3S2HI

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2hI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2hI02
2PK7A 3Q87A 2NVYI 2R92I 1ML8A 2P3YA 4NBFA 1TWGI 1USPB 2F4OA 2JA8I 4A3JI 3GTQI 2J6AA 2JS4A 3HOUI 1Y1VI 3GCFA 3S16I 3S17I 3FKII 3S1NI 4NBCA 1RLYA 2JNYA 1Y1VS 5C4JI 5C3EI 3GTMI 3RZDI 3VMHA 4BBRI 4BXXI 1QYPA 1N2FA 3H3VJ 1LQLA 3M4OI 2R93I 1WW9A 3S2HI 3I07A 2NVTI 4BY7I 3GTKI 2VUMI 4NBGA 2DE6A 2JA5I 2JA6I 5C44I 2DE7A 4A3GI 1NUIA 1X3WA 3I4NI 3CQZI 1R9TI 3VMGA 4BY1I 3GTOI 4A3LI 1YUAA 1SFOI 5IP7I 1WCMI 4NB8A 4A3KI 2E2HI 5IP9I 2YU9I 3HOVI 1USPA 3GTGI 2BJOA 1I50I 3HOXI 3GTMS 2HF1A 1ZB8A 2NVQI 3PO3I 4A3EI 4A3MI 4A3II 3K7AI 4NBAA 1I6HI 4A93I 2B63I 5C4XI 4Y7NI 4A3FI 3PO3S 3S1QI 4A3DI 3LUSA 4QTTA 3PO2I 1PFTA 4NOZA 4A3CI 2R7ZI 1ZB9A 1RO4A 1TFIA 1VLAA 2NVXI 2JA7I 3GTJI 4NBDA 3VMIA 3VB9A 4QTUA 3S15I 3S2DI 4MH4A 1X3ZA 3S1RI 1TWHI 2RBLA 1TWFI 3ESWA 3RZOI 3EERA 5CM2M 2E2II 1TWCI 2K5RA 1I3QI 4NBHA 4NBEA 2KPIA 3U50C 3M3YI 1DL6A 3GKQA 4BBSI 2AKLA 4XX2A 1Y1WI 4NB9A 3S14I 3H0GI 3S1MI 3GTLI 2DE5A 3HOYI 1TWAI 2E2JI 3I4MI 4Y52I 3GTPI 3HOZI 3D6WA 3HOWI 4A3BI 1K83I 5FLMI 2JR6A 4NBBA 4X6AI 1L1OC 2F4MA
chains in the Genus database with same CATH superfamily
1VQMZ 2PK7A 3Q87A 2JIOA 1TWGI 2JA8I 2IV2X 3GTQI 3G6EZ 2JS4A 5T64A 1Y1VI 1YIJ1 1W2BZ 3HOUI 4RVHA 3CCQZ 2Q51A 3CMEZ 3CCJZ 4NBCA 1Q16A 2QR1B 3CCMZ 3CCSZ 1RLYA 1M1K1 4DQYB 1NJI2 1Y1VS 2QEX1 2I3CA 1W2BY 3GTMI 2GTIA 3RZDI 3CCV1 5AN9F 1VQ41 1LQLA 1YI2Z 4HGYA 2Q4ZA 4RS4A 2JMOA 3NH8A 3S2HI 2W04A 1NJI1 1QVFZ 2JA6I 1WIIA 4E33A 2JIRA 1S7MA 3CQZI 1YJW1 4MONA 3GTOI 3IFUA 1YUAA 2HU9A 1SFOI 1WCMI 2AYDA 2WB1A 1FDIA 1USPA 3GTGI 1I50I 1ZB8A 3PO3I 4A3MI 4A3II 3K7AI 3MZLB 4AYBA 1VQ5Z 2R6MA 2P28A 2B63I 5C4XI 4Y7NI 2VPXA 4A3FI 3PO3S 4E31A 3J7A4 1N8R1 4A3DI 1NP6A 4QTTA 3PO2I 2PMZA 3CC71 2V8JA 1WJ2A 1ZB9A 1Q812 3CCU1 4DGLA 1TFIA 1VLAA 3GTJI 2QEXZ 1Q7Y2 4NBDA 3VMIA 1AA6A 5IT9b 3CCVZ 4MH4A 1X3ZA 3CC41 1TWFI 2E2II 3U50C 2QLVB 1DL6A 3J81b 2AKLA 2YADA 3J80f 1Y1WI 3S14I 5FLXf 3H0GI 1Q7Y1 2E2JI 4HGZA 4DK1A 4A3BI 1K83I 4NBBA 2H85A 1YJWZ 3S1QI 1Y8CA 3IR7A 1VQP1 3CD61 1FDOA 2F4OA 4RV9A 1KD12 2VPWA 3G4S1 3GCFA 3S17I 1S72Z 2JIQA 3S1NI 2OTJ1 1YJNZ 