3S2DI

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI02
4XX2A 4A3JI 1VLAA 1WW9A 1DL6A 4A3DI 1ZB9A 3VMHA 4A3MI 4Y7NI 3GTGI 2JA7I 2NVQI 1Y1VI 4A3CI 1R9TI 3H0GI 4NBEA 3H3VJ 2DE6A 3D6WA 1Y1WI 2K5RA 1I6HI 4Y52I 1X3ZA 3HOYI 2NVXI 2RBLA 3M3YI 5IP9I 3GTOI 3S1MI 2J6AA 5C4XI 4NBAA 3RZOI 4A93I 1TWAI 3HOVI 1I3QI 3GTQI 3VMIA 4A3BI 3S2HI 2BJOA 2PK7A 1X3WA 5C44I 4NBDA 2F4MA 4NB9A 4NBGA 1RLYA 3I4NI 2F4OA 4BBSI 3GTKI 1YUAA 1WCMI 4A3KI 2NVYI 5C4JI 3VMGA 3S16I 2VUMI 3S1QI 1PFTA 1I50I 4MH4A 4BY7I 2NVTI 4BBRI 3GKQA 3HOXI 1N2FA 3VB9A 3S1RI 4X6AI 3K7AI 2R93I 2YU9I 3GTMS 2R92I 4QTUA 1K83I 4BXXI 5CM2M 1ZB8A 4NBHA 4BY1I 1TWHI 2JNYA 3GTLI 3I07A 4QTTA 3FKII 3GTMI 4A3EI 1QYPA 4NBBA 4A3FI 1USPA 3S17I 3HOWI 2E2HI 3ESWA 4A3II 2JA6I 1TWFI 2B63I 3GTPI 4A3GI 3LUSA 3HOZI 2P3YA 1ML8A 2DE5A 2JR6A 3S1NI 2R7ZI 5FLMI 1SFOI 3GTJI 3S15I 1TWCI 3PO3S 2KPIA 2DE7A 3Q87A 4A3LI 1TWGI 5C3EI 2JA5I 3U50C 3S2DI 2HF1A 3CQZI 3EERA 5IP7I 2E2JI 2E2II 3S14I 4NBCA 3PO3I 1TFIA 1NUIA 1RO4A 1L1OC 2JA8I 1LQLA 1USPB 3RZDI 3HOUI 3M4OI 3GCFA 2AKLA 4NBFA 1Y1VS 2JS4A 4NOZA 3I4MI 3PO2I 4NB8A
chains in the Genus database with same CATH superfamily
4XX2A 1VLAA 3CCRZ 1W2BY 4A3MI 3I561 1YIJZ 4Y7NI 2JA7I 2NVQI 4TNUA 3MONA 4A3CI 1R9TI 1YITZ 1M901 4NBEA 5IT9b 5T64A 3IR7A 2E7ZA 1K9M2 2K5RA 1X3ZA 3I56Z 3HOYI 4HH4A 5IP9I 3GTOI 4MD7A 2J6AA 2VPXA 1K732 5C4XI 4NBAA 1TWAI 1JWHC 3CCVZ 1YI21 3BG1B 2I3CA 2BJOA 4MXUA 3CMEZ 2JIOA 3KIHA 2JMOA 2OOYB 2F4OA 4BBSI 3F3PC 1YUAA 2JIPA 3CMA1 4E2XA 2NVYI 2ZAEB 3I551 2R6MA 3S16I 3CCJ1 2VF1A 3J81b 1YHQ1 4E33A 1VQLZ 5IT9f 1S7MA 4BY7I 1M1K1 2M6NA 1S721 3HOXI 5FLXb 3CMAZ 2VPWA 3I55Z 3P5JB 3CCJZ 1Q7Y2 1QXFA 3CPWZ 4HGZA 3CCE1 1QF8A 1FDIA 2YU9I 1Q16A 4QTUA 2V8IA 2GU2A 4BY1I 1TWHI 2JNYA 1Z03A 3FKII 3CCEZ 1SIWA 4NBBA 1VQNZ 1Z02A 3HOWI 1JJ2Y 3J7A4 4A3II 3VTNA 2B63I 5D1OB 2QLVB 4A3GI 2P3YA 2JR6A 4RS4A 2R7ZI 5FLMI 2K3RA 5FLXf 3GTJI 1TWCI 3PO3S 2KPIA 3J80f 5T67A 1WIIA 2GTIA 2JA5I 3S2DI 2HF1A 1VQ5Z 3EERA 4AYBA 5IP7I 1VQ9Z 2E2JI 1TFIA 2WAQA 3CXCY 1RO4A 1L1OC 1K731 3RZDI 1RQFA 2Q51A 3I4MI 3PO2I 4NB8A 1Y8CA 1WJ2A 3IF8A 4DK1A 2V8KA 1W2BZ 3GTGI 1Y1VI 1VQ61 3H0GI 3D6WA 3QWUA 3CC21 2WB1A 1VQ8Z 2JUBA 