3S2DI

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI02
2NVTI 1WCMI 3S2HI 5C4XI 1X3WA 4NBAA 2E2II 4A3LI 1R9TI 5C4JI 3D6WA 4NBFA 4BXXI 3M3YI 1LQLA 1TFIA 5IP9I 4X6AI 3PO3I 4NBBA 4A3BI 1Y1VI 4BBRI 2R92I 3CQZI 3I07A 2JA6I 1X3ZA 4QTUA 2F4MA 3Q87A 4A3GI 3GTMI 4NBGA 4BBSI 3HOXI 4Y52I 1TWGI 5C44I 4BY1I 5CM2M 2JA5I 1I6HI 2PK7A 3H0GI 4NBEA 4XX2A 1VLAA 2JA8I 2DE6A 4MH4A 2NVYI 2KPIA 3I4NI 1YUAA 2NVQI 2DE5A 5FLMI 3GKQA 4NBHA 4A3KI 2JS4A 3GTLI 3HOYI 1PFTA 2B63I 3GTJI 4Y7NI 4A93I 2RBLA 3VB9A 4BY7I 1I50I 2JNYA 3U50C 1TWAI 4A3FI 2E2HI 3HOWI 3S1NI 3HOVI 3VMGA 3K7AI 3GCFA 1TWHI 2AKLA 4A3EI 2JA7I 3I4MI 1K83I 4QTTA 3GTQI 1QYPA 1TWCI 2JR6A 4A3CI 3HOZI 5C3EI 3RZOI 3S2DI 4NOZA 4NB8A 3S16I 3ESWA 1USPA 3PO2I 2K5RA 2DE7A 2NVXI 4NBDA 2HF1A 2VUMI 1DL6A 1N2FA 4NB9A 1I3QI 3FKII 3GTOI 3S17I 3GTMS 2P3YA 4A3MI 3VMHA 3GTKI 3GTGI 3S15I 3S14I 2YU9I 1ZB8A 2E2JI 4A3II 1Y1VS 1RO4A 3S1RI 3PO3S 1ZB9A 3S1QI 4A3DI 5IP7I 2F4OA 3VMIA 1NUIA 2BJOA 3RZDI 4NBCA 1ML8A 1RLYA 3LUSA 3HOUI 3M4OI 1WW9A 3S1MI 4A3JI 3GTPI 3EERA 3H3VJ 1USPB 1L1OC 2J6AA 2R93I 1TWFI 1SFOI 2R7ZI 1Y1WI
chains in the Genus database with same CATH superfamily
4HGZA 2OOYB 4A3LI 2LIYA 2QR1B 5C4JI 2GTIA 4MD9A 3M3YI 1Z02A 1TFIA 5IT9f 1VQ81 2VPYA 3PO3I 5FLXf 1Q7Y1 3G71Z 3CCQZ 2E7ZA 1M1K1 1RQFA 4AYBA 2JA6I 3Q87A 3CCR1 4MRIA 2JA5I 4NBEA 5D1OB 2Q4ZA 1VLAA 3NH8A 5AN9F 1RO2A 2HU9A 1AA6A 3G6EZ 1VQ8Z 2JS4A 4Y7NI 1K9M2 2KI7B 3G711 1N8R2 4BY7I 3QWUA 3CCQ1 2GTHA 2Y0SA 1YI2Z 2IZ4A 3S1NI 3K7AI 1Q862 2JA7I 1KC81 3I4MI 4QTTA 1TWCI 1JJ2Y 1Q861 2LEXA 4MONA 5C3EI 3D2LA 3J81f 3G6E1 4NOZA 4NB8A 1VQLZ 4CL1A 3T4NB 4DQYB 2JIPA 2RIQA 2K5RA 2OOXB 1DL6A 1FDOA 2QRCB 4NB9A 1VQP1 4A3MI 2JMOA 2OTL1 2QREB 2YU9I 4A3II 1Y1VS 3S1RI 1Z03A 3VMIA 1NUIA 3NDJA 3CCM1 2G2KA 2Q51A 3HOUI 1VQL1 3CXCZ 1WW9A 2M48A 1USPB 1L1OC 1VQKZ 3CD61 1YIJ1 3I55Z 1VQPZ 5C4XI 1X3WA 3NH5A 2OTLZ 1R9TI 3D6WA 4NBFA 4BXXI 1LQLA 2QA4Z 5IP9I 4X6AI 2VPZA 4RS4A 4A3BI 2IV2X 4BBRI 3CC71 2PMZA 1VQ6Z 2R92I 1W2BZ 3I07A 4E31A 2K3RA 5T64A 3KIFA 1YIT1 5LL6f 2F4MA 4QTUA 3GTMI 1VQO1 4Y52I 3HOXI 1VQK1 3CPWZ 1YIJZ 3CCV1 2PK7A 3J7A4 3I551 3CC4Z 2JA8I 1VQ4Z 2KPIA 3I4NI 5FLMI 2VF1A 1K731 2QKDA 3OW2Z 