2LEXA 1Z01A 1YHQ1 3OW2Z 5C4JI 5C3EI 1VQ71 2LIYA 4BBRI 2M6NA 4RVDA 1QYPA 1YJ91 2RIQA 1KD11 2RHBA 3M4OI 2G2KA 3OW2Y 1WW9A 1K731 1VQL1 3I07A 3CMA1 2NVTI 2GTHA 1K8A2 2JIMA 5C44I 2DE7A 4A3GI 1VQN1 2RPRA 2O53A 2QA4Z 1R9TI 1P9NA 4NB8A 4NH1C 2YU9I 3HOVI 2NAPA 1K8A1 3GTMS 2HF1A 3CPWY 2IZ4A 4NFRA 1VQOZ 1VQPZ 3NFZA 3G4SZ 3CCE1 2KI7B 1PFTA 3CCR1 5D1OB 2V8KA 1YUKA 2IZ3A 3NH5A 3VB9A 4QTUA 3F3PC 3S1RI 1TWHI 2K3RA 2PM9A 4MRIA 2RBLA 3RZOI 1TWCI 4NBHA 4NBEA 3M3YI 2Y0SA 4E2ZA 3VTNA 3MZKB 3CMAZ 1YIJZ 3GTLI 3HOYI 3CXCZ 1TWAI 3FQQA 4MD8A 1VQ91 4E2XA 1RQFA 5T67A 3D6WA 3HOWI 5FLMI 2JR6A 4E2WA 3D9XA 1Z02A 1VQNZ 2F4MA 3CXCY 2P3YA 2QRDB 1VQ4Z 2OOXB 4A3JI 5A2Qf 2J6AA 3CC21 3BG0B 1YIT1 2OTL1 1M902 1Q811 1VQM1 1WZNA 3G711 4CL1A 3VMHA 1KQSZ 3D2LA 1QVGY 4BXXI 2GU2A 2V8IA 2JIPA 3NDJA 3HKZA 3H3VJ 3CCEZ 2R93I 5FLXb 1RNIA 1K9M2 3CCQ1 3CME1 3CCJ1 1KQSY 3CCM1 3CCS1 3P5JB 2DE6A 2V45A 2JUBA 2OOYB 4RVFA 1RO2A 1NUIA 1X3WA 2M48A 3KIHA 1YI21 3I4NI 3JAMb 1K9M1 3VMGA 2V3VA 4BY1I 1JWHC 4A3KI 4E30A 5IP9I 2O4HA 3NDIA 3CC7Z 2RT9A 3HOXI 1ZH1A 2LFUA 1Q822 3FQMA 3CCUZ 3I561 1JJ2Y 3IX0A 1VQ61 3CC4Z 2VPYA 3CC2Z 3CCL1 1YITZ 4MXUA 1SIWA 4NOZA 4A3CI 2EGTA 1M1K2 2JA7I 3CPWZ 3T4NB 3G71Z 1VQ51 1VQ81 3ESWA 1KRLA 5CM2M 2KPIA 1Q862 4BBSI 4XX2A 3CD6Z 4E2YA 3S1MI 2DE5A 4Y52I 4MD9A 2OTJZ 4X6AI 1YHQZ 2NVYI 2R92I 1ML8A 1VQ7Z 1Q861 4NBFA 1USPB 2ZAEB 1QXFA 1YJ9Z 5D1PA 3TE5B 3S16I 3I551 3FKII 4S1TA 1X0TA 2QRCB 3KIFA 3I56Z 5D1OA 1VQLZ 2JNYA 4E32A 2W03A 3BG1B 1QVFY 1VQ6Z 1N8R2 1N2FA 3CCLZ 1S721 1KC82 2VUGA 2E9HA 1YJN1 1VQK1 1VQ8Z 4BY7I 3GTKI 2VUMI 4NBGA 1QVGZ 2JA5I 3MONA 5IT9f 5A2Qb 4A3LI 5IP7I 1KC81 2E2HI 3J81f 3J80b 3G6E1 2BJOA 2OZKA 5LL6f 2VPZA 3CCRZ 2NVQI 2E7ZA 4A3EI 4NBAA 1M901 3NH4A 1I6HI 2QA41 4A93I 1QF8A 3LUSA 3TDHB 3I55Z 4HH4A 3QWUA 2R7ZI 3F3FC 1RO4A 2NVXI 4MD7A 1RO0A 1VQO1 1JJ2Z 2QKDA 3S15I 1VQ9Z 3S2DI 2WAQA 3JAMf 4EWCA 3EERA 2K5RA 4TNUA 1I3QI 1K732 3GKQA 2QREB 4NB9A 4RVGA 5T6BA 1VQKZ 3I4MI 1Z03A 2OTLZ 3GTPI 3HOZI 3IF8A 2VF1A 1Q821 3EEDA 1L1OC
chains in the Genus database with same CATH topology