1NJI1 4Y52I 2NVXI 2RBLA 3CCR1 3OW2Z 2V45A 3G4SZ 3IFUA 3HOVI 3CC2Z 1Q7Y1 3FQQA 2PK7A 4NBDA 4NB9A 1N8R2 3D2LA 1RLYA 3CCU1 3CC41 1QVGY 3GTKI 1WCMI 5C4JI 3CCV1 1I50I 2QEX1 1KC82 1Z01A 3CCUZ 3CME1 3CC4Z 2NVTI 1AA6A 3CC71 4E2WA 2QEXZ 2R93I 2PM9A 3GTMS 2R92I 1VQL1 2W04A 1YJNZ 4BXXI 1KD12 1ZB8A 3FQMA 3I07A 3CC7Z 4NFRA 3BG0B 3NH5A 1NP6A 1KRLA 1QYPA 4A3FI 2P28A 4NH1C 2PMZA 2E2HI 2JIMA 1TWFI 3GTPI 3LUSA 3HOZI 2DE5A 4MD9A 1WZNA 1VQ7Z 3S15I 2DE7A 1VQN1 2QRDB 3EEDA 3F3FC 3G6EZ 5C3EI 3U50C 5T6BA 3S14I 2E2II 4NBCA 3PO3I 2E9HA 1NUIA 4E2YA 1LQLA 1USPB 3CXCZ 3M4OI 5D1PA 3J81f 2RT9A 1DL6A 1ZB9A 4DQYB 1VQ51 1YUKA 1VQ91 2LEXA 1N8R1 4E30A 1Q862 3H3VJ 2DE6A 1Y1WI 1RO0A 3JAMb 5LL6f 1I6HI 4RVDA 1K9M1 3M3YI 1KC81 2GTHA 4A93I 3CPWY 1VQKZ 1QVFY 4RVGA 3GTQI 3VMIA 1X0TA 1KQSZ 1RO2A 4RVFA 1X3WA 5C44I 1VQ81 1VQP1 3NDJA 4NBGA 1K8A2 3NH8A 3I4NI 4RVHA 3CD61 3G4S1 2LIYA 1QVGZ 3VMGA 2G2KA 3CCS1 2IZ3A 2IV2X 3S1QI 4MH4A 1VQPZ 2VPZA 2KI7B 1YJ9Z 3CD6Z 4E32A 3CCLZ 3CCSZ 2Q4ZA 3VB9A 4E2ZA 3S1RI 4X6AI 2OTLZ 3KIFA 2V3VA 2Y0SA 5CM2M 3GTLI 1Q822 4QTTA 2EGTA 2QRCB 3GTMI 4A3EI 1VQO1 1USPA 2JIRA 3ESWA 5D1OA 2VUGA 1YJN1 2JA6I 2OOXB 3CCQZ 1P9NA 3S1NI 1SFOI 1VQOZ 3IX0A 4A3LI 1TWGI 4E31A 1Q861 3OW2Y 1ZH1A 3MZLB 3CQZI 1FDOA 4DGLA 2RHBA 3NDIA 2OZKA 1VQ71 2JA8I 2JS4A 3G6E1 2JIQA 1JJ2Z 4A3JI 1WW9A 4A3DI 3VMHA 1K8A1 2YADA 1Q812 2V8JA 1YI2Z 2AYDA 1VQ41 1NJI2 2QKDA 4RV9A 3NH4A 3G711 3S1MI 1VQ4Z 3J80b 1I3QI 2QR1B 1YHQZ 4A3BI 4EWCA 3S2HI 1QVFZ 2OTJ1 2F4MA 2W03A 3G71Z 3TE5B 1S72Z 1VQM1 1M902 4A3KI 1Q821 5A2Qb 2QA41 2OTJZ 1VQK1 2VUMI 1PFTA 2O53A 4MD8A 1VQMZ 4BBRI 3GKQA 1N2FA 2QA4Z 2O4HA 2H85A 3K7AI 4MONA 2IZ4A 4CL1A 3CCM1 1K83I 3TDHB 1YJ91 4NBHA 2QREB 1KD11 4S1TA 3T4NB 3HKZA 3CCL1 3NFZA 2RIQA 3CCMZ 3S17I 2OTL1 3D9XA 5A2Qf 1M1K2 5AN9F 3JAMf 4HGYA 3MZKB 1ML8A 2HU9A 3Q87A 1Q811 1YJW1 2VPYA 1RNIA 2NAPA 4MRIA 3CCQ1 2M48A 1VQ6Z 1YIJ1 1YJWZ 2RPRA 1KQSY 3HOUI 3GCFA 2AKLA 4NBFA 1Y1VS 4NOZA 1YIT1 2LFUA 3RZOI
chains in the Genus database with same CATH topology