5FLXb 5T67A 4E2ZA 1RNIA 1ZH1A 2B63I 3GTJI 1K732 3CC7Z 3FQQA 1VQ61 1P9NA 1Q811 2JNYA 1YITZ 1YJW1 4A3FI 2P28A 1JJ2Z 3CCMZ 4A3EI 4RVHA 3F3FC 3BG0B 4TNUA 1VQ41 3GTQI 1Q821 3TDHB 3HOZI 3RZOI 3CXCY 3CD6Z 2QLVB 1KD12 2QRDB 2V8KA 3J80f 2DE7A 1N2FA 4MXUA 2QA41 3GTOI 3GTMS 1VQMZ 3VMHA 4RV9A 2V45A 1RO4A 3JAMb 2IZ3A 1VQOZ 1W2BY 1JWHC 1KQSY 3CCVZ 1ML8A 3LUSA 3CC41 3EERA 1KD11 1FDIA 1TWFI 1Q822 5T6BA 2R7ZI 1Y1WI 2NVTI 1WCMI 3EEDA 3I561 2E2II 3BG1B 2AYDA 2O4HA 3CCE1 1YJWZ 3CMAZ 1K8A2 1M1K2 4MD7A 3CC21 3MONA 1Y1VI 3CQZI 1X3ZA 3TE5B 4A3GI 4NBGA 3CCL1 3NDIA 4BY1I 5CM2M 1I6HI 3H0GI 4MH4A 3P5JB 1YUAA 3G4S1 2DE5A 4A3KI 1QVFY 1SIWA 3GTLI 1VQM1 2OTJ1 3CC2Z 2V8IA 3CCJZ 4A93I 1I50I 1TWAI 1X0TA 2JIQA 2LFUA 3IFUA 3NH4A 3HOVI 4NFRA 5A2Qb 1TWHI 2AKLA 2VUGA 4A3CI 1QYPA 4HH4A 2VPWA 1QXFA 3FQMA 3G4SZ 1QF8A 3ESWA 2OTJZ 3I56Z 2PM9A 4E2YA 2ZAEB 1S721 2NVXI 2HF1A 2R6MA 1NP6A 3CCEZ 2RPRA 1I3QI 3FKII 3CMA1 3GTKI 2JIMA 2E2JI 1M901 3MZKB 3PO3S 3CPWY 1N8R1 1ZB9A 3S1QI 4A3DI 3VTNA 5IP7I 3CCLZ 5D1PA 2BJOA 1WIIA 3M4OI 1WJ2A 3J80b 2JIRA 4DGLA 1Z01A 1YJN1 4A3JI 4E30A 3CCSZ 3CCUZ 2J6AA 2V3VA 1SFOI 3F3PC 1M902 3HKZA 3S2HI 4NBAA 2I3CA 2QEX1 1YJ9Z 3CCJ1 2WAQA 2O53A 1YHQZ 2V8JA 4NBBA 4DK1A 1K8A1 2RHBA 3OW2Y 3CMEZ 4EWCA 2GU2A 1K9M1 4BBSI 1QVFZ 3CCU1 5IT9b 1TWGI 5C44I 1VQ71 3J81b 1VQ9Z 1WZNA 4XX2A 3MZLB 2DE6A 2NVYI 2QEXZ 1S72Z 2NVQI 2W03A 1Y8CA 3GKQA 4NBHA 3HOYI 3IX0A 1PFTA 1S7MA 1VQ51 2RBLA 3VB9A 3IF8A 3U50C 3CME1 2EGTA 2E2HI 3HOWI 1Q7Y2 4E32A 3D9XA 4E2WA 2VPXA 3VMGA 4RVGA 3GCFA 1K83I 4HGYA 1Q16A 2JR6A 3JAMf 1YJNZ 2JIOA 2WB1A 5D1OA 3CCS1 1VQNZ 3S2DI 3KIHA 3S16I 1RO0A 2E9HA 1USPA 3PO2I 2RT9A 4NH1C 1VQ5Z 2H85A 4MD8A 2VUMI 1YJ91 4NBDA 2W04A 2JUBA 1KQSZ 2YADA 3S17I 1KC82 2P3YA 1YHQ1 4S1TA 1QVGY 3GTGI 3S15I 3S14I 2M6NA 1ZB8A 1YI21 2NAPA 1QVGZ 1KRLA 1NJI2 4RVFA 1Q812 3NFZA 2F4OA 1VQ7Z 2OZKA 3IR7A 1VQN1 1YUKA 4E2XA 5A2Qf 1VQ91 3RZDI 4NBCA 4RVDA 1RLYA 3S1MI 3GTPI 1NJI1 3H3VJ 3CCRZ 4E33A 2R93I
chains in the Genus database with same CATH topology
