;  1PFT A;  3CC7 Z;  3CMA Z;  4RS4 A;  3CXC Y;  3GTK I;  1VQ9 Z;  3S1Q I;  3ESW A;  1KQS Y;  1VQ8 1;  3CC2 1;  3NH4 A;  4RV9 A;  1WCM I;  1Z01 A;  1VQO 1;  1Y1V S;  2V8K A;  1YJN Z;  1YHQ Z;  2IZ3 A;  2RIQ A;  1QVG Y;  3HOZ I;  1YJW 1;  3S14 I;  2F4O A;  1S72 Z;  3CCJ 1;  2PM9 A;  3HOX I;  1Q82 2;  1WII A;  4QTT A;  1TWH I;  4E33 A;  3I4M I;  2PK7 A;  2RBL A;  3VMI A;  4MRI A;  3CCV Z;  3NFZ A;  3EER A;  3CQZ I;  2E2H I;  4BBS I;  1I6H I;  3JAM f;  1VQK Z;  5A2Q f;  1ZB8 A;  3PO3 I;  2QR1 B;  2GTH A;  2AKL A;  4BY7 I;  2OTL Z;  2Q4Z A;  1X3Z A;  4A3E I;  1Q81 1;  4NFR A;  3PO3 S;  3GTM I;  1KD1 1;  4A3K I;  1Z03 A;  3CC7 1;  2VF1 A;  4BXX I;  1N2F A;  2QRC B;  3GTJ I;  3G71 Z;  4RVG A;  3CCQ Z;  4DGL A;  2R7Z I;  3GTM S;  3I07 A;  4NBF A;  4NH1 C;  3IF8 A;  3CCR 1;  3HOY I;  2B63 I;  5AN9 F;  3J81 f;  2R93 I;  4MON A;  1YJN 1;  3LUS A;  1YI2 Z;  2OOX B;  3IFU A;  1M90 1;  3D9X A;  1VQN Z;  3D6W A;  1YUA A;  2LFU A;  4E32 A;  3TDH B;  1S72 1;  5IP7 I;  2W03 A;  4NBB A;  2P3Y A;  2NVT I;  1Q7Y 1;  1YJ9 Z;  1QVF Y;  1VQ5 Z;  5FLM I;  4E2Z A;  3OW2 Z;  3G4S 1;  3HOV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...