4XX2A 1VLAA 3CCRZ 1W2BY 4A3MI 3I561 1YIJZ 4Y7NI 2JA7I 2NVQI 4TNUA 3MONA 4A3CI 1R9TI 1YITZ 1M901 4NBEA 5IT9b 5T64A 1K9M2 2K5RA 1X3ZA 3I56Z 3HOYI 4HH4A 5IP9I 3GTOI 4MD7A 2J6AA 1K732 5C4XI 4NBAA 1TWAI 1JWHC 3CCVZ 1YI21 3BG1B 2I3CA 2BJOA 4MXUA 3CMEZ 3KIHA 2JMOA 2OOYB 2F4OA 4BBSI 3F3PC 1YUAA 3CMA1 4E2XA 2NVYI 2ZAEB 3I551 2R6MA 3S16I 3CCJ1 2VF1A 3J81b 1YHQ1 4E33A 1VQLZ 5IT9f 1S7MA 4BY7I 1M1K1 2M6NA 1S721 3HOXI 5FLXb 3CMAZ 3I55Z 3P5JB 3CCJZ 1Q7Y2 3CPWZ 4HGZA 3CCE1 1QF8A 2YU9I 4QTUA 2V8IA 2GU2A 4BY1I 1TWHI 2JNYA 1Z03A 3FKII 3CCEZ 4NBBA 1VQNZ 1Z02A 3HOWI 1JJ2Y 3J7A4 4A3II 3VTNA 2B63I 5D1OB 2QLVB 4A3GI 2P3YA 2JR6A 4RS4A 2R7ZI 5FLMI 2K3RA 5FLXf 3GTJI 1TWCI 3PO3S 2KPIA 3J80f 5T67A 1WIIA 2GTIA 2JA5I 3S2DI 2HF1A 1VQ5Z 3EERA 4AYBA 5IP7I 1VQ9Z 2E2JI 1TFIA 2WAQA 3CXCY 1RO4A 1L1OC 1K731 3RZDI 1RQFA 2Q51A 3I4MI 3PO2I 4NB8A 3IF8A 4DK1A 2V8KA 1W2BZ 3GTGI 1Y1VI 1VQ61 3H0GI 3D6WA 3QWUA 3CC21 2WB1A 1VQ8Z 2JUBA 1NJI1 4Y52I 2NVXI 2RBLA 3CCR1 3OW2Z 3G4SZ 3IFUA 3HOVI 3CC2Z 1Q7Y1 3FQQA 2PK7A 4NBDA 4NB9A 1N8R2 1RLYA 3CCU1 3CC41 1QVGY 3GTKI 1WCMI 5C4JI 3CCV1 1I50I 2QEX1 1KC82 1Z01A 3CCUZ 3CME1 3CC4Z 2NVTI 3CC71 4E2WA 2QEXZ 2R93I 2PM9A 3GTMS 2R92I 1VQL1 2W04A 1YJNZ 4BXXI 1KD12 1ZB8A 3FQMA 3I07A 3CC7Z 4NFRA 3BG0B 3NH5A 1NP6A 1KRLA 1QYPA 4A3FI 2P28A 4NH1C 2PMZA 2E2HI 1TWFI 3GTPI 3LUSA 3HOZI 2DE5A 4MD9A 1VQ7Z 3S15I 2DE7A 1VQN1 2QRDB 3EEDA 3F3FC 3G6EZ 5C3EI 3U50C 5T6BA 3S14I 2E2II 4NBCA 3PO3I 2E9HA 1NUIA 4E2YA 1LQLA 1USPB 3CXCZ 3M4OI 5D1PA 3J81f 2RT9A 1DL6A 1ZB9A 4DQYB 1VQ51 1YUKA 1VQ91 1N8R1 4E30A 1Q862 3H3VJ 2DE6A 1Y1WI 1RO0A 3JAMb 5LL6f 1I6HI 4RVDA 1K9M1 3M3YI 1KC81 2GTHA 4A93I 3CPWY 1VQKZ 1QVFY 4RVGA 3GTQI 3VMIA 1X0TA 1KQSZ 1RO2A 4RVFA 1X3WA 5C44I 1VQ81 1VQP1 3NDJA 4NBGA 1K8A2 3NH8A 3I4NI 4RVHA 3CD61 3G4S1 2LIYA 1QVGZ 3VMGA 2G2KA 3CCS1 2IZ3A 3S1QI 4MH4A 1VQPZ 2KI7B 1YJ9Z 3CD6Z 4E32A 3CCLZ 3CCSZ 2Q4ZA 3VB9A 4E2ZA 3S1RI 4X6AI 2OTLZ 3KIFA 2Y0SA 5CM2M 3GTLI 1Q822 4QTTA 2EGTA 2QRCB 3GTMI 4A3EI 1VQO1 1USPA 3ESWA 5D1OA 2VUGA 1YJN1 2JA6I 2OOXB 3CCQZ 1P9NA 3S1NI 1SFOI 1VQOZ 3IX0A 4A3LI 1TWGI 4E31A 1Q861 3OW2Y 1ZH1A 3MZLB 3CQZI 4DGLA 2RHBA 3NDIA 2OZKA 1VQ71 2JA8I 2JS4A 3G6E1 1JJ2Z 4A3JI 1WW9A 4A3DI 3VMHA 1K8A1 2YADA 1Q812 2V8JA 1YI2Z 1VQ41 1NJI2 2QKDA 4RV9A 3NH4A 3G711 3S1MI 1VQ4Z 3J80b 1I3QI 2QR1B 1YHQZ 4A3BI 4EWCA 3S2HI 1QVFZ 2OTJ1 2F4MA 