4HGZA 2OOYB 4A3LI 2LIYA 2QR1B 5C4JI 2GTIA 4MD9A 3M3YI 1Z02A 1TFIA 5IT9f 1VQ81 3PO3I 5FLXf 1Q7Y1 3G71Z 3CCQZ 1M1K1 1RQFA 4AYBA 2JA6I 3Q87A 3CCR1 4MRIA 2JA5I 4NBEA 5D1OB 2Q4ZA 1VLAA 3NH8A 5AN9F 1RO2A 2HU9A 3G6EZ 1VQ8Z 2JS4A 4Y7NI 1K9M2 2KI7B 3G711 1N8R2 4BY7I 3QWUA 3CCQ1 2GTHA 2Y0SA 1YI2Z 2IZ4A 3S1NI 3K7AI 1Q862 2JA7I 1KC81 3I4MI 4QTTA 1TWCI 1JJ2Y 1Q861 4MONA 5C3EI 3J81f 3G6E1 4NOZA 4NB8A 1VQLZ 4CL1A 3T4NB 4DQYB 2RIQA 2OOXB 2K5RA 1DL6A 2QRCB 4NB9A 1VQP1 4A3MI 2JMOA 2OTL1 2QREB 2YU9I 4A3II 1Y1VS 3S1RI 1Z03A 3VMIA 1NUIA 3NDJA 3CCM1 2G2KA 2Q51A 3HOUI 1VQL1 3CXCZ 1WW9A 2M48A 1USPB 1L1OC 1VQKZ 3CD61 1YIJ1 3I55Z 1VQPZ 5C4XI 1X3WA 3NH5A 2OTLZ 1R9TI 3D6WA 4NBFA 4BXXI 1LQLA 2QA4Z 5IP9I 4X6AI 4RS4A 4A3BI 4BBRI 3CC71 2PMZA 1VQ6Z 2R92I 1W2BZ 3I07A 4E31A 2K3RA 5T64A 3KIFA 1YIT1 5LL6f 2F4MA 4QTUA 3GTMI 1VQO1 4Y52I 3HOXI 1VQK1 3CPWZ 1YIJZ 3CCV1 2PK7A 3J7A4 3I551 3CC4Z 2JA8I 1VQ4Z 2KPIA 3I4NI 5FLMI 2VF1A 1K731 2QKDA 3OW2Z 5FLXb 5T67A 4E2ZA 1RNIA 1ZH1A 2B63I 3GTJI 1K732 3CC7Z 3FQQA 1VQ61 1P9NA 1Q811 2JNYA 1YITZ 1YJW1 4A3FI 2P28A 1JJ2Z 3CCMZ 4A3EI 4RVHA 3F3FC 3BG0B 4TNUA 1VQ41 3GTQI 1Q821 3TDHB 3HOZI 3RZOI 3CXCY 3CD6Z 2QLVB 1KD12 2QRDB 2V8KA 3J80f 2DE7A 1N2FA 4MXUA 2QA41 3GTOI 3GTMS 1VQMZ 3VMHA 4RV9A 1RO4A 3JAMb 2IZ3A 1VQOZ 1W2BY 1JWHC 1KQSY 3CCVZ 1ML8A 3LUSA 3CC41 3EERA 1KD11 1TWFI 1Q822 5T6BA 2R7ZI 1Y1WI 2NVTI 1WCMI 3EEDA 3I561 2E2II 3BG1B 2O4HA 3CCE1 1YJWZ 3CMAZ 1K8A2 1M1K2 4MD7A 3CC21 3MONA 1Y1VI 3CQZI 1X3ZA 3TE5B 4A3GI 4NBGA 3CCL1 3NDIA 4BY1I 5CM2M 1I6HI 3H0GI 4MH4A 3P5JB 1YUAA 3G4S1 2DE5A 4A3KI 1QVFY 3GTLI 1VQM1 2OTJ1 3CC2Z 2V8IA 3CCJZ 4A93I 1I50I 1TWAI 1X0TA 2LFUA 3IFUA 3NH4A 3HOVI 4NFRA 5A2Qb 1TWHI 2AKLA 2VUGA 4A3CI 1QYPA 4HH4A 3FQMA 3G4SZ 1QF8A 3ESWA 2OTJZ 3I56Z 2PM9A 2ZAEB 4E2YA 1S721 2NVXI 2HF1A 2R6MA 1NP6A 3CCEZ 2RPRA 1I3QI 3FKII 3CMA1 3GTKI 2E2JI 1M901 3MZKB 3PO3S 3CPWY 1N8R1 1ZB9A 3S1QI 4A3DI 3VTNA 5IP7I 3CCLZ 5D1PA 2BJOA 1WIIA 3M4OI 3J80b 4DGLA 1Z01A 1YJN1 4A3JI 4E30A 3CCSZ 3CCUZ 2J6AA 1SFOI 3F3PC 1M902 3HKZA 3S2HI 4NBAA 2I3CA 2QEX1 1YJ9Z 3CCJ1 2WAQA 2O53A 1YHQZ 2V8JA 4NBBA 4DK1A 1K8A1 2RHBA 3OW2Y 3CMEZ 4EWCA 2GU2A 1K9M1 4BBSI 1QVFZ 3CCU1 5IT9b 1TWGI 5C44I 1VQ71 3J81b 1VQ9Z 4XX2A 3MZLB 2DE6A 2NVYI 2QEXZ 1S72Z 2NVQI 2W03A 3GKQA 4NBHA 3HOYI 3IX0A 1PFTA 1S7MA 1VQ51 2RBLA 3VB9A 3IF8A 3U50C 3CME1 2EGTA 2E2HI 