3S2DI

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI02
3HOYI 1NUIA 2DE6A 3LUSA 2AKLA 5FLMI 4A3FI 3GTQI 4A3MI 1R9TI 2RBLA 1YUAA 3HOUI 3HOVI 2JNYA 4QTUA 4BY7I 2VUMI 1RLYA 2YU9I 2JA5I 1I3QI 4NBHA 4A3II 1QYPA 4A3DI 3S16I 3GTKI 3HOZI 4NBBA 1Y1WI 1USPA 3GTLI 1TWAI 4QTTA 1ZB8A 4NOZA 4A3KI 2KPIA 3GTPI 2DE7A 5C3EI 1RO4A 3U50C 3PO3I 1L1OC 4BBSI 3K7AI 3PO3S 2PK7A 4A93I 1X3ZA 2HF1A 3S2HI 3S15I 2F4OA 2R7ZI 3GKQA 3GTJI 4BY1I 3S2DI 3HOXI 1TWFI 4A3EI 3M4OI 1WCMI 1WW9A 2B63I 3Q87A 3RZOI 3GTOI 3GCFA 3VMHA 2JA7I 2E2II 3H3VJ 4NBDA 2J6AA 4A3LI 2NVYI 1ZB9A 1PFTA 3S17I 3VMIA 5C44I 3I4NI 2JR6A 1Y1VI 3M3YI 1Y1VS 2JS4A 1TFIA 2K5RA 4Y7NI 2E2JI 4A3GI 3PO2I 4NB9A 1TWGI 3S14I 3FKII 2BJOA 4A3BI 1USPB 3S1RI 1N2FA 4NBGA 2NVTI 1X3WA 1I50I 3H0GI 1TWHI 3VMGA 2E2HI 4A3CI 4NBFA 4NBEA 1K83I 1I6HI 2P3YA 5C4JI 2R93I 4XX2A 5CM2M 3I07A 2NVQI 3GTMI 2F4MA 3CQZI 3GTMS 3I4MI 3D6WA 4X6AI 4Y52I 3S1QI 4BBRI 1TWCI 1DL6A 3ESWA 4NBCA 3S1MI 3S1NI 5IP9I 3GTGI 4BXXI 5C4XI 1LQLA 3RZDI 1SFOI 3VB9A 4MH4A 4NB8A 1ML8A 3HOWI 2R92I 2NVXI 2JA6I 3EERA 1VLAA 4NBAA 2JA8I 4A3JI 5IP7I 2DE5A
chains in the Genus database with same CATH superfamily
4HGZA 2RT9A 2V45A 2AKLA 5FLMI 3GTQI 1YJWZ 1R9TI 2IZ3A 1KC81 2QRCB 2GTHA 2HU9A 2QLVB 2Y0SA 2VUMI 4BY7I 2YU9I 1I3QI 1QYPA 2V8IA 2QA4Z 3GTKI 1KD12 3HOZI 2LIYA 3GTLI 1ZB8A 4NOZA 1RO0A 3CPWY 5A2Qf 1RO4A 3IR7A 2JIPA 3U50C 2I3CA 1YJN1 3PO3I 3CD6Z 4A93I 3KIFA 3CCQZ 3S2HI 2JIQA 2F4OA 3HOXI 2JIRA 2E2II 2V8KA 2E7ZA 1KQSY 1ZB9A 3CCUZ 3VTNA 2JUBA 3I4NI 3IFUA 3M3YI 3CCR1 1KD11 2E2JI 1TWGI 5FLXb 2V8JA 2IZ4A 4A3BI 2BJOA 2YADA 3CCRZ 1Q811 2OOXB 1I6HI 2OTL1 3F3FC 4XX2A 2R93I 5CM2M 3I07A 2NVQI 3GTMI 2WB1A 3QWUA 3CCM1 1QVGY 2F4MA 3IX0A 2JIOA 2JMOA 3S1QI 4BBRI 2EGTA 4MD8A 2OTLZ 5IT9b 3ESWA 2O4HA 4NBCA 3GTGI 1YI21 5C4XI 4RVDA 4E2YA 3RZDI 1FDOA 3VB9A 1YI2Z 4NB8A 1VQPZ 1VQ61 3MZLB 4MXUA 3BG1B 5T64A 1VQ6Z 1NUIA 3J81f 2QREB 3J80f 1K8A1 2PM9A 5A2Qb 1YIT1 1VQ9Z 2RBLA 4MONA 2VPWA 2ZAEB 3CMA1 3J7A4 1YITZ 2JA5I 4E2XA 1VQ71 3FQQA 3MONA 4A3II 1VQM1 1QVFY 3MZKB 3G6E1 1Q862 5D1OB 4MD9A 4QTTA 1VQ7Z 3FQMA 2DE7A 5C3EI 1W2BY 3G6EZ 2OTJ1 3NDJA 1L1OC 3I551 1VQK1 3K7AI 3CC41 2HF1A 3GTJI 4BY1I 3I55Z 