3S2DI

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/rna/dna
total genus 16
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2dI02
3I4NI 3PO3S 3S2HI 4NBHA 3GTLI 2E2JI 3EERA 1TWHI 3S15I 3HOWI 2VUMI 2F4MA 4BBSI 2JA5I 4Y7NI 1X3WA 5FLMI 3HOZI 1L1OC 1RLYA 5C4JI 4A3BI 4X6AI 1I6HI 3M3YI 2DE6A 2NVXI 2JA8I 2JNYA 4NBGA 3GTMS 2J6AA 2PK7A 1TWAI 1WW9A 3K7AI 3RZDI 1I50I 1VLAA 1I3QI 3S1RI 1WCMI 1TWFI 3GCFA 2JA6I 3Q87A 4A93I 1USPB 3PO3I 2JA7I 2E2HI 3LUSA 5IP7I 4A3MI 2NVYI 2F4OA 2NVTI 2AKLA 3S14I 3FKII 4A3JI 2BJOA 3VMHA 1TFIA 1X3ZA 2JR6A 3GTJI 3H0GI 3D6WA 3GTOI 3RZOI 3S17I 2RBLA 4NOZA 2R92I 3I07A 5CM2M 3VB9A 2R93I 2KPIA 4MH4A 3GTMI 3GKQA 4BY1I 4Y52I 1RO4A 2R7ZI 3GTQI 2B63I 3ESWA 3S2DI 4A3CI 3HOVI 3S1NI 4NB8A 1ZB9A 5IP9I 4NBDA 4A3II 4BBRI 1TWCI 3GTKI 2P3YA 3U50C 1N2FA 2DE7A 4NBBA 5C44I 4NBCA 3PO2I 4A3EI 4NBFA 1NUIA 4XX2A 3H3VJ 3S1QI 3M4OI 2HF1A 4BY7I 3CQZI 5C4XI 1LQLA 3HOUI 2K5RA 4A3DI 3GTGI 4NBAA 4QTUA 3HOXI 4A3FI 1SFOI 1PFTA 3I4MI 1Y1WI 4NB9A 3S1MI 4BXXI 1QYPA 3VMGA 1R9TI 2NVQI 3S16I 3HOYI 1Y1VS 4NBEA 4A3LI 1ML8A 1Y1VI 2YU9I 4QTTA 2JS4A 2E2II 1YUAA 3GTPI 1TWGI 3VMIA 2DE5A 1USPA 1ZB8A 1K83I 4A3KI 5C3EI 1DL6A 4A3GI
chains in the Genus database with same CATH superfamily
3I4NI 4RS4A 3S2HI 3CC2Z 3GTLI 1WIIA 3EERA 3HOWI 2W04A 5IT9f 2W03A 4S1TA 5FLMI 3G4SZ 1JJ2Y 5T67A 2IZ4A 4RVDA 1VQOZ 1RLYA 5A2Qf 4X6AI 3M3YI 3IF8A 2JNYA 4NBGA 1M1K1 1TWAI 4DK1A 1YJWZ 1I50I 2EGTA 1WCMI 2LIYA 1N8R2 5IT9b 1P9NA 3Q87A 1VQ8Z 1Q862 1RO0A 1QVGZ 2E2HI 4NH1C 1Z03A 5IP7I 5A2Qb 4RVFA 2GU2A 3VMHA 1TFIA 3RZOI 3GTOI 4NOZA 5CM2M 1K8A1 2E9HA 1YUKA 3IR7A 2R93I 1RO4A 3CCJZ 3F3FC 1Q16A 1Y8CA 4A3CI 3MZLB 2YADA 3S1NI 1VQL1 1VQNZ 4NBDA 2V8KA 2Y0SA 1JJ2Z 3GTKI 3CCLZ 2VUGA 2DE7A 4NBBA 1S7MA 2VPYA 4XX2A 3S1QI 1FDOA 2G2KA 3CQZI 1VQK1 1SIWA 1VQM1 2QA41 4A3DI 3CCS1 1K732 4QTUA 3HOXI 3G711 4A3FI 1PFTA 1Y1WI 3TDHB 2AYDA 5T64A 1QYPA 1R9TI 1KD11 2JUBA 3S16I 4MD7A 1NJI1 2OTJ1 3CXCY 1Q811 1KC82 1K9M2 1Y1VI 1WZNA 1QVFZ 