3HOWI 1Q7Y2 4E32A 3D9XA 4E2WA 3VMGA 4RVGA 3GCFA 1K83I 4HGYA 2JR6A 3JAMf 1YJNZ 2WB1A 5D1OA 3CCS1 1VQNZ 3S2DI 3KIHA 3S16I 1RO0A 2E9HA 1USPA 3PO2I 2RT9A 4NH1C 1VQ5Z 2H85A 4MD8A 2VUMI 4NBDA 1YJ91 2W04A 2JUBA 1KQSZ 2YADA 3S17I 1KC82 2P3YA 1YHQ1 4S1TA 1QVGY 3GTGI 3S15I 3S14I 2M6NA 1ZB8A 1YI21 1QVGZ 1KRLA 1NJI2 4RVFA 1Q812 3NFZA 2F4OA 1VQ7Z 2OZKA 1VQN1 1YUKA 4E2XA 5A2Qf 3RZDI 1VQ91 4NBCA 4RVDA 1RLYA 3S1MI 3GTPI 1NJI1 3H3VJ 3CCRZ 4E33A 2R93I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT I;  1WCM I;  3S2H I;  5C4X I;  1X3W A;  4NBA A;  2E2I I;  4A3L I;  1R9T I;  5C4J I;  3D6W A;  4NBF A;  4BXX I;  3M3Y I;  1LQL A;  1TFI A;  5IP9 I;  4X6A I;  3PO3 I;  4NBB A;  4A3B I;  1Y1V I;  4BBR I;  2R92 I;  3CQZ I;  3I07 A;  2JA6 I;  1X3Z A;  4QTU A;  2F4M A;  3Q87 A;  4A3G I;  3GTM I;  4NBG A;  4BBS I;  3HOX I;  4Y52 I;  1TWG I;  5C44 I;  4BY1 I;  5CM2 M;  2JA5 I;  1I6H I;  2PK7 A;  3H0G I;  4NBE A;  4XX2 A;  1VLA A;  2JA8 I;  2DE6 A;  4MH4 A;  2NVY I;  2KPI A;  3I4N I;  1YUA A;  2NVQ I;  2DE5 A;  5FLM I;  3GKQ A;  4NBH A;  4A3K I;  2JS4 A;  3GTL I;  3HOY I;  1PFT A;  2B63 I;  3GTJ I;  4Y7N I;  4A93 I;  2RBL A;  3VB9 A;  4BY7 I;  1I50 I;  2JNY A;  3U50 C;  1TWA I;  4A3F I;  2E2H I;  3HOW I;  3S1N I;  3HOV I;  3VMG A;  3K7A I;  3GCF A;  1TWH I;  2AKL A;  4A3E I;  2JA7 I;  3I4M I;  1K83 I;  4QTT A;  3GTQ I;  1QYP A;  1TWC I;  2JR6 A;  4A3C I;  3HOZ I;  5C3E I;  3RZO I;  3S2D I;  4NOZ A;  4NB8 A;  3S16 I;  3ESW A;  1USP A;  3PO2 I;  2K5R A;  2DE7 A;  2NVX I;  4NBD A;  2HF1 A;  2VUM I;  1DL6 A;  1N2F A;  4NB9 A;  1I3Q I;  3FKI I;  3GTO I;  3S17 I;  3GTM S;  2P3Y A;  4A3M I;  3VMH A;  3GTK I;  3GTG I;  3S15 I;  3S14 I;  2YU9 I;  1ZB8 A;  2E2J I;  4A3I I;  1Y1V S;  1RO4 A;  3S1R I;  3PO3 S;  1ZB9 A;  3S1Q I;  4A3D I;  5IP7 I;  2F4O A;  3VMI A;  1NUI A;  2BJO A;  3RZD I;  4NBC A;  1ML8 A;  1RLY A;  3LUS A;  3HOU I;  3M4O I;  1WW9 A;  3S1M I;  4A3J I;  3GTP I;  3EER A;  3H3V J;  1USP B;  1L1O C;  2J6A A;  2R93 I;  1TWF I;  1SFO I;  2R7Z I;  1Y1W I; 
#chains in the Genus database with same CATH topology