1TWFI 1VQKZ 3CC4Z 1QVFZ 3M4OI 1WCMI 1P9NA 4TNUA 3RZOI 1M1K2 1X0TA 4NFRA 1PFTA 2H85A 3S17I 3VMIA 2JR6A 3JAMb 1Y1VS 1TFIA 2K5RA 2Q51A 1YHQ1 1Q861 1Q7Y1 2LEXA 1VQL1 2O53A 3S14I 5LL6f 3FKII 1USPB 3S1RI 1YJNZ 2NVTI 2M6NA 3CCE1 4NBEA 3D2LA 1RO2A 3CPWZ 1K732 3OW2Y 2QEX1 3CCV1 3I4MI 4Y52I 1RQFA 1TWCI 2PMZA 1VQ41 2V3VA 2G2KA 5D1OA 1M1K1 1M902 4BXXI 2QEXZ 3CCVZ 2LFUA 3CXCY 1VQ4Z 2VPZA 1N8R2 3CC71 4E2ZA 4E30A 4AYBA 2R92I 2VUGA 1KQSZ 3BG0B 4NBAA 1QF8A 4A3JI 3HOYI 4CL1A 4EWCA 3LUSA 4A3FI 3EEDA 1YUAA 2E9HA 3CCMZ 3P5JB 2JNYA 3IF8A 4E31A 1RLYA 1M901 1FDIA 1VQ81 3NFZA 4NBBA 1USPA 1Z02A 1YIJ1 1WZNA 1QVGZ 1VQN1 1N8R1 4A3KI 2NAPA 1VQ8Z 4DQYB 3GTPI 1RNIA 3CCJ1 1YIJZ 3PO3S 1VQNZ 2PK7A 1X3ZA 3CME1 2R6MA 2R7ZI 3T4NB 4A3EI 1WW9A 3G711 3G4S1 3GCFA 4S1TA 3CMAZ 4NH1C 2JA7I 3H3VJ 1YJ91 4A3LI 2NVYI 1S721 3CC21 1VQMZ 5C44I 2P28A 4E33A 5FLXf 3TE5B 2JS4A 1YJ9Z 4Y7NI 3PO2I 1S72Z 4NB9A 3CC2Z 1VQ51 2GTIA 1Q822 2OTJZ 4NBGA 2OOYB 1X3WA 1VQ5Z 1I50I 2JIMA 2W03A 3VMGA 2E2HI 1ZH1A 4NBFA 1W2BZ 5IT9f 4RVHA 3GTMS 4X6AI 1SIWA 3D6WA 1Z01A 4RV9A 1DL6A 3NDIA 4RVFA 2QA41 3F3PC 3TDHB 4E2WA 2RHBA 1YHQZ 2RIQA 2VF1A 1VQLZ 3CD61 1VLAA 2JA8I 1Q821 3CCQ1 3CCL1 2DE5A 3D9XA 1Q812 2VPXA 2DE6A 3CCEZ 4A3MI 3J81b 3CCLZ 3J80b 1JJ2Y 1YUKA 3HOUI 3HOVI 4QTUA 2W04A 3NH8A 4NBHA 2Q4ZA 3CCU1 4A3DI 3S16I 1KRLA 1Y1WI 2GU2A 3OW2Z 1TWAI 3CC7Z 2RPRA 4RS4A 2KPIA 1JJ2Z 4BBSI 4MD7A 1WIIA 3CXCZ 3S15I 3GKQA 1NJI2 3S2DI 4RVGA 1K731 5T6BA 2B63I 3Q87A 1VQO1 4MRIA 1K8A2 3GTOI 1Q16A 3VMHA 1S7MA 4HH4A 3NH4A 4NBDA 1VQOZ 2J6AA 3JAMf 1K9M2 3NH5A 2WAQA 1Y1VI 1NP6A 3KIHA 3I561 4A3GI 1VQP1 3CCS1 5T67A 3CCJZ 1N2FA 3I56Z 2KI7B 4E32A 2AYDA 3H0GI 3CMEZ 3CCSZ 1TWHI 2OZKA 4A3CI 1JWHC 2QKDA 4DGLA 1K83I 1NJI1 2K3RA 2P3YA 2QR1B 5C4JI 1KC82 1QXFA 1WJ2A 1VQ91 1Y8CA 3G71Z 3G4SZ 3CQZI 4HGYA 2QRDB 5D1PA 2M48A 4DK1A 3S1MI 3S1NI 5IP9I 1LQLA 1K9M1 1AA6A 3HKZA 1SFOI 4MH4A 1ML8A 3HOWI 2IV2X 2NVXI 2JA6I 1Z03A 2VPYA 1Q7Y2 3EERA 5AN9F 1YJW1 5IP7I
chains in the Genus database with same CATH topology