2W03A 3G71Z 3TE5B 1S72Z 1VQM1 1M902 4A3KI 1Q821 5A2Qb 2QA41 2OTJZ 1VQK1 2VUMI 1PFTA 2O53A 4MD8A 1VQMZ 4BBRI 3GKQA 1N2FA 2QA4Z 2O4HA 2H85A 3K7AI 4MONA 2IZ4A 4CL1A 3CCM1 1K83I 3TDHB 1YJ91 4NBHA 2QREB 1KD11 4S1TA 3T4NB 3HKZA 3CCL1 3NFZA 2RIQA 3CCMZ 3S17I 2OTL1 3D9XA 5A2Qf 1M1K2 5AN9F 3JAMf 4HGYA 3MZKB 1ML8A 2HU9A 3Q87A 1Q811 1YJW1 1RNIA 4MRIA 3CCQ1 2M48A 1VQ6Z 1YIJ1 1YJWZ 2RPRA 1KQSY 3HOUI 3GCFA 2AKLA 4NBFA 1Y1VS 4NOZA 1YIT1 2LFUA 3RZOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XX2 A;  4A3J I;  1VLA A;  1WW9 A;  1DL6 A;  4A3D I;  1ZB9 A;  3VMH A;  4A3M I;  4Y7N I;  3GTG I;  2JA7 I;  2NVQ I;  1Y1V I;  4A3C I;  1R9T I;  3H0G I;  4NBE A;  3H3V J;  2DE6 A;  3D6W A;  1Y1W I;  2K5R A;  1I6H I;  4Y52 I;  1X3Z A;  3HOY I;  2NVX I;  2RBL A;  3M3Y I;  5IP9 I;  3GTO I;  3S1M I;  2J6A A;  5C4X I;  4NBA A;  3RZO I;  4A93 I;  1TWA I;  3HOV I;  1I3Q I;  3GTQ I;  3VMI A;  4A3B I;  3S2H I;  2BJO A;  2PK7 A;  1X3W A;  5C44 I;  4NBD A;  2F4M A;  4NB9 A;  4NBG A;  1RLY A;  3I4N I;  2F4O A;  4BBS I;  3GTK I;  1YUA A;  1WCM I;  4A3K I;  2NVY I;  5C4J I;  3VMG A;  3S16 I;  2VUM I;  3S1Q I;  1PFT A;  1I50 I;  4MH4 A;  4BY7 I;  2NVT I;  4BBR I;  3GKQ A;  3HOX I;  1N2F A;  3VB9 A;  3S1R I;  4X6A I;  3K7A I;  2R93 I;  2YU9 I;  3GTM S;  2R92 I;  4QTU A;  1K83 I;  4BXX I;  5CM2 M;  1ZB8 A;  4NBH A;  4BY1 I;  1TWH I;  2JNY A;  3GTL I;  3I07 A;  4QTT A;  3FKI I;  3GTM I;  4A3E I;  1QYP A;  4NBB A;  4A3F I;  1USP A;  3S17 I;  3HOW I;  2E2H I;  3ESW A;  4A3I I;  2JA6 I;  1TWF I;  2B63 I;  3GTP I;  4A3G I;  3LUS A;  3HOZ I;  2P3Y A;  1ML8 A;  2DE5 A;  2JR6 A;  3S1N I;  2R7Z I;  5FLM I;  1SFO I;  3GTJ I;  3S15 I;  1TWC I;  3PO3 S;  2KPI A;  2DE7 A;  3Q87 A;  4A3L I;  1TWG I;  5C3E I;  2JA5 I;  3U50 C;  3S2D I;  2HF1 A;  3CQZ I;  3EER A;  5IP7 I;  2E2J I;  2E2I I;  3S14 I;  4NBC A;  3PO3 I;  1TFI A;  1NUI A;  1RO4 A;  1L1O C;  2JA8 I;  1LQL A;  1USP B;  3RZD I;  3HOU I;  3M4O I;  3GCF A;  2AKL A;  4NBF A;  1Y1V S;  2JS4 A;  4NOZ A;  3I4M I;  3PO2 I;  4NB8 A; 
#chains in the Genus database with same CATH topology