1VQMZ 2PK7A 3Q87A 1TWGI 2JA8I 3GTQI 3G6EZ 2JS4A 5T64A 1Y1VI 1YIJ1 1W2BZ 3HOUI 4RVHA 3CCQZ 2Q51A 3CMEZ 3CCJZ 4NBCA 2QR1B 3CCMZ 3CCSZ 1RLYA 1M1K1 4DQYB 1NJI2 1Y1VS 2QEX1 2I3CA 1W2BY 3GTMI 2GTIA 3RZDI 3CCV1 5AN9F 1VQ41 1LQLA 1YI2Z 4HGYA 2Q4ZA 4RS4A 2JMOA 3NH8A 3S2HI 2W04A 1NJI1 1QVFZ 2JA6I 1WIIA 4E33A 1S7MA 3CQZI 1YJW1 4MONA 3GTOI 3IFUA 1YUAA 2HU9A 1SFOI 1WCMI 2WB1A 1USPA 3GTGI 1I50I 1ZB8A 3PO3I 4A3MI 4A3II 3K7AI 3MZLB 4AYBA 1VQ5Z 2R6MA 2P28A 2B63I 5C4XI 4Y7NI 4A3FI 3PO3S 4E31A 3J7A4 1N8R1 4A3DI 1NP6A 4QTTA 3PO2I 2PMZA 3CC71 2V8JA 1ZB9A 1Q812 3CCU1 4DGLA 1TFIA 1VLAA 3GTJI 2QEXZ 1Q7Y2 4NBDA 3VMIA 5IT9b 3CCVZ 4MH4A 1X3ZA 3CC41 1TWFI 2E2II 3U50C 2QLVB 1DL6A 3J81b 2AKLA 2YADA 3J80f 1Y1WI 3S14I 5FLXf 3H0GI 1Q7Y1 2E2JI 4HGZA 4DK1A 4A3BI 1K83I 4NBBA 2H85A 1YJWZ 3S1QI 1VQP1 3CD61 2F4OA 4RV9A 1KD12 3G4S1 3GCFA 3S17I 1S72Z 3S1NI 2OTJ1 1YJNZ 1Z01A 1YHQ1 3OW2Z 5C4JI 5C3EI 1VQ71 2LIYA 4BBRI 2M6NA 4RVDA 1QYPA 1YJ91 2RIQA 1KD11 2RHBA 3M4OI 2G2KA 3OW2Y 1WW9A 1K731 1VQL1 3I07A 3CMA1 2NVTI 2GTHA 1K8A2 5C44I 2DE7A 4A3GI 1VQN1 2RPRA 2O53A 2QA4Z 1R9TI 1P9NA 4NB8A 4NH1C 2YU9I 3HOVI 1K8A1 3GTMS 2HF1A 3CPWY 2IZ4A 4NFRA 1VQOZ 1VQPZ 3NFZA 3G4SZ 3CCE1 2KI7B 1PFTA 3CCR1 5D1OB 2V8KA 1YUKA 2IZ3A 3NH5A 3VB9A 4QTUA 3S1RI 3F3PC 1TWHI 2K3RA 2PM9A 4MRIA 2RBLA 3RZOI 1TWCI 4NBHA 4NBEA 3M3YI 2Y0SA 4E2ZA 3VTNA 3MZKB 3CMAZ 1YIJZ 3GTLI 3HOYI 3CXCZ 1TWAI 3FQQA 4MD8A 1VQ91 4E2XA 1RQFA 5T67A 3D6WA 3HOWI 5FLMI 2JR6A 4E2WA 3D9XA 1Z02A 1VQNZ 2F4MA 3CXCY 2P3YA 2QRDB 1VQ4Z 2OOXB 4A3JI 5A2Qf 2J6AA 3CC21 3BG0B 1YIT1 2OTL1 1M902 1Q811 1VQM1 3G711 4CL1A 3VMHA 1KQSZ 1QVGY 4BXXI 2GU2A 2V8IA 3NDJA 3HKZA 3H3VJ 3CCEZ 2R93I 5FLXb 1RNIA 1K9M2 3CCQ1 3CME1 3CCJ1 1KQSY 3CCM1 3CCS1 3P5JB 2DE6A 2JUBA 2OOYB 4RVFA 1RO2A 1NUIA 1X3WA 2M48A 3KIHA 1YI21 3I4NI 3JAMb 1K9M1 3VMGA 4BY1I 1JWHC 4A3KI 4E30A 5IP9I 2O4HA 3NDIA 3CC7Z 2RT9A 3HOXI 1ZH1A 2LFUA 1Q822 3FQMA 3CCUZ 3I561 1JJ2Y 3IX0A 1VQ61 3CC4Z 3CC2Z 3CCL1 1YITZ 4MXUA 4NOZA 4A3CI 2EGTA 1M1K2 2JA7I 3CPWZ 3T4NB 3G71Z 1VQ51 1VQ81 3ESWA 1KRLA 5CM2M 2KPIA 1Q862 4BBSI 4XX2A 3CD6Z 4E2YA 3S1MI 2DE5A 4Y52I 4MD9A 2OTJZ 4X6AI 1YHQZ 2NVYI 2R92I 1ML8A 1VQ7Z 1Q861 4NBFA 1USPB 2ZAEB 1YJ9Z 5D1PA 3TE5B 3S16I 3I551 3FKII 4S1TA 1X0TA 2QRCB 3KIFA 3I56Z 5D1OA 1VQLZ 2JNYA 4E32A 2W03A 3BG1B 1QVFY 1VQ6Z 1N8R2 