4HGZA 2RT9A 2AKLA 5FLMI 3GTQI 1YJWZ 1R9TI 2IZ3A 1KC81 2QRCB 2GTHA 2HU9A 2QLVB 2Y0SA 2VUMI 4BY7I 2YU9I 1I3QI 1QYPA 2V8IA 2QA4Z 3GTKI 1KD12 3HOZI 2LIYA 3GTLI 1ZB8A 4NOZA 1RO0A 3CPWY 5A2Qf 1RO4A 3U50C 2I3CA 1YJN1 3PO3I 3CD6Z 4A93I 3KIFA 3CCQZ 3S2HI 2F4OA 3HOXI 2E2II 2V8KA 1KQSY 1ZB9A 3CCUZ 3VTNA 2JUBA 3I4NI 3IFUA 3M3YI 3CCR1 1KD11 2E2JI 1TWGI 5FLXb 2V8JA 2IZ4A 4A3BI 2BJOA 2YADA 3CCRZ 1Q811 2OOXB 1I6HI 2OTL1 3F3FC 4XX2A 2R93I 5CM2M 3I07A 2NVQI 3GTMI 2WB1A 3QWUA 3CCM1 1QVGY 2F4MA 3IX0A 2JMOA 3S1QI 4MD8A 2EGTA 4BBRI 2OTLZ 5IT9b 3ESWA 2O4HA 4NBCA 3GTGI 1YI21 5C4XI 4RVDA 4E2YA 3RZDI 3VB9A 1YI2Z 4NB8A 1VQPZ 1VQ61 3MZLB 4MXUA 3BG1B 5T64A 1VQ6Z 1NUIA 3J81f 2QREB 3J80f 1K8A1 2PM9A 5A2Qb 1YIT1 1VQ9Z 2RBLA 4MONA 2ZAEB 3CMA1 3J7A4 1YITZ 2JA5I 4E2XA 1VQ71 3FQQA 3MONA 4A3II 1VQM1 1QVFY 3MZKB 3G6E1 1Q862 5D1OB 4MD9A 4QTTA 1VQ7Z 3FQMA 2DE7A 5C3EI 1W2BY 3G6EZ 2OTJ1 3NDJA 1L1OC 3I551 1VQK1 3K7AI 3CC41 2HF1A 3GTJI 4BY1I 3I55Z 1TWFI 1VQKZ 3CC4Z 1QVFZ 3M4OI 1WCMI 1P9NA 4TNUA 3RZOI 1M1K2 1X0TA 4NFRA 1PFTA 2H85A 3S17I 3VMIA 2JR6A 3JAMb 1Y1VS 1TFIA 2K5RA 2Q51A 1YHQ1 1Q861 1Q7Y1 1VQL1 2O53A 3S14I 5LL6f 3FKII 1USPB 3S1RI 1YJNZ 2NVTI 2M6NA 3CCE1 4NBEA 1RO2A 3CPWZ 1K732 3OW2Y 2QEX1 3CCV1 3I4MI 4Y52I 1RQFA 1TWCI 2PMZA 1VQ41 2G2KA 5D1OA 1M1K1 1M902 4BXXI 2QEXZ 3CCVZ 2LFUA 3CXCY 1VQ4Z 1N8R2 3CC71 4E2ZA 4E30A 4AYBA 2R92I 2VUGA 1KQSZ 3BG0B 4NBAA 1QF8A 4A3JI 3HOYI 4CL1A 4EWCA 3LUSA 4A3FI 3EEDA 1YUAA 2E9HA 3CCMZ 3P5JB 2JNYA 3IF8A 4E31A 1RLYA 1M901 1VQ81 3NFZA 4NBBA 1USPA 1Z02A 1YIJ1 1QVGZ 1VQN1 1N8R1 4A3KI 1VQ8Z 4DQYB 3GTPI 1RNIA 3CCJ1 1YIJZ 3PO3S 1VQNZ 2PK7A 1X3ZA 3CME1 2R6MA 2R7ZI 3T4NB 4A3EI 1WW9A 3G711 3G4S1 3GCFA 4S1TA 3CMAZ 4NH1C 2JA7I 3H3VJ 1YJ91 4A3LI 2NVYI 1S721 3CC21 1VQMZ 5C44I 2P28A 4E33A 5FLXf 3TE5B 2JS4A 1YJ9Z 4Y7NI 3PO2I 1S72Z 4NB9A 3CC2Z 1VQ51 2GTIA 1Q822 2OTJZ 4NBGA 2OOYB 1X3WA 1VQ5Z 1I50I 2W03A 3VMGA 2E2HI 1ZH1A 4NBFA 1W2BZ 5IT9f 4RVHA 3GTMS 4X6AI 3D6WA 1Z01A 4RV9A 1DL6A 3NDIA 4RVFA 2QA41 3F3PC 3TDHB 4E2WA 2RHBA 1YHQZ 2RIQA 2VF1A 1VQLZ 3CD61 1VLAA 2JA8I 1Q821 3CCQ1 3CCL1 2DE5A 3D9XA 1Q812 2DE6A 3CCEZ 4A3MI 3J81b 3CCLZ 3J80b 1JJ2Y 1YUKA 3HOUI 3HOVI 4QTUA 2W04A 3NH8A 4NBHA 2Q4ZA 3CCU1 4A3DI 3S16I 1KRLA 1Y1WI 2GU2A 3OW2Z 1TWAI 3CC7Z 2RPRA 4RS4A 2KPIA 1JJ2Z 4BBSI 4MD7A 1WIIA 3CXCZ 3S15I 3GKQA 1NJI2 3S2DI 4RVGA 1K731 5T6BA 