 4XX2 A;  1VLA A;  3CCR Z;  1W2B Y;  4A3M I;  3I56 1;  1YIJ Z;  4Y7N I;  2JA7 I;  2NVQ I;  4TNU A;  3MON A;  4A3C I;  1R9T I;  1YIT Z;  1M90 1;  4NBE A;  5IT9 b;  5T64 A;  3IR7 A;  2E7Z A;  1K9M 2;  2K5R A;  1X3Z A;  3I56 Z;  3HOY I;  4HH4 A;  5IP9 I;  3GTO I;  4MD7 A;  2J6A A;  2VPX A;  1K73 2;  5C4X I;  4NBA A;  1TWA I;  1JWH C;  3CCV Z;  1YI2 1;  3BG1 B;  2I3C A;  2BJO A;  4MXU A;  3CME Z;  2JIO A;  3KIH A;  2JMO A;  2OOY B;  2F4O A;  4BBS I;  3F3P C;  1YUA A;  2JIP A;  3CMA 1;  4E2X A;  2NVY I;  2ZAE B;  3I55 1;  2R6M A;  3S16 I;  3CCJ 1;  2VF1 A;  3J81 b;  1YHQ 1;  4E33 A;  1VQL Z;  5IT9 f;  1S7M A;  4BY7 I;  1M1K 1;  2M6N A;  1S72 1;  3HOX I;  5FLX b;  3CMA Z;  2VPW A;  3I55 Z;  3P5J B;  3CCJ Z;  1Q7Y 2;  1QXF A;  3CPW Z;  4HGZ A;  3CCE 1;  1QF8 A;  1FDI A;  2YU9 I;  1Q16 A;  4QTU A;  2V8I A;  2GU2 A;  4BY1 I;  1TWH I;  2JNY A;  1Z03 A;  3FKI I;  3CCE Z;  1SIW A;  4NBB A;  1VQN Z;  1Z02 A;  3HOW I;  1JJ2 Y;  3J7A 4;  4A3I I;  3VTN A;  2B63 I;  5D1O B;  2QLV B;  4A3G I;  2P3Y A;  2JR6 A;  4RS4 A;  2R7Z I;  5FLM I;  2K3R A;  5FLX f;  3GTJ I;  1TWC I;  3PO3 S;  2KPI A;  3J80 f;  5T67 A;  1WII A;  2GTI A;  2JA5 I;  3S2D I;  2HF1 A;  1VQ5 Z;  3EER A;  4AYB A;  5IP7 I;  1VQ9 Z;  2E2J I;  1TFI A;  2WAQ A;  3CXC Y;  1RO4 A;  1L1O C;  1K73 1;  3RZD I;  1RQF A;  2Q51 A;  3I4M I;  3PO2 I;  4NB8 A;  1Y8C A;  1WJ2 A;  3IF8 A;  4DK1 A;  2V8K A;  1W2B Z;  3GTG I;  1Y1V I;  1VQ6 1;  3H0G I;  3D6W A;  3QWU A;  3CC2 1;  2WB1 A;  1VQ8 Z;  2JUB A;  1NJI 1;  4Y52 I;  2NVX I;  2RBL A;  3CCR 1;  3OW2 Z;  2V45 A;  3G4S Z;  3IFU A;  3HOV I;  3CC2 Z;  1Q7Y 1;  3FQQ A;  2PK7 A;  4NBD A;  4NB9 A;  1N8R 2;  3D2L A;  1RLY A;  3CCU 1;  3CC4 1;  1QVG Y;  3GTK I;  1WCM I;  5C4J I;  3CCV 1;  1I50 I;  2QEX 1;  1KC8 2;  1Z01 A;  3CCU Z;  3CME 1;  3CC4 Z;  2NVT I;  1AA6 A;  3CC7 1;  4E2W A;  2QEX Z;  2R93 I;  2PM9 A;  3GTM S;  2R92 I;  1VQL 1;  2W04 A;  1YJN Z;  4BXX I;  1KD1 2;  1ZB8 A;  3FQM A;  3I07 A;  3CC7 Z;  4NFR A;  3BG0 B;  3NH5 A;  1NP6 A;  1KRL A;  1QYP A;  4A3F I;  2P28 A;  4NH1 C;  2PMZ A;  2E2H I;  2JIM A;  1TWF I;  3GTP I;  3LUS A;  3HOZ I;  2DE5 A;  4MD9 A;  1WZN A;  1VQ7 Z;  3S15 I;  2DE7 A;  1VQN 1;  2QRD B;  3EED A;  