1N2FA 3CCLZ 1S721 1KC82 2VUGA 2E9HA 1YJN1 1VQK1 1VQ8Z 4BY7I 3GTKI 2VUMI 4NBGA 1QVGZ 2JA5I 3MONA 5IT9f 5A2Qb 4A3LI 5IP7I 1KC81 2E2HI 3J81f 3J80b 3G6E1 2BJOA 2OZKA 5LL6f 3CCRZ 2NVQI 4A3EI 4NBAA 1M901 3NH4A 1I6HI 2QA41 4A93I 1QF8A 3LUSA 3TDHB 3I55Z 4HH4A 3QWUA 2R7ZI 3F3FC 1RO4A 2NVXI 4MD7A 1RO0A 1VQO1 1JJ2Z 2QKDA 3S15I 1VQ9Z 3S2DI 2WAQA 3JAMf 4EWCA 3EERA 2K5RA 4TNUA 1I3QI 1K732 3GKQA 2QREB 4NB9A 4RVGA 5T6BA 1VQKZ 3I4MI 1Z03A 2OTLZ 3GTPI 3HOZI 3IF8A 2VF1A 1Q821 3EEDA 1L1OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PK7 A;  3Q87 A;  2NVY I;  2R92 I;  1ML8 A;  2P3Y A;  4NBF A;  1TWG I;  1USP B;  2F4O A;  2JA8 I;  4A3J I;  3GTQ I;  2J6A A;  2JS4 A;  3HOU I;  1Y1V I;  3GCF A;  3S16 I;  3S17 I;  3FKI I;  3S1N I;  4NBC A;  1RLY A;  2JNY A;  1Y1V S;  5C4J I;  5C3E I;  3GTM I;  3RZD I;  3VMH A;  4BBR I;  4BXX I;  1QYP A;  1N2F A;  3H3V J;  1LQL A;  3M4O I;  2R93 I;  1WW9 A;  3S2H I;  3I07 A;  2NVT I;  4BY7 I;  3GTK I;  2VUM I;  4NBG A;  2DE6 A;  2JA5 I;  2JA6 I;  5C44 I;  2DE7 A;  4A3G I;  1NUI A;  1X3W A;  3I4N I;  3CQZ I;  1R9T I;  3VMG A;  4BY1 I;  3GTO I;  4A3L I;  1YUA A;  1SFO I;  5IP7 I;  1WCM I;  4NB8 A;  4A3K I;  2E2H I;  5IP9 I;  2YU9 I;  3HOV I;  1USP A;  3GTG I;  2BJO A;  1I50 I;  3HOX I;  3GTM S;  2HF1 A;  1ZB8 A;  2NVQ I;  3PO3 I;  4A3E I;  4A3M I;  4A3I I;  3K7A I;  4NBA A;  1I6H I;  4A93 I;  2B63 I;  5C4X I;  4Y7N I;  4A3F I;  3PO3 S;  3S1Q I;  4A3D I;  3LUS A;  4QTT A;  3PO2 I;  1PFT A;  4NOZ A;  4A3C I;  2R7Z I;  1ZB9 A;  1RO4 A;  1TFI A;  1VLA A;  2NVX I;  2JA7 I;  3GTJ I;  4NBD A;  3VMI A;  3VB9 A;  4QTU A;  3S15 I;  3S2D I;  4MH4 A;  1X3Z A;  3S1R I;  1TWH I;  2RBL A;  1TWF I;  3ESW A;  3RZO I;  3EER A;  5CM2 M;  2E2I I;  1TWC I;  2K5R A;  1I3Q I;  4NBH A;  4NBE A;  2KPI A;  3U50 C;  3M3Y I;  1DL6 A;  3GKQ A;  4BBS I;  2AKL A;  4XX2 A;  1Y1W I;  4NB9 A;  3S14 I;  3H0G I;  3S1M I;  3GTL I;  2DE5 A;  3HOY I;  1TWA I;  2E2J I;  3I4M I;  4Y52 I;  3GTP I;  3HOZ I;  3D6W A;  3HOW I;  4A3B I;  1K83 I;  5FLM I;  2JR6 A;  4NBB A;  4X6A I;  1L1O C;  2F4M A; 
#chains in the Genus database with same CATH topology