 4HGZ A;  2OOY B;  4A3L I;  2LIY A;  2QR1 B;  5C4J I;  2GTI A;  4MD9 A;  3M3Y I;  1Z02 A;  1TFI A;  5IT9 f;  1VQ8 1;  2VPY A;  3PO3 I;  5FLX f;  1Q7Y 1;  3G71 Z;  3CCQ Z;  2E7Z A;  1M1K 1;  1RQF A;  4AYB A;  2JA6 I;  3Q87 A;  3CCR 1;  4MRI A;  2JA5 I;  4NBE A;  5D1O B;  2Q4Z A;  1VLA A;  3NH8 A;  5AN9 F;  1RO2 A;  2HU9 A;  1AA6 A;  3G6E Z;  1VQ8 Z;  2JS4 A;  4Y7N I;  1K9M 2;  2KI7 B;  3G71 1;  1N8R 2;  4BY7 I;  3QWU A;  3CCQ 1;  2GTH A;  2Y0S A;  1YI2 Z;  2IZ4 A;  3S1N I;  3K7A I;  1Q86 2;  2JA7 I;  1KC8 1;  3I4M I;  4QTT A;  1TWC I;  1JJ2 Y;  1Q86 1;  2LEX A;  4MON A;  5C3E I;  3D2L A;  3J81 f;  3G6E 1;  4NOZ A;  4NB8 A;  1VQL Z;  4CL1 A;  3T4N B;  4DQY B;  2JIP A;  2RIQ A;  2K5R A;  2OOX B;  1DL6 A;  1FDO A;  2QRC B;  4NB9 A;  1VQP 1;  4A3M I;  2JMO A;  2OTL 1;  2QRE B;  2YU9 I;  4A3I I;  1Y1V S;  3S1R I;  1Z03 A;  3VMI A;  1NUI A;  3NDJ A;  3CCM 1;  2G2K A;  2Q51 A;  3HOU I;  1VQL 1;  3CXC Z;  1WW9 A;  2M48 A;  1USP B;  1L1O C;  1VQK Z;  3CD6 1;  1YIJ 1;  3I55 Z;  1VQP Z;  5C4X I;  1X3W A;  3NH5 A;  2OTL Z;  1R9T I;  3D6W A;  4NBF A;  4BXX I;  1LQL A;  2QA4 Z;  5IP9 I;  4X6A I;  2VPZ A;  4RS4 A;  4A3B I;  2IV2 X;  4BBR I;  3CC7 1;  2PMZ A;  1VQ6 Z;  2R92 I;  1W2B Z;  3I07 A;  4E31 A;  2K3R A;  5T64 A;  3KIF A;  1YIT 1;  5LL6 f;  2F4M A;  4QTU A;  3GTM I;  1VQO 1;  4Y52 I;  3HOX I;  1VQK 1;  3CPW Z;  1YIJ Z;  3CCV 1;  2PK7 A;  3J7A 4;  3I55 1;  3CC4 Z;  2JA8 I;  1VQ4 Z;  2KPI A;  3I4N I;  5FLM I;  2VF1 A;  1K73 1;  2QKD A;  3OW2 Z;  5FLX b;  5T67 A;  4E2Z A;  1RNI A;  1ZH1 A;  2B63 I;  3GTJ I;  1K73 2;  3CC7 Z;  3FQQ A;  1VQ6 1;  1P9N A;  1Q81 1;  2JNY A;  1YIT Z;  1YJW 1;  4A3F I;  2P28 A;  1JJ2 Z;  3CCM Z;  4A3E I;  4RVH A;  3F3F C;  3BG0 B;  4TNU A;  1VQ4 1;  3GTQ I;  1Q82 1;  3TDH B;  3HOZ I;  3RZO I;  3CXC Y;  3CD6 Z;  2QLV B;  1KD1 2;  2QRD B;  2V8K A;  3J80 f;  2DE7 A;  1N2F A;  4MXU A;  2QA4 1;  3GTO I;  3GTM S;  1VQM Z;  3VMH A;  4RV9 A;  2V45 A;  1RO4 A;  3JAM b;  2IZ3 A;  1VQO Z;  1W2B Y;  1JWH C;  1KQS Y;  3CCV Z;  1ML8 A;  3LUS A;  3CC4 1;  3EER A;  1KD1 1;  1FDI A;  1TWF I;  1Q82 2;  5T6B A;  2R7Z I;  1Y1W I;  2NVT I;  1WCM I;  3EED A;  3I56 1;  2E2I I;  3BG1 B;  2AYD A;  2O4H A;  3CCE 1;  