3F3F C;  3G6E Z;  5C3E I;  3U50 C;  5T6B A;  3S14 I;  2E2I I;  4NBC A;  3PO3 I;  2E9H A;  1NUI A;  4E2Y A;  1LQL A;  1USP B;  3CXC Z;  3M4O I;  5D1P A;  3J81 f;  2RT9 A;  1DL6 A;  1ZB9 A;  4DQY B;  1VQ5 1;  1YUK A;  1VQ9 1;  2LEX A;  1N8R 1;  4E30 A;  1Q86 2;  3H3V J;  2DE6 A;  1Y1W I;  1RO0 A;  3JAM b;  5LL6 f;  1I6H I;  4RVD A;  1K9M 1;  3M3Y I;  1KC8 1;  2GTH A;  4A93 I;  3CPW Y;  1VQK Z;  1QVF Y;  4RVG A;  3GTQ I;  3VMI A;  1X0T A;  1KQS Z;  1RO2 A;  4RVF A;  1X3W A;  5C44 I;  1VQ8 1;  1VQP 1;  3NDJ A;  4NBG A;  1K8A 2;  3NH8 A;  3I4N I;  4RVH A;  3CD6 1;  3G4S 1;  2LIY A;  1QVG Z;  3VMG A;  2G2K A;  3CCS 1;  2IZ3 A;  2IV2 X;  3S1Q I;  4MH4 A;  1VQP Z;  2VPZ A;  2KI7 B;  1YJ9 Z;  3CD6 Z;  4E32 A;  3CCL Z;  3CCS Z;  2Q4Z A;  3VB9 A;  4E2Z A;  3S1R I;  4X6A I;  2OTL Z;  3KIF A;  2V3V A;  2Y0S A;  5CM2 M;  3GTL I;  1Q82 2;  4QTT A;  2EGT A;  2QRC B;  3GTM I;  4A3E I;  1VQO 1;  1USP A;  2JIR A;  3ESW A;  5D1O A;  2VUG A;  1YJN 1;  2JA6 I;  2OOX B;  3CCQ Z;  1P9N A;  3S1N I;  1SFO I;  1VQO Z;  3IX0 A;  4A3L I;  1TWG I;  4E31 A;  1Q86 1;  3OW2 Y;  1ZH1 A;  3MZL B;  3CQZ I;  1FDO A;  4DGL A;  2RHB A;  3NDI A;  2OZK A;  1VQ7 1;  2JA8 I;  2JS4 A;  3G6E 1;  2JIQ A;  1JJ2 Z;  4A3J I;  1WW9 A;  4A3D I;  3VMH A;  1K8A 1;  2YAD A;  1Q81 2;  2V8J A;  1YI2 Z;  2AYD A;  1VQ4 1;  1NJI 2;  2QKD A;  4RV9 A;  3NH4 A;  3G71 1;  3S1M I;  1VQ4 Z;  3J80 b;  1I3Q I;  2QR1 B;  1YHQ Z;  4A3B I;  4EWC A;  3S2H I;  1QVF Z;  2OTJ 1;  2F4M A;  2W03 A;  3G71 Z;  3TE5 B;  1S72 Z;  1VQM 1;  1M90 2;  4A3K I;  1Q82 1;  5A2Q b;  2QA4 1;  2OTJ Z;  1VQK 1;  2VUM I;  1PFT A;  2O53 A;  4MD8 A;  1VQM Z;  4BBR I;  3GKQ A;  1N2F A;  2QA4 Z;  2O4H A;  2H85 A;  3K7A I;  4MON A;  2IZ4 A;  4CL1 A;  3CCM 1;  1K83 I;  3TDH B;  1YJ9 1;  4NBH A;  2QRE B;  1KD1 1;  4S1T A;  3T4N B;  3HKZ A;  3CCL 1;  3NFZ A;  2RIQ A;  3CCM Z;  3S17 I;  2OTL 1;  3D9X A;  5A2Q f;  1M1K 2;  5AN9 F;  3JAM f;  4HGY A;  3MZK B;  1ML8 A;  2HU9 A;  3Q87 A;  1Q81 1;  1YJW 1;  2VPY A;  1RNI A;  2NAP A;  4MRI A;  3CCQ 1;  2M48 A;  1VQ6 Z;  1YIJ 1;  1YJW Z;  2RPR A;  1KQS Y;  3HOU I;  3GCF A;  2AKL A;  4NBF A;  1Y1V S;  4NOZ A;  1YIT 1;  2LFU A;  3RZO I; 