2QEX1 2QREB 1YUAA 3CC4Z 2JIMA 1Q7Y2 4RVGA 1VQ5Z 3I561 3CMEZ 2RIQA 1DL6A 3KIFA 4E2XA 4A3GI 1VQ71 3I551 3FQQA 3CCMZ 1TWHI 3S15I 2VUMI 3CCU1 2JA5I 2OZKA 2R6MA 3J7A4 1X3WA 1YJN1 3CCQ1 2QKDA 3HOZI 3G6EZ 1QF8A 1N8R1 2IZ3A 2JA8I 3K7AI 4MD9A 3RZDI 1I3QI 4NFRA 4DGLA 1TWFI 3NH5A 3G4S1 1S72Z 3CXCZ 3LUSA 2V3VA 2KI7B 2H85A 2V8JA 2JIRA 2F4OA 2NVYI 3QWUA 3FQMA 2AKLA 2M6NA 4RVHA 1Q822 4RV9A 1RO2A 3CCVZ 3NDJA 2RBLA 4MONA 3I07A 2OOXB 2OTL1 1RQFA 2VF1A 4Y52I 1VQ81 3MONA 3GTQI 3BG1B 3ESWA 4E2WA 1FDIA 3HKZA 2M48A 4E33A 5IP9I 3CCR1 4A3II 2JIQA 1K731 2V8IA 3U50C 2GTIA 2LEXA 1W2BZ 4HH4A 3PO2I 4NBFA 1NUIA 1QVFY 1YITZ 1VQ41 2HF1A 1LQLA 4DQYB 1WJ2A 1YIJ1 1VQPZ 5AN9F 1KC81 4MD8A 3S1MI 1Q7Y1 3VMGA 2VPXA 3CCL1 2NVQI 3J80f 2OOYB 1M902 4E31A 1ML8A 4E32A 4QTTA 2VPWA 1YI21 5T6BA 3VMIA 2DE5A 1USPA 4MXUA 4AYBA 1K83I 4MRIA 3J81f 3MZKB 2K3RA 2WAQA 2WB1A 5D1OA 2JIOA 1YHQ1 3J80b 1QXFA 2GTHA 1VQ9Z 4Y7NI 2V45A 3CC41 1VQLZ 1YJ9Z 1KRLA 1VQ51 4E30A 3J81b 2NVXI 2PK7A 2JMOA 3D2LA 3S1RI 1VQMZ 2QA4Z 2O4HA 3GCFA 3G6E1 3PO3I 2IV2X 1X0TA 3OW2Z 1K8A2 3CCEZ 1AA6A 2Q4ZA 4A3MI 3CD6Z 2OTJZ 2NVTI 3S14I 3FKII 1W2BY 3GTJI 2QRDB 3S17I 1Q861 3JAMf 3CC21 2KPIA 4MH4A 3NH4A 3GTMI 3GKQA 4BY1I 2O53A 1S721 3S2DI 1KQSZ 2JIPA 3CMAZ 4NB8A 3NFZA 3CC7Z 4BBRI 1VQO1 1N2FA 1VQ6Z 5C44I 3CCQZ 4NBCA 4A3EI 1YJW1 3JAMb 3KIHA 1NJI2 1M901 3HOUI 1Q812 3GTGI 4NBAA 3I4MI 2PM9A 4NB9A 4BXXI 4HGYA 1Y1VS 4NBEA 2RT9A 3BG0B 4A3LI 4CL1A 2QRCB 1YIT1 2YU9I 3NH8A 2NAPA 1VQP1 1ZB8A 4A3KI 4E2YA 2LFUA 2QLVB 3CCJ1 1K9M1 2OTLZ 3PO3S 4NBHA 2QR1B 2E2JI 4HGZA 4TNUA 1VQN1 2F4MA 4BBSI 5D1PA 1RNIA 3T4NB 1L1OC 3TE5B 3CCRZ 3OW2Y 2ZAEB 5C4JI 4A3BI 2VPZA 1I6HI 2DE6A 3GTMS 2J6AA 5FLXf 1WW9A 1VQ4Z 1VLAA 2Q51A 2P28A 2RHBA 1YIJZ 1VQ91 3D9XA 2JA6I 4A93I 1Z02A 1USPB 1YJ91 1M1K2 2JA7I 1KQSY 3VTNA 1ZH1A 3P5JB 5D1OB 5LL6f 4A3JI 2BJOA 3CME1 5FLXb 1X3ZA 2JR6A 3D6WA 3H0GI 1YI2Z 2PMZA 3CPWY 2R92I 2E7ZA 3VB9A 3CCM1 1VQKZ 1Z01A 3F3PC 3NDIA 3CCSZ 2R7ZI 2B63I 1Q821 3G71Z 1YHQZ 3HOVI 3IX0A 2I3CA 3CCE1 1ZB9A 3CD61 1TWCI 2P3YA 4EWCA 3IFUA 3H3VJ 3M4OI 2QEXZ 4BY7I 5C4XI 2K5RA 2RPRA 3I56Z 1SFOI 3CMA1 4E2ZA 3CC71 1VQ7Z 3I55Z 3HOYI 1VQ61 1QVGY 3CCUZ 2HU9A 2E2II 2JS4A 1NP6A 1JWHC 1YJNZ 3CCV1 3GTPI 1TWGI 3EEDA 3CPWZ 1KD12 5C3EI