 1VQM Z;  2PK7 A;  3Q87 A;  2JIO A;  1TWG I;  2JA8 I;  2IV2 X;  3GTQ I;  3G6E Z;  2JS4 A;  5T64 A;  1Y1V I;  1YIJ 1;  1W2B Z;  3HOU I;  4RVH A;  3CCQ Z;  2Q51 A;  3CME Z;  3CCJ Z;  4NBC A;  1Q16 A;  2QR1 B;  3CCM Z;  3CCS Z;  1RLY A;  1M1K 1;  4DQY B;  1NJI 2;  1Y1V S;  2QEX 1;  2I3C A;  1W2B Y;  3GTM I;  2GTI A;  3RZD I;  3CCV 1;  5AN9 F;  1VQ4 1;  1LQL A;  1YI2 Z;  4HGY A;  2Q4Z A;  4RS4 A;  2JMO A;  3NH8 A;  3S2H I;  2W04 A;  1NJI 1;  1QVF Z;  2JA6 I;  1WII A;  4E33 A;  2JIR A;  1S7M A;  3CQZ I;  1YJW 1;  4MON A;  3GTO I;  3IFU A;  1YUA A;  2HU9 A;  1SFO I;  1WCM I;  2AYD A;  2WB1 A;  1FDI A;  1USP A;  3GTG I;  1I50 I;  1ZB8 A;  3PO3 I;  4A3M I;  4A3I I;  3K7A I;  3MZL B;  4AYB A;  1VQ5 Z;  2R6M A;  2P28 A;  2B63 I;  5C4X I;  4Y7N I;  2VPX A;  4A3F I;  3PO3 S;  4E31 A;  3J7A 4;  1N8R 1;  4A3D I;  1NP6 A;  4QTT A;  3PO2 I;  2PMZ A;  3CC7 1;  2V8J A;  1WJ2 A;  1ZB9 A;  1Q81 2;  3CCU 1;  4DGL A;  1TFI A;  1VLA A;  3GTJ I;  2QEX Z;  1Q7Y 2;  4NBD A;  3VMI A;  1AA6 A;  5IT9 b;  3CCV Z;  4MH4 A;  1X3Z A;  3CC4 1;  1TWF I;  2E2I I;  3U50 C;  2QLV B;  1DL6 A;  3J81 b;  2AKL A;  2YAD A;  3J80 f;  1Y1W I;  3S14 I;  5FLX f;  3H0G I;  1Q7Y 1;  2E2J I;  4HGZ A;  4DK1 A;  4A3B I;  1K83 I;  4NBB A;  2H85 A;  1YJW Z;  3S1Q I;  1Y8C A;  3IR7 A;  1VQP 1;  3CD6 1;  1FDO A;  2F4O A;  4RV9 A;  1KD1 2;  2VPW A;  3G4S 1;  3GCF A;  3S17 I;  1S72 Z;  2JIQ A;  3S1N I;  2OTJ 1;  1YJN Z;  2LEX A;  1Z01 A;  1YHQ 1;  3OW2 Z;  5C4J I;  5C3E I;  1VQ7 1;  2LIY A;  4BBR I;  2M6N A;  4RVD A;  1QYP A;  1YJ9 1;  2RIQ A;  1KD1 1;  2RHB A;  3M4O I;  2G2K A;  3OW2 Y;  1WW9 A;  1K73 1;  1VQL 1;  3I07 A;  3CMA 1;  2NVT I;  2GTH A;  1K8A 2;  2JIM A;  5C44 I;  2DE7 A;  4A3G I;  1VQN 1;  2RPR A;  2O53 A;  2QA4 Z;  1R9T I;  1P9N A;  4NB8 A;  4NH1 C;  2YU9 I;  3HOV I;  2NAP A;  1K8A 1;  3GTM S;  2HF1 A;  3CPW Y;  2IZ4 A;  4NFR A;  1VQO Z;  1VQP Z;  3NFZ A;  3G4S Z;  3CCE 1;  2KI7 B;  1PFT A;  3CCR 1;  5D1O B;  2V8K A;  1YUK A;  2IZ3 A;  3NH5 A;  3VB9 A;  4QTU A;  3F3P C;  3S1R I;  1TWH I;  2K3R A;  2PM9 A;  4MRI A;  2RBL A;  3RZO I;  1TWC I;  4NBH A;  4NBE A;  3M3Y I;  2Y0S A;  4E2Z A;  3VTN A;  3MZK B;  3CMA Z;  1YIJ Z;  3GTL