#chains in the Genus database with same CATH homology
 4XX2 A;  1VLA A;  3CCR Z;  1W2B Y;  4A3M I;  3I56 1;  1YIJ Z;  4Y7N I;  2JA7 I;  2NVQ I;  4TNU A;  3MON A;  4A3C I;  1R9T I;  1YIT Z;  1M90 1;  4NBE A;  5IT9 b;  5T64 A;  1K9M 2;  2K5R A;  1X3Z A;  3I56 Z;  3HOY I;  4HH4 A;  5IP9 I;  3GTO I;  4MD7 A;  2J6A A;  1K73 2;  5C4X I;  4NBA A;  1TWA I;  1JWH C;  3CCV Z;  1YI2 1;  3BG1 B;  2I3C A;  2BJO A;  4MXU A;  3CME Z;  3KIH A;  2JMO A;  2OOY B;  2F4O A;  4BBS I;  3F3P C;  1YUA A;  3CMA 1;  4E2X A;  2NVY I;  2ZAE B;  3I55 1;  2R6M A;  3S16 I;  3CCJ 1;  2VF1 A;  3J81 b;  1YHQ 1;  4E33 A;  1VQL Z;  5IT9 f;  1S7M A;  4BY7 I;  1M1K 1;  2M6N A;  1S72 1;  3HOX I;  5FLX b;  3CMA Z;  3I55 Z;  3P5J B;  3CCJ Z;  1Q7Y 2;  3CPW Z;  4HGZ A;  3CCE 1;  1QF8 A;  2YU9 I;  4QTU A;  2V8I A;  2GU2 A;  4BY1 I;  1TWH I;  2JNY A;  1Z03 A;  3FKI I;  3CCE Z;  4NBB A;  1VQN Z;  1Z02 A;  3HOW I;  1JJ2 Y;  3J7A 4;  4A3I I;  3VTN A;  2B63 I;  5D1O B;  2QLV B;  4A3G I;  2P3Y A;  2JR6 A;  4RS4 A;  2R7Z I;  5FLM I;  2K3R A;  5FLX f;  3GTJ I;  1TWC I;  3PO3 S;  2KPI A;  3J80 f;  5T67 A;  1WII A;  2GTI A;  2JA5 I;  3S2D I;  2HF1 A;  1VQ5 Z;  3EER A;  4AYB A;  5IP7 I;  1VQ9 Z;  2E2J I;  1TFI A;  2WAQ A;  3CXC Y;  1RO4 A;  1L1O C;  1K73 1;  3RZD I;  1RQF A;  2Q51 A;  3I4M I;  3PO2 I;  4NB8 A;  3IF8 A;  4DK1 A;  2V8K A;  1W2B Z;  3GTG I;  1Y1V I;  1VQ6 1;  3H0G I;  3D6W A;  3QWU A;  3CC2 1;  2WB1 A;  1VQ8 Z;  2JUB A;  1NJI 1;  4Y52 I;  2NVX I;  2RBL A;  3CCR 1;  3OW2 Z;  3G4S Z;  3IFU A;  3HOV I;  3CC2 Z;  1Q7Y 1;  3FQQ A;  2PK7 A;  4NBD A;  4NB9 A;  1N8R 2;  1RLY A;  3CCU 1;  3CC4 1;  1QVG Y;  3GTK I;  1WCM I;  5C4J I;  3CCV 1;  1I50 I;  2QEX 1;  1KC8 2;  1Z01 A;  3CCU Z;  3CME 1;  3CC4 Z;  2NVT I;  3CC7 1;  4E2W A;  2QEX Z;  2R93 I;  2PM9 A;  3GTM S;  2R92 I;  1VQL 1;  2W04 A;  1YJN Z;  4BXX I;  1KD1 2;  1ZB8 A;  3FQM A;  3I07 A;  3CC7 Z;  4NFR A;  3BG0 B;  3NH5 A;  1NP6 A;  1KRL A;  1QYP A;  4A3F I;  2P28 A;  4NH1 C;  2PMZ A;  2E2H I;  1TWF I;  3GTP I;  3LUS A;  3HOZ I;  2DE5 A;  4MD9 A;  1VQ7 Z;  3S15 I;  2DE7 A;  1VQN 1;  2QRD B;  3EED