2B63I 3Q87A 1VQO1 4MRIA 1K8A2 3GTOI 3VMHA 1S7MA 4HH4A 3NH4A 4NBDA 1VQOZ 2J6AA 3JAMf 1K9M2 3NH5A 2WAQA 1Y1VI 1NP6A 3KIHA 3I561 4A3GI 1VQP1 3CCS1 5T67A 3CCJZ 1N2FA 3I56Z 2KI7B 4E32A 3H0GI 3CMEZ 3CCSZ 1TWHI 2OZKA 4A3CI 1JWHC 2QKDA 4DGLA 1K83I 1NJI1 2K3RA 2P3YA 2QR1B 5C4JI 1KC82 1VQ91 3G71Z 3G4SZ 3CQZI 4HGYA 2QRDB 5D1PA 2M48A 4DK1A 3S1MI 3S1NI 5IP9I 1LQLA 1K9M1 3HKZA 1SFOI 4MH4A 1ML8A 3HOWI 2NVXI 2JA6I 1Z03A 1Q7Y2 3EERA 5AN9F 1YJW1 5IP7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY I;  1NUI A;  2DE6 A;  3LUS A;  2AKL A;  5FLM I;  4A3F I;  3GTQ I;  4A3M I;  1R9T I;  2RBL A;  1YUA A;  3HOU I;  3HOV I;  2JNY A;  4QTU A;  4BY7 I;  2VUM I;  1RLY A;  2YU9 I;  2JA5 I;  1I3Q I;  4NBH A;  4A3I I;  1QYP A;  4A3D I;  3S16 I;  3GTK I;  3HOZ I;  4NBB A;  1Y1W I;  1USP A;  3GTL I;  1TWA I;  4QTT A;  1ZB8 A;  4NOZ A;  4A3K I;  2KPI A;  3GTP I;  2DE7 A;  5C3E I;  1RO4 A;  3U50 C;  3PO3 I;  1L1O C;  4BBS I;  3K7A I;  3PO3 S;  2PK7 A;  4A93 I;  1X3Z A;  2HF1 A;  3S2H I;  3S15 I;  2F4O A;  2R7Z I;  3GKQ A;  3GTJ I;  4BY1 I;  3S2D I;  3HOX I;  1TWF I;  4A3E I;  3M4O I;  1WCM I;  1WW9 A;  2B63 I;  3Q87 A;  3RZO I;  3GTO I;  3GCF A;  3VMH A;  2JA7 I;  2E2I I;  3H3V J;  4NBD A;  2J6A A;  4A3L I;  2NVY I;  1ZB9 A;  1PFT A;  3S17 I;  3VMI A;  5C44 I;  3I4N I;  2JR6 A;  1Y1V I;  3M3Y I;  1Y1V S;  2JS4 A;  1TFI A;  2K5R A;  4Y7N I;  2E2J I;  4A3G I;  3PO2 I;  4NB9 A;  1TWG I;  3S14 I;  3FKI I;  2BJO A;  4A3B I;  1USP B;  3S1R I;  1N2F A;  4NBG A;  2NVT I;  1X3W A;  1I50 I;  3H0G I;  1TWH I;  3VMG A;  2E2H I;  4A3C I;  4NBF A;  4NBE A;  1K83 I;  1I6H I;  2P3Y A;  5C4J I;  2R93 I;  4XX2 A;  5CM2 M;  3I07 A;  2NVQ I;  3GTM I;  2F4M A;  3CQZ I;  3GTM S;  3I4M I;  3D6W A;  4X6A I;  4Y52 I;  3S1Q I;  4BBR I;  1TWC I;  1DL6 A;  3ESW A;  4NBC A;  3S1M I;  3S1N I;  5IP9 I;  3GTG I;  4BXX I;  5C4X I;  1LQL A;  3RZD I;  1SFO I;  3VB9 A;  4MH4 A;  4NB8 A;  1ML8 A;  3HOW I;  2R92 I;  2NVX I;  2JA6 I;  3EER A;  1VLA A;  4NBA A;  2JA8 I;  4A3J I;  5IP7 I;  2DE5 A; 
#chains in the Genus database with same CATH topology