I;  3HOY I;  3CXC Z;  1TWA I;  3FQQ A;  4MD8 A;  1VQ9 1;  4E2X A;  1RQF A;  5T67 A;  3D6W A;  3HOW I;  5FLM I;  2JR6 A;  4E2W A;  3D9X A;  1Z02 A;  1VQN Z;  2F4M A;  3CXC Y;  2P3Y A;  2QRD B;  1VQ4 Z;  2OOX B;  4A3J I;  5A2Q f;  2J6A A;  3CC2 1;  3BG0 B;  1YIT 1;  2OTL 1;  1M90 2;  1Q81 1;  1VQM 1;  1WZN A;  3G71 1;  4CL1 A;  3VMH A;  1KQS Z;  3D2L A;  1QVG Y;  4BXX I;  2GU2 A;  2V8I A;  2JIP A;  3NDJ A;  3HKZ A;  3H3V J;  3CCE Z;  2R93 I;  5FLX b;  1RNI A;  1K9M 2;  3CCQ 1;  3CME 1;  3CCJ 1;  1KQS Y;  3CCM 1;  3CCS 1;  3P5J B;  2DE6 A;  2V45 A;  2JUB A;  2OOY B;  4RVF A;  1RO2 A;  1NUI A;  1X3W A;  2M48 A;  3KIH A;  1YI2 1;  3I4N I;  3JAM b;  1K9M 1;  3VMG A;  2V3V A;  4BY1 I;  1JWH C;  4A3K I;  4E30 A;  5IP9 I;  2O4H A;  3NDI A;  3CC7 Z;  2RT9 A;  3HOX I;  1ZH1 A;  2LFU A;  1Q82 2;  3FQM A;  3CCU Z;  3I56 1;  1JJ2 Y;  3IX0 A;  1VQ6 1;  3CC4 Z;  2VPY A;  3CC2 Z;  3CCL 1;  1YIT Z;  4MXU A;  1SIW A;  4NOZ A;  4A3C I;  2EGT A;  1M1K 2;  2JA7 I;  3CPW Z;  3T4N B;  3G71 Z;  1VQ5 1;  1VQ8 1;  3ESW A;  1KRL A;  5CM2 M;  2KPI A;  1Q86 2;  4BBS I;  4XX2 A;  3CD6 Z;  4E2Y A;  3S1M I;  2DE5 A;  4Y52 I;  4MD9 A;  2OTJ Z;  4X6A I;  1YHQ Z;  2NVY I;  2R92 I;  1ML8 A;  1VQ7 Z;  1Q86 1;  4NBF A;  1USP B;  2ZAE B;  1QXF A;  1YJ9 Z;  5D1P A;  3TE5 B;  3S16 I;  3I55 1;  3FKI I;  4S1T A;  1X0T A;  2QRC B;  3KIF A;  3I56 Z;  5D1O A;  1VQL Z;  2JNY A;  4E32 A;  2W03 A;  3BG1 B;  1QVF Y;  1VQ6 Z;  1N8R 2;  1N2F A;  3CCL Z;  1S72 1;  1KC8 2;  2VUG A;  2E9H A;  1YJN 1;  1VQK 1;  1VQ8 Z;  4BY7 I;  3GTK I;  2VUM I;  4NBG A;  1QVG Z;  2JA5 I;  3MON A;  5IT9 f;  5A2Q b;  4A3L I;  5IP7 I;  1KC8 1;  2E2H I;  3J81 f;  3J80 b;  3G6E 1;  2BJO A;  2OZK A;  5LL6 f;  2VPZ A;  3CCR Z;  2NVQ I;  2E7Z A;  4A3E I;  4NBA A;  1M90 1;  3NH4 A;  1I6H I;  2QA4 1;  4A93 I;  1QF8 A;  3LUS A;  3TDH B;  3I55 Z;  4HH4 A;  3QWU A;  2R7Z I;  3F3F C;  1RO4 A;  2NVX I;  4MD7 A;  1RO0 A;  1VQO 1;  1JJ2 Z;  2QKD A;  3S15 I;  1VQ9 Z;  3S2D I;  2WAQ A;  3JAM f;  4EWC A;  3EER A;  2K5R A;  4TNU A;  1I3Q I;  1K73 2;  3GKQ A;  2QRE B;  4NB9 A;  4RVG A;  5T6B A;  1VQK Z;  3I4M I;  1Z03 A;  2OTL Z;  3GTP I;  3HOZ I;  3IF8 A;  2VF1 A;  1Q82 1;  3EED A;  1L1O C; 