1YJW Z;  3CMA Z;  1K8A 2;  1M1K 2;  4MD7 A;  3CC2 1;  3MON A;  1Y1V I;  3CQZ I;  1X3Z A;  3TE5 B;  4A3G I;  4NBG A;  3CCL 1;  3NDI A;  4BY1 I;  5CM2 M;  1I6H I;  3H0G I;  4MH4 A;  3P5J B;  1YUA A;  3G4S 1;  2DE5 A;  4A3K I;  1QVF Y;  1SIW A;  3GTL I;  1VQM 1;  2OTJ 1;  3CC2 Z;  2V8I A;  3CCJ Z;  4A93 I;  1I50 I;  1TWA I;  1X0T A;  2JIQ A;  2LFU A;  3IFU A;  3NH4 A;  3HOV I;  4NFR A;  5A2Q b;  1TWH I;  2AKL A;  2VUG A;  4A3C I;  1QYP A;  4HH4 A;  2VPW A;  1QXF A;  3FQM A;  3G4S Z;  1QF8 A;  3ESW A;  2OTJ Z;  3I56 Z;  2PM9 A;  4E2Y A;  2ZAE B;  1S72 1;  2NVX I;  2HF1 A;  2R6M A;  1NP6 A;  3CCE Z;  2RPR A;  1I3Q I;  3FKI I;  3CMA 1;  3GTK I;  2JIM A;  2E2J I;  1M90 1;  3MZK B;  3PO3 S;  3CPW Y;  1N8R 1;  1ZB9 A;  3S1Q I;  4A3D I;  3VTN A;  5IP7 I;  3CCL Z;  5D1P A;  2BJO A;  1WII A;  3M4O I;  1WJ2 A;  3J80 b;  2JIR A;  4DGL A;  1Z01 A;  1YJN 1;  4A3J I;  4E30 A;  3CCS Z;  3CCU Z;  2J6A A;  2V3V A;  1SFO I;  3F3P C;  1M90 2;  3HKZ A;  3S2H I;  4NBA A;  2I3C A;  2QEX 1;  1YJ9 Z;  3CCJ 1;  2WAQ A;  2O53 A;  1YHQ Z;  2V8J A;  4NBB A;  4DK1 A;  1K8A 1;  2RHB A;  3OW2 Y;  3CME Z;  4EWC A;  2GU2 A;  1K9M 1;  4BBS I;  1QVF Z;  3CCU 1;  5IT9 b;  1TWG I;  5C44 I;  1VQ7 1;  3J81 b;  1VQ9 Z;  1WZN A;  4XX2 A;  3MZL B;  2DE6 A;  2NVY I;  2QEX Z;  1S72 Z;  2NVQ I;  2W03 A;  1Y8C A;  3GKQ A;  4NBH A;  3HOY I;  3IX0 A;  1PFT A;  1S7M A;  1VQ5 1;  2RBL A;  3VB9 A;  3IF8 A;  3U50 C;  3CME 1;  2EGT A;  2E2H I;  3HOW I;  1Q7Y 2;  4E32 A;  3D9X A;  4E2W A;  2VPX A;  3VMG A;  4RVG A;  3GCF A;  1K83 I;  4HGY A;  1Q16 A;  2JR6 A;  3JAM f;  1YJN Z;  2JIO A;  2WB1 A;  5D1O A;  3CCS 1;  1VQN Z;  3S2D I;  3KIH A;  3S16 I;  1RO0 A;  2E9H A;  1USP A;  3PO2 I;  2RT9 A;  4NH1 C;  1VQ5 Z;  2H85 A;  4MD8 A;  2VUM I;  1YJ9 1;  4NBD A;  2W04 A;  2JUB A;  1KQS Z;  2YAD A;  3S17 I;  1KC8 2;  2P3Y A;  1YHQ 1;  4S1T A;  1QVG Y;  3GTG I;  3S15 I;  3S14 I;  2M6N A;  1ZB8 A;  1YI2 1;  2NAP A;  1QVG Z;  1KRL A;  1NJI 2;  4RVF A;  1Q81 2;  3NFZ A;  2F4O A;  1VQ7 Z;  2OZK A;  3IR7 A;  1VQN 1;  1YUK A;  4E2X A;  5A2Q f;  1VQ9 1;  3RZD I;  4NBC A;  4RVD A;  1RLY A;  3S1M I;  3GTP I;  1NJI 1;  3H3V J;  3CCR Z;  4E33 A;  2R93 I; 