 4HGZ A;  2RT9 A;  2V45 A;  2AKL A;  5FLM I;  3GTQ I;  1YJW Z;  1R9T I;  2IZ3 A;  1KC8 1;  2QRC B;  2GTH A;  2HU9 A;  2QLV B;  2Y0S A;  2VUM I;  4BY7 I;  2YU9 I;  1I3Q I;  1QYP A;  2V8I A;  2QA4 Z;  3GTK I;  1KD1 2;  3HOZ I;  2LIY A;  3GTL I;  1ZB8 A;  4NOZ A;  1RO0 A;  3CPW Y;  5A2Q f;  1RO4 A;  3IR7 A;  2JIP A;  3U50 C;  2I3C A;  1YJN 1;  3PO3 I;  3CD6 Z;  4A93 I;  3KIF A;  3CCQ Z;  3S2H I;  2JIQ A;  2F4O A;  3HOX I;  2JIR A;  2E2I I;  2V8K A;  2E7Z A;  1KQS Y;  1ZB9 A;  3CCU Z;  3VTN A;  2JUB A;  3I4N I;  3IFU A;  3M3Y I;  3CCR 1;  1KD1 1;  2E2J I;  1TWG I;  5FLX b;  2V8J A;  2IZ4 A;  4A3B I;  2BJO A;  2YAD A;  3CCR Z;  1Q81 1;  2OOX B;  1I6H I;  2OTL 1;  3F3F C;  4XX2 A;  2R93 I;  5CM2 M;  3I07 A;  2NVQ I;  3GTM I;  2WB1 A;  3QWU A;  3CCM 1;  1QVG Y;  2F4M A;  3IX0 A;  2JIO A;  2JMO A;  3S1Q I;  4BBR I;  2EGT A;  4MD8 A;  2OTL Z;  5IT9 b;  3ESW A;  2O4H A;  4NBC A;  3GTG I;  1YI2 1;  5C4X I;  4RVD A;  4E2Y A;  3RZD I;  1FDO A;  3VB9 A;  1YI2 Z;  4NB8 A;  1VQP Z;  1VQ6 1;  3MZL B;  4MXU A;  3BG1 B;  5T64 A;  1VQ6 Z;  1NUI A;  3J81 f;  2QRE B;  3J80 f;  1K8A 1;  2PM9 A;  5A2Q b;  1YIT 1;  1VQ9 Z;  2RBL A;  4MON A;  2VPW A;  2ZAE B;  3CMA 1;  3J7A 4;  1YIT Z;  2JA5 I;  4E2X A;  1VQ7 1;  3FQQ A;  3MON A;  4A3I I;  1VQM 1;  1QVF Y;  3MZK B;  3G6E 1;  1Q86 2;  5D1O B;  4MD9 A;  4QTT A;  1VQ7 Z;  3FQM A;  2DE7 A;  5C3E I;  1W2B Y;  3G6E Z;  2OTJ 1;  3NDJ A;  1L1O C;  3I55 1;  1VQK 1;  3K7A I;  3CC4 1;  2HF1 A;  3GTJ I;  4BY1 I;  3I55 Z;  1TWF I;  1VQK Z;  3CC4 Z;  1QVF Z;  3M4O I;  1WCM I;  1P9N A;  4TNU A;  3RZO I;  1M1K 2;  1X0T A;  4NFR A;  1PFT A;  2H85 A;  3S17 I;  3VMI A;  2JR6 A;  3JAM b;  1Y1V S;  1TFI A;  2K5R A;  2Q51 A;  1YHQ 1;  1Q86 1;  1Q7Y 1;  2LEX A;  1VQL 1;  2O53 A;  3S14 I;  5LL6 f;  3FKI I;  1USP B;  3S1R I;  1YJN Z;  2NVT I;  2M6N A;  3CCE 1;  4NBE A;  3D2L A;  1RO2 A;  3CPW Z;  1K73 2;  3OW2 Y;  2QEX 1;  3CCV 1;  3I4M I;  4Y52 I;  1RQF A;  1TWC I;  2PMZ A;  1VQ4 1;  2V3V A;  2G2K A;  5D1O A;  1M1K 1;  1M90 2;  4BXX I;  2QEX Z;  3CCV Z;  2LFU A;  3CXC Y;  1VQ4 Z;  2VPZ A;  1N8R 2;  3CC7 1;  4E2Z A;  4E30 A;  4AYB A;  2R92 I;  2VUG A;  1KQS Z;  3BG0 B;  4NBA A;  1QF8 A;  4A3J I;  3HOY I;  