#chains in the Genus database with same CATH homology
 1VQM Z;  2PK7 A;  3Q87 A;  1TWG I;  2JA8 I;  3GTQ I;  3G6E Z;  2JS4 A;  5T64 A;  1Y1V I;  1YIJ 1;  1W2B Z;  3HOU I;  4RVH A;  3CCQ Z;  2Q51 A;  3CME Z;  3CCJ Z;  4NBC A;  2QR1 B;  3CCM Z;  3CCS Z;  1RLY A;  1M1K 1;  4DQY B;  1NJI 2;  1Y1V S;  2QEX 1;  2I3C A;  1W2B Y;  3GTM I;  2GTI A;  3RZD I;  3CCV 1;  5AN9 F;  1VQ4 1;  1LQL A;  1YI2 Z;  4HGY A;  2Q4Z A;  4RS4 A;  2JMO A;  3NH8 A;  3S2H I;  2W04 A;  1NJI 1;  1QVF Z;  2JA6 I;  1WII A;  4E33 A;  1S7M A;  3CQZ I;  1YJW 1;  4MON A;  3GTO I;  3IFU A;  1YUA A;  2HU9 A;  1SFO I;  1WCM I;  2WB1 A;  1USP A;  3GTG I;  1I50 I;  1ZB8 A;  3PO3 I;  4A3M I;  4A3I I;  3K7A I;  3MZL B;  4AYB A;  1VQ5 Z;  2R6M A;  2P28 A;  2B63 I;  5C4X I;  4Y7N I;  4A3F I;  3PO3 S;  4E31 A;  3J7A 4;  1N8R 1;  4A3D I;  1NP6 A;  4QTT A;  3PO2 I;  2PMZ A;  3CC7 1;  2V8J A;  1ZB9 A;  1Q81 2;  3CCU 1;  4DGL A;  1TFI A;  1VLA A;  3GTJ I;  2QEX Z;  1Q7Y 2;  4NBD A;  3VMI A;  5IT9 b;  3CCV Z;  4MH4 A;  1X3Z A;  3CC4 1;  1TWF I;  2E2I I;  3U50 C;  2QLV B;  1DL6 A;  3J81 b;  2AKL A;  2YAD A;  3J80 f;  1Y1W I;  3S14 I;  5FLX f;  3H0G I;  1Q7Y 1;  2E2J I;  4HGZ A;  4DK1 A;  4A3B I;  1K83 I;  4NBB A;  2H85 A;  1YJW Z;  3S1Q I;  1VQP 1;  3CD6 1;  2F4O A;  4RV9 A;  1KD1 2;  3G4S 1;  3GCF A;  3S17 I;  1S72 Z;  3S1N I;  2OTJ 1;  1YJN Z;  1Z01 A;  1YHQ 1;  3OW2 Z;  5C4J I;  5C3E I;  1VQ7 1;  2LIY A;  4BBR I;  2M6N A;  4RVD A;  1QYP A;  1YJ9 1;  2RIQ A;  1KD1 1;  2RHB A;  3M4O I;  2G2K A;  3OW2 Y;  1WW9 A;  1K73 1;  1VQL 1;  3I07 A;  3CMA 1;  2NVT I;  2GTH A;  1K8A 2;  5C44 I;  2DE7 A;  4A3G I;  1VQN 1;  2RPR A;  2O53 A;  2QA4 Z;  1R9T I;  1P9N A;  4NB8 A;  4NH1 C;  2YU9 I;  3HOV I;  1K8A 1;  3GTM S;  2HF1 A;  3CPW Y;  2IZ4 A;  4NFR A;  1VQO Z;  1VQP Z;  3NFZ A;  3G4S Z;  3CCE 1;  2KI7 B;  1PFT A;  3CCR 1;  5D1O B;  2V8K A;  1YUK A;  2IZ3 A;  3NH5 A;  3VB9 A;  4QTU A;  3S1R I;  3F3P C;  1TWH I;  2K3R A;  2PM9 A;  4MRI A;  2RBL A;  3RZO I;  1TWC I;  4NBH A;  4NBE A;  3M3Y I;  2Y0S A;  4E2Z A;  3VTN A;  3MZK B;  3CMA Z;  1YIJ Z;  3GTL I;  3HOY I;  