A;  3F3F C;  3G6E Z;  5C3E I;  3U50 C;  5T6B A;  3S14 I;  2E2I I;  4NBC A;  3PO3 I;  2E9H A;  1NUI A;  4E2Y A;  1LQL A;  1USP B;  3CXC Z;  3M4O I;  5D1P A;  3J81 f;  2RT9 A;  1DL6 A;  1ZB9 A;  4DQY B;  1VQ5 1;  1YUK A;  1VQ9 1;  1N8R 1;  4E30 A;  1Q86 2;  3H3V J;  2DE6 A;  1Y1W I;  1RO0 A;  3JAM b;  5LL6 f;  1I6H I;  4RVD A;  1K9M 1;  3M3Y I;  1KC8 1;  2GTH A;  4A93 I;  3CPW Y;  1VQK Z;  1QVF Y;  4RVG A;  3GTQ I;  3VMI A;  1X0T A;  1KQS Z;  1RO2 A;  4RVF A;  1X3W A;  5C44 I;  1VQ8 1;  1VQP 1;  3NDJ A;  4NBG A;  1K8A 2;  3NH8 A;  3I4N I;  4RVH A;  3CD6 1;  3G4S 1;  2LIY A;  1QVG Z;  3VMG A;  2G2K A;  3CCS 1;  2IZ3 A;  3S1Q I;  4MH4 A;  1VQP Z;  2KI7 B;  1YJ9 Z;  3CD6 Z;  4E32 A;  3CCL Z;  3CCS Z;  2Q4Z A;  3VB9 A;  4E2Z A;  3S1R I;  4X6A I;  2OTL Z;  3KIF A;  2Y0S A;  5CM2 M;  3GTL I;  1Q82 2;  4QTT A;  2EGT A;  2QRC B;  3GTM I;  4A3E I;  1VQO 1;  1USP A;  3ESW A;  5D1O A;  2VUG A;  1YJN 1;  2JA6 I;  2OOX B;  3CCQ Z;  1P9N A;  3S1N I;  1SFO I;  1VQO Z;  3IX0 A;  4A3L I;  1TWG I;  4E31 A;  1Q86 1;  3OW2 Y;  1ZH1 A;  3MZL B;  3CQZ I;  4DGL A;  2RHB A;  3NDI A;  2OZK A;  1VQ7 1;  2JA8 I;  2JS4 A;  3G6E 1;  1JJ2 Z;  4A3J I;  1WW9 A;  4A3D I;  3VMH A;  1K8A 1;  2YAD A;  1Q81 2;  2V8J A;  1YI2 Z;  1VQ4 1;  1NJI 2;  2QKD A;  4RV9 A;  3NH4 A;  3G71 1;  3S1M I;  1VQ4 Z;  3J80 b;  1I3Q I;  2QR1 B;  1YHQ Z;  4A3B I;  4EWC A;  3S2H I;  1QVF Z;  2OTJ 1;  2F4M A;  2W03 A;  3G71 Z;  3TE5 B;  1S72 Z;  1VQM 1;  1M90 2;  4A3K I;  1Q82 1;  5A2Q b;  2QA4 1;  2OTJ Z;  1VQK 1;  2VUM I;  1PFT A;  2O53 A;  4MD8 A;  1VQM Z;  4BBR I;  3GKQ A;  1N2F A;  2QA4 Z;  2O4H A;  2H85 A;  3K7A I;  4MON A;  2IZ4 A;  4CL1 A;  3CCM 1;  1K83 I;  3TDH B;  1YJ9 1;  4NBH A;  2QRE B;  1KD1 1;  4S1T A;  3T4N B;  3HKZ A;  3CCL 1;  3NFZ A;  2RIQ A;  3CCM Z;  3S17 I;  2OTL 1;  3D9X A;  5A2Q f;  1M1K 2;  5AN9 F;  3JAM f;  4HGY A;  3MZK B;  1ML8 A;  2HU9 A;  3Q87 A;  1Q81 1;  1YJW 1;  1RNI A;  4MRI A;  3CCQ 1;  2M48 A;  1VQ6 Z;  1YIJ 1;  1YJW Z;  2RPR A;  1KQS Y;  3HOU I;  3GCF A;  2AKL A;  4NBF A;  1Y1V S;  4NOZ A;  1YIT 1;  2LFU A;  3RZO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...