4CL1 A;  4EWC A;  3LUS A;  4A3F I;  3EED A;  1YUA A;  2E9H A;  3CCM Z;  3P5J B;  2JNY A;  3IF8 A;  4E31 A;  1RLY A;  1M90 1;  1FDI A;  1VQ8 1;  3NFZ A;  4NBB A;  1USP A;  1Z02 A;  1YIJ 1;  1WZN A;  1QVG Z;  1VQN 1;  1N8R 1;  4A3K I;  2NAP A;  1VQ8 Z;  4DQY B;  3GTP I;  1RNI A;  3CCJ 1;  1YIJ Z;  3PO3 S;  1VQN Z;  2PK7 A;  1X3Z A;  3CME 1;  2R6M A;  2R7Z I;  3T4N B;  4A3E I;  1WW9 A;  3G71 1;  3G4S 1;  3GCF A;  4S1T A;  3CMA Z;  4NH1 C;  2JA7 I;  3H3V J;  1YJ9 1;  4A3L I;  2NVY I;  1S72 1;  3CC2 1;  1VQM Z;  5C44 I;  2P28 A;  4E33 A;  5FLX f;  3TE5 B;  2JS4 A;  1YJ9 Z;  4Y7N I;  3PO2 I;  1S72 Z;  4NB9 A;  3CC2 Z;  1VQ5 1;  2GTI A;  1Q82 2;  2OTJ Z;  4NBG A;  2OOY B;  1X3W A;  1VQ5 Z;  1I50 I;  2JIM A;  2W03 A;  3VMG A;  2E2H I;  1ZH1 A;  4NBF A;  1W2B Z;  5IT9 f;  4RVH A;  3GTM S;  4X6A I;  1SIW A;  3D6W A;  1Z01 A;  4RV9 A;  1DL6 A;  3NDI A;  4RVF A;  2QA4 1;  3F3P C;  3TDH B;  4E2W A;  2RHB A;  1YHQ Z;  2RIQ A;  2VF1 A;  1VQL Z;  3CD6 1;  1VLA A;  2JA8 I;  1Q82 1;  3CCQ 1;  3CCL 1;  2DE5 A;  3D9X A;  1Q81 2;  2VPX A;  2DE6 A;  3CCE Z;  4A3M I;  3J81 b;  3CCL Z;  3J80 b;  1JJ2 Y;  1YUK A;  3HOU I;  3HOV I;  4QTU A;  2W04 A;  3NH8 A;  4NBH A;  2Q4Z A;  3CCU 1;  4A3D I;  3S16 I;  1KRL A;  1Y1W I;  2GU2 A;  3OW2 Z;  1TWA I;  3CC7 Z;  2RPR A;  4RS4 A;  2KPI A;  1JJ2 Z;  4BBS I;  4MD7 A;  1WII A;  3CXC Z;  3S15 I;  3GKQ A;  1NJI 2;  3S2D I;  4RVG A;  1K73 1;  5T6B A;  2B63 I;  3Q87 A;  1VQO 1;  4MRI A;  1K8A 2;  3GTO I;  1Q16 A;  3VMH A;  1S7M A;  4HH4 A;  3NH4 A;  4NBD A;  1VQO Z;  2J6A A;  3JAM f;  1K9M 2;  3NH5 A;  2WAQ A;  1Y1V I;  1NP6 A;  3KIH A;  3I56 1;  4A3G I;  1VQP 1;  3CCS 1;  5T67 A;  3CCJ Z;  1N2F A;  3I56 Z;  2KI7 B;  4E32 A;  2AYD A;  3H0G I;  3CME Z;  3CCS Z;  1TWH I;  2OZK A;  4A3C I;  1JWH C;  2QKD A;  4DGL A;  1K83 I;  1NJI 1;  2K3R A;  2P3Y A;  2QR1 B;  5C4J I;  1KC8 2;  1QXF A;  1WJ2 A;  1VQ9 1;  1Y8C A;  3G71 Z;  3G4S Z;  3CQZ I;  4HGY A;  2QRD B;  5D1P A;  2M48 A;  4DK1 A;  3S1M I;  3S1N I;  5IP9 I;  1LQL A;  1K9M 1;  1AA6 A;  3HKZ A;  1SFO I;  4MH4 A;  1ML8 A;  3HOW I;  2IV2 X;  2NVX I;  2JA6 I;  1Z03 A;  2VPY A;  1Q7Y 2;  3EER A;  5AN9 F;  1YJW 1;  5IP7 I; 