3CXC Z;  1TWA I;  3FQQ A;  4MD8 A;  1VQ9 1;  4E2X A;  1RQF A;  5T67 A;  3D6W A;  3HOW I;  5FLM I;  2JR6 A;  4E2W A;  3D9X A;  1Z02 A;  1VQN Z;  2F4M A;  3CXC Y;  2P3Y A;  2QRD B;  1VQ4 Z;  2OOX B;  4A3J I;  5A2Q f;  2J6A A;  3CC2 1;  3BG0 B;  1YIT 1;  2OTL 1;  1M90 2;  1Q81 1;  1VQM 1;  3G71 1;  4CL1 A;  3VMH A;  1KQS Z;  1QVG Y;  4BXX I;  2GU2 A;  2V8I A;  3NDJ A;  3HKZ A;  3H3V J;  3CCE Z;  2R93 I;  5FLX b;  1RNI A;  1K9M 2;  3CCQ 1;  3CME 1;  3CCJ 1;  1KQS Y;  3CCM 1;  3CCS 1;  3P5J B;  2DE6 A;  2JUB A;  2OOY B;  4RVF A;  1RO2 A;  1NUI A;  1X3W A;  2M48 A;  3KIH A;  1YI2 1;  3I4N I;  3JAM b;  1K9M 1;  3VMG A;  4BY1 I;  1JWH C;  4A3K I;  4E30 A;  5IP9 I;  2O4H A;  3NDI A;  3CC7 Z;  2RT9 A;  3HOX I;  1ZH1 A;  2LFU A;  1Q82 2;  3FQM A;  3CCU Z;  3I56 1;  1JJ2 Y;  3IX0 A;  1VQ6 1;  3CC4 Z;  3CC2 Z;  3CCL 1;  1YIT Z;  4MXU A;  4NOZ A;  4A3C I;  2EGT A;  1M1K 2;  2JA7 I;  3CPW Z;  3T4N B;  3G71 Z;  1VQ5 1;  1VQ8 1;  3ESW A;  1KRL A;  5CM2 M;  2KPI A;  1Q86 2;  4BBS I;  4XX2 A;  3CD6 Z;  4E2Y A;  3S1M I;  2DE5 A;  4Y52 I;  4MD9 A;  2OTJ Z;  4X6A I;  1YHQ Z;  2NVY I;  2R92 I;  1ML8 A;  1VQ7 Z;  1Q86 1;  4NBF A;  1USP B;  2ZAE B;  1YJ9 Z;  5D1P A;  3TE5 B;  3S16 I;  3I55 1;  3FKI I;  4S1T A;  1X0T A;  2QRC B;  3KIF A;  3I56 Z;  5D1O A;  1VQL Z;  2JNY A;  4E32 A;  2W03 A;  3BG1 B;  1QVF Y;  1VQ6 Z;  1N8R 2;  1N2F A;  3CCL Z;  1S72 1;  1KC8 2;  2VUG A;  2E9H A;  1YJN 1;  1VQK 1;  1VQ8 Z;  4BY7 I;  3GTK I;  2VUM I;  4NBG A;  1QVG Z;  2JA5 I;  3MON A;  5IT9 f;  5A2Q b;  4A3L I;  5IP7 I;  1KC8 1;  2E2H I;  3J81 f;  3J80 b;  3G6E 1;  2BJO A;  2OZK A;  5LL6 f;  3CCR Z;  2NVQ I;  4A3E I;  4NBA A;  1M90 1;  3NH4 A;  1I6H I;  2QA4 1;  4A93 I;  1QF8 A;  3LUS A;  3TDH B;  3I55 Z;  4HH4 A;  3QWU A;  2R7Z I;  3F3F C;  1RO4 A;  2NVX I;  4MD7 A;  1RO0 A;  1VQO 1;  1JJ2 Z;  2QKD A;  3S15 I;  1VQ9 Z;  3S2D I;  2WAQ A;  3JAM f;  4EWC A;  3EER A;  2K5R A;  4TNU A;  1I3Q I;  1K73 2;  3GKQ A;  2QRE B;  4NB9 A;  4RVG A;  5T6B A;  1VQK Z;  3I4M I;  1Z03 A;  2OTL Z;  3GTP I;  3HOZ I;  3IF8 A;  2VF1 A;  1Q82 1;  3EED A;  1L1O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...