#chains in the Genus database with same CATH homology
 4HGZ A;  2OOY B;  4A3L I;  2LIY A;  2QR1 B;  5C4J I;  2GTI A;  4MD9 A;  3M3Y I;  1Z02 A;  1TFI A;  5IT9 f;  1VQ8 1;  3PO3 I;  5FLX f;  1Q7Y 1;  3G71 Z;  3CCQ Z;  1M1K 1;  1RQF A;  4AYB A;  2JA6 I;  3Q87 A;  3CCR 1;  4MRI A;  2JA5 I;  4NBE A;  5D1O B;  2Q4Z A;  1VLA A;  3NH8 A;  5AN9 F;  1RO2 A;  2HU9 A;  3G6E Z;  1VQ8 Z;  2JS4 A;  4Y7N I;  1K9M 2;  2KI7 B;  3G71 1;  1N8R 2;  4BY7 I;  3QWU A;  3CCQ 1;  2GTH A;  2Y0S A;  1YI2 Z;  2IZ4 A;  3S1N I;  3K7A I;  1Q86 2;  2JA7 I;  1KC8 1;  3I4M I;  4QTT A;  1TWC I;  1JJ2 Y;  1Q86 1;  4MON A;  5C3E I;  3J81 f;  3G6E 1;  4NOZ A;  4NB8 A;  1VQL Z;  4CL1 A;  3T4N B;  4DQY B;  2RIQ A;  2OOX B;  2K5R A;  1DL6 A;  2QRC B;  4NB9 A;  1VQP 1;  4A3M I;  2JMO A;  2OTL 1;  2QRE B;  2YU9 I;  4A3I I;  1Y1V S;  3S1R I;  1Z03 A;  3VMI A;  1NUI A;  3NDJ A;  3CCM 1;  2G2K A;  2Q51 A;  3HOU I;  1VQL 1;  3CXC Z;  1WW9 A;  2M48 A;  1USP B;  1L1O C;  1VQK Z;  3CD6 1;  1YIJ 1;  3I55 Z;  1VQP Z;  5C4X I;  1X3W A;  3NH5 A;  2OTL Z;  1R9T I;  3D6W A;  4NBF A;  4BXX I;  1LQL A;  2QA4 Z;  5IP9 I;  4X6A I;  4RS4 A;  4A3B I;  4BBR I;  3CC7 1;  2PMZ A;  1VQ6 Z;  2R92 I;  1W2B Z;  3I07 A;  4E31 A;  2K3R A;  5T64 A;  3KIF A;  1YIT 1;  5LL6 f;  2F4M A;  4QTU A;  3GTM I;  1VQO 1;  4Y52 I;  3HOX I;  1VQK 1;  3CPW Z;  1YIJ Z;  3CCV 1;  2PK7 A;  3J7A 4;  3I55 1;  3CC4 Z;  2JA8 I;  1VQ4 Z;  2KPI A;  3I4N I;  5FLM I;  2VF1 A;  1K73 1;  2QKD A;  3OW2 Z;  5FLX b;  5T67 A;  4E2Z A;  1RNI A;  1ZH1 A;  2B63 I;  3GTJ I;  1K73 2;  3CC7 Z;  3FQQ A;  1VQ6 1;  1P9N A;  1Q81 1;  2JNY A;  1YIT Z;  1YJW 1;  4A3F I;  2P28 A;  1JJ2 Z;  3CCM Z;  4A3E I;  4RVH A;  3F3F C;  3BG0 B;  4TNU A;  1VQ4 1;  3GTQ I;  1Q82 1;  3TDH B;  3HOZ I;  3RZO I;  3CXC Y;  3CD6 Z;  2QLV B;  1KD1 2;  2QRD B;  2V8K A;  3J80 f;  2DE7 A;  1N2F A;  4MXU A;  2QA4 1;  3GTO I;  3GTM S;  1VQM Z;  3VMH A;  4RV9 A;  1RO4 A;  3JAM b;  2IZ3 A;  1VQO Z;  1W2B Y;  1JWH C;  1KQS Y;  3CCV Z;  1ML8 A;  3LUS A;  3CC4 1;  3EER A;  1KD1 1;  1TWF I;  1Q82 2;  5T6B A;  2R7Z I;  1Y1W I;  2NVT I;  1WCM I;  3EED A;  