#chains in the Genus database with same CATH homology
 4HGZ A;  2RT9 A;  2AKL A;  5FLM I;  3GTQ I;  1YJW Z;  1R9T I;  2IZ3 A;  1KC8 1;  2QRC B;  2GTH A;  2HU9 A;  2QLV B;  2Y0S A;  2VUM I;  4BY7 I;  2YU9 I;  1I3Q I;  1QYP A;  2V8I A;  2QA4 Z;  3GTK I;  1KD1 2;  3HOZ I;  2LIY A;  3GTL I;  1ZB8 A;  4NOZ A;  1RO0 A;  3CPW Y;  5A2Q f;  1RO4 A;  3U50 C;  2I3C A;  1YJN 1;  3PO3 I;  3CD6 Z;  4A93 I;  3KIF A;  3CCQ Z;  3S2H I;  2F4O A;  3HOX I;  2E2I I;  2V8K A;  1KQS Y;  1ZB9 A;  3CCU Z;  3VTN A;  2JUB A;  3I4N I;  3IFU A;  3M3Y I;  3CCR 1;  1KD1 1;  2E2J I;  1TWG I;  5FLX b;  2V8J A;  2IZ4 A;  4A3B I;  2BJO A;  2YAD A;  3CCR Z;  1Q81 1;  2OOX B;  1I6H I;  2OTL 1;  3F3F C;  4XX2 A;  2R93 I;  5CM2 M;  3I07 A;  2NVQ I;  3GTM I;  2WB1 A;  3QWU A;  3CCM 1;  1QVG Y;  2F4M A;  3IX0 A;  2JMO A;  3S1Q I;  4MD8 A;  2EGT A;  4BBR I;  2OTL Z;  5IT9 b;  3ESW A;  2O4H A;  4NBC A;  3GTG I;  1YI2 1;  5C4X I;  4RVD A;  4E2Y A;  3RZD I;  3VB9 A;  1YI2 Z;  4NB8 A;  1VQP Z;  1VQ6 1;  3MZL B;  4MXU A;  3BG1 B;  5T64 A;  1VQ6 Z;  1NUI A;  3J81 f;  2QRE B;  3J80 f;  1K8A 1;  2PM9 A;  5A2Q b;  1YIT 1;  1VQ9 Z;  2RBL A;  4MON A;  2ZAE B;  3CMA 1;  3J7A 4;  1YIT Z;  2JA5 I;  4E2X A;  1VQ7 1;  3FQQ A;  3MON A;  4A3I I;  1VQM 1;  1QVF Y;  3MZK B;  3G6E 1;  1Q86 2;  5D1O B;  4MD9 A;  4QTT A;  1VQ7 Z;  3FQM A;  2DE7 A;  5C3E I;  1W2B Y;  3G6E Z;  2OTJ 1;  3NDJ A;  1L1O C;  3I55 1;  1VQK 1;  3K7A I;  3CC4 1;  2HF1 A;  3GTJ I;  4BY1 I;  3I55 Z;  1TWF I;  1VQK Z;  3CC4 Z;  1QVF Z;  3M4O I;  1WCM I;  1P9N A;  4TNU A;  3RZO I;  1M1K 2;  1X0T A;  4NFR A;  1PFT A;  2H85 A;  3S17 I;  3VMI A;  2JR6 A;  3JAM b;  1Y1V S;  1TFI A;  2K5R A;  2Q51 A;  1YHQ 1;  1Q86 1;  1Q7Y 1;  1VQL 1;  2O53 A;  3S14 I;  5LL6 f;  3FKI I;  1USP B;  3S1R I;  1YJN Z;  2NVT I;  2M6N A;  3CCE 1;  4NBE A;  1RO2 A;  3CPW Z;  1K73 2;  3OW2 Y;  2QEX 1;  3CCV 1;  3I4M I;  4Y52 I;  1RQF A;  1TWC I;  2PMZ A;  1VQ4 1;  2G2K A;  5D1O A;  1M1K 1;  1M90 2;  4BXX I;  2QEX Z;  3CCV Z;  2LFU A;  3CXC Y;  1VQ4 Z;  1N8R 2;  3CC7 1;  4E2Z A;  4E30 A;  4AYB A;  2R92 I;  2VUG A;  1KQS Z;  3BG0 