chains in the Genus database with same CATH topology
3I4NI 4RS4A 3S2HI 3CC2Z 3GTLI 1WIIA 3EERA 3HOWI 2W04A 5IT9f 2W03A 4S1TA 5FLMI 3G4SZ 1JJ2Y 5T67A 2IZ4A 4RVDA 1VQOZ 1RLYA 5A2Qf 4X6AI 3M3YI 3IF8A 2JNYA 4NBGA 1M1K1 1TWAI 4DK1A 1YJWZ 1I50I 2EGTA 1WCMI 2LIYA 1N8R2 5IT9b 1P9NA 3Q87A 1VQ8Z 1Q862 1RO0A 1QVGZ 2E2HI 4NH1C 1Z03A 5IP7I 5A2Qb 4RVFA 2GU2A 3VMHA 1TFIA 3RZOI 3GTOI 4NOZA 5CM2M 1K8A1 2E9HA 1YUKA 2R93I 1RO4A 3CCJZ 3F3FC 4A3CI 3MZLB 2YADA 3S1NI 1VQL1 1VQNZ 4NBDA 2V8KA 2Y0SA 1JJ2Z 3GTKI 3CCLZ 2VUGA 2DE7A 4NBBA 1S7MA 4XX2A 3S1QI 2G2KA 3CQZI 1VQK1 1VQM1 2QA41 4A3DI 3CCS1 1K732 4QTUA 3HOXI 3G711 4A3FI 1PFTA 1Y1WI 3TDHB 5T64A 1QYPA 1R9TI 1KD11 2JUBA 3S16I 4MD7A 1NJI1 2OTJ1 3CXCY 1Q811 1KC82 1K9M2 1Y1VI 1QVFZ 2QEX1 2QREB 1YUAA 3CC4Z 1Q7Y2 4RVGA 1VQ5Z 3I561 3CMEZ 2RIQA 1DL6A 3KIFA 4E2XA 4A3GI 1VQ71 3I551 3FQQA 3CCMZ 1TWHI 3S15I 2VUMI 3CCU1 2JA5I 2OZKA 2R6MA 3J7A4 1X3WA 1YJN1 3CCQ1 2QKDA 3HOZI 3G6EZ 1QF8A 1N8R1 2IZ3A 2JA8I 3K7AI 4MD9A 3RZDI 1I3QI 4NFRA 4DGLA 1TWFI 3NH5A 3G4S1 1S72Z 3CXCZ 3LUSA 2KI7B 2H85A 2V8JA 2NVYI 2F4OA 3QWUA 3FQMA 2AKLA 2M6NA 4RVHA 1Q822 4RV9A 1RO2A 3CCVZ 3NDJA 2RBLA 4MONA 3I07A 2OOXB 2OTL1 1RQFA 2VF1A 4Y52I 1VQ81 3MONA 3GTQI 3BG1B 3ESWA 4E2WA 3HKZA 2M48A 4E33A 5IP9I 3CCR1 4A3II 1K731 2V8IA 3U50C 2GTIA 1W2BZ 4HH4A 3PO2I 4NBFA 1NUIA 1QVFY 1YITZ 1VQ41 2HF1A 1LQLA 4DQYB 1YIJ1 1VQPZ 5AN9F 1KC81 4MD8A 3S1MI 1Q7Y1 3VMGA 3CCL1 2NVQI 3J80f 2OOYB 1M902 4E31A 1ML8A 4E32A 4QTTA 1YI21 5T6BA 3VMIA 2DE5A 1USPA 4MXUA 4AYBA 1K83I 4MRIA 3J81f 3MZKB 2K3RA 2WAQA 2WB1A 5D1OA 1YHQ1 3J80b 2GTHA 1VQ9Z 4Y7NI 3CC41 1VQLZ 1YJ9Z 1KRLA 1VQ51 4E30A 3J81b 2NVXI 2PK7A 2JMOA 3S1RI 1VQMZ 2QA4Z 2O4HA 3GCFA 3G6E1 3PO3I 1X0TA 3OW2Z 1K8A2 3CCEZ 