3I56 1;  2E2I I;  3BG1 B;  2O4H A;  3CCE 1;  1YJW Z;  3CMA Z;  1K8A 2;  1M1K 2;  4MD7 A;  3CC2 1;  3MON A;  1Y1V I;  3CQZ I;  1X3Z A;  3TE5 B;  4A3G I;  4NBG A;  3CCL 1;  3NDI A;  4BY1 I;  5CM2 M;  1I6H I;  3H0G I;  4MH4 A;  3P5J B;  1YUA A;  3G4S 1;  2DE5 A;  4A3K I;  1QVF Y;  3GTL I;  1VQM 1;  2OTJ 1;  3CC2 Z;  2V8I A;  3CCJ Z;  4A93 I;  1I50 I;  1TWA I;  1X0T A;  2LFU A;  3IFU A;  3NH4 A;  3HOV I;  4NFR A;  5A2Q b;  1TWH I;  2AKL A;  2VUG A;  4A3C I;  1QYP A;  4HH4 A;  3FQM A;  3G4S Z;  1QF8 A;  3ESW A;  2OTJ Z;  3I56 Z;  2PM9 A;  2ZAE B;  4E2Y A;  1S72 1;  2NVX I;  2HF1 A;  2R6M A;  1NP6 A;  3CCE Z;  2RPR A;  1I3Q I;  3FKI I;  3CMA 1;  3GTK I;  2E2J I;  1M90 1;  3MZK B;  3PO3 S;  3CPW Y;  1N8R 1;  1ZB9 A;  3S1Q I;  4A3D I;  3VTN A;  5IP7 I;  3CCL Z;  5D1P A;  2BJO A;  1WII A;  3M4O I;  3J80 b;  4DGL A;  1Z01 A;  1YJN 1;  4A3J I;  4E30 A;  3CCS Z;  3CCU Z;  2J6A A;  1SFO I;  3F3P C;  1M90 2;  3HKZ A;  3S2H I;  4NBA A;  2I3C A;  2QEX 1;  1YJ9 Z;  3CCJ 1;  2WAQ A;  2O53 A;  1YHQ Z;  2V8J A;  4NBB A;  4DK1 A;  1K8A 1;  2RHB A;  3OW2 Y;  3CME Z;  4EWC A;  2GU2 A;  1K9M 1;  4BBS I;  1QVF Z;  3CCU 1;  5IT9 b;  1TWG I;  5C44 I;  1VQ7 1;  3J81 b;  1VQ9 Z;  4XX2 A;  3MZL B;  2DE6 A;  2NVY I;  2QEX Z;  1S72 Z;  2NVQ I;  2W03 A;  3GKQ A;  4NBH A;  3HOY I;  3IX0 A;  1PFT A;  1S7M A;  1VQ5 1;  2RBL A;  3VB9 A;  3IF8 A;  3U50 C;  3CME 1;  2EGT A;  2E2H I;  3HOW I;  1Q7Y 2;  4E32 A;  3D9X A;  4E2W A;  3VMG A;  4RVG A;  3GCF A;  1K83 I;  4HGY A;  2JR6 A;  3JAM f;  1YJN Z;  2WB1 A;  5D1O A;  3CCS 1;  1VQN Z;  3S2D I;  3KIH A;  3S16 I;  1RO0 A;  2E9H A;  1USP A;  3PO2 I;  2RT9 A;  4NH1 C;  1VQ5 Z;  2H85 A;  4MD8 A;  2VUM I;  4NBD A;  1YJ9 1;  2W04 A;  2JUB A;  1KQS Z;  2YAD A;  3S17 I;  1KC8 2;  2P3Y A;  1YHQ 1;  4S1T A;  1QVG Y;  3GTG I;  3S15 I;  3S14 I;  2M6N A;  1ZB8 A;  1YI2 1;  1QVG Z;  1KRL A;  1NJI 2;  4RVF A;  1Q81 2;  3NFZ A;  2F4O A;  1VQ7 Z;  2OZK A;  1VQN 1;  1YUK A;  4E2X A;  5A2Q f;  3RZD I;  1VQ9 1;  4NBC A;  4RVD A;  1RLY A;  3S1M I;  3GTP I;  1NJI 1;  3H3V J;  3CCR Z;  4E33 A;  2R93 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...