B;  4NBA A;  1QF8 A;  4A3J I;  3HOY I;  4CL1 A;  4EWC A;  3LUS A;  4A3F I;  3EED A;  1YUA A;  2E9H A;  3CCM Z;  3P5J B;  2JNY A;  3IF8 A;  4E31 A;  1RLY A;  1M90 1;  1VQ8 1;  3NFZ A;  4NBB A;  1USP A;  1Z02 A;  1YIJ 1;  1QVG Z;  1VQN 1;  1N8R 1;  4A3K I;  1VQ8 Z;  4DQY B;  3GTP I;  1RNI A;  3CCJ 1;  1YIJ Z;  3PO3 S;  1VQN Z;  2PK7 A;  1X3Z A;  3CME 1;  2R6M A;  2R7Z I;  3T4N B;  4A3E I;  1WW9 A;  3G71 1;  3G4S 1;  3GCF A;  4S1T A;  3CMA Z;  4NH1 C;  2JA7 I;  3H3V J;  1YJ9 1;  4A3L I;  2NVY I;  1S72 1;  3CC2 1;  1VQM Z;  5C44 I;  2P28 A;  4E33 A;  5FLX f;  3TE5 B;  2JS4 A;  1YJ9 Z;  4Y7N I;  3PO2 I;  1S72 Z;  4NB9 A;  3CC2 Z;  1VQ5 1;  2GTI A;  1Q82 2;  2OTJ Z;  4NBG A;  2OOY B;  1X3W A;  1VQ5 Z;  1I50 I;  2W03 A;  3VMG A;  2E2H I;  1ZH1 A;  4NBF A;  1W2B Z;  5IT9 f;  4RVH A;  3GTM S;  4X6A I;  3D6W A;  1Z01 A;  4RV9 A;  1DL6 A;  3NDI A;  4RVF A;  2QA4 1;  3F3P C;  3TDH B;  4E2W A;  2RHB A;  1YHQ Z;  2RIQ A;  2VF1 A;  1VQL Z;  3CD6 1;  1VLA A;  2JA8 I;  1Q82 1;  3CCQ 1;  3CCL 1;  2DE5 A;  3D9X A;  1Q81 2;  2DE6 A;  3CCE Z;  4A3M I;  3J81 b;  3CCL Z;  3J80 b;  1JJ2 Y;  1YUK A;  3HOU I;  3HOV I;  4QTU A;  2W04 A;  3NH8 A;  4NBH A;  2Q4Z A;  3CCU 1;  4A3D I;  3S16 I;  1KRL A;  1Y1W I;  2GU2 A;  3OW2 Z;  1TWA I;  3CC7 Z;  2RPR A;  4RS4 A;  2KPI A;  1JJ2 Z;  4BBS I;  4MD7 A;  1WII A;  3CXC Z;  3S15 I;  3GKQ A;  1NJI 2;  3S2D I;  4RVG A;  1K73 1;  5T6B A;  2B63 I;  3Q87 A;  1VQO 1;  4MRI A;  1K8A 2;  3GTO I;  3VMH A;  1S7M A;  4HH4 A;  3NH4 A;  4NBD A;  1VQO Z;  2J6A A;  3JAM f;  1K9M 2;  3NH5 A;  2WAQ A;  1Y1V I;  1NP6 A;  3KIH A;  3I56 1;  4A3G I;  1VQP 1;  3CCS 1;  5T67 A;  3CCJ Z;  1N2F A;  3I56 Z;  2KI7 B;  4E32 A;  3H0G I;  3CME Z;  3CCS Z;  1TWH I;  2OZK A;  4A3C I;  1JWH C;  2QKD A;  4DGL A;  1K83 I;  1NJI 1;  2K3R A;  2P3Y A;  2QR1 B;  5C4J I;  1KC8 2;  1VQ9 1;  3G71 Z;  3G4S Z;  3CQZ I;  4HGY A;  2QRD B;  5D1P A;  2M48 A;  4DK1 A;  3S1M I;  3S1N I;  5IP9 I;  1LQL A;  1K9M 1;  3HKZ A;  1SFO I;  4MH4 A;  1ML8 A;  3HOW I;  2NVX I;  2JA6 I;  1Z03 A;  1Q7Y 2;  3EER A;  5AN9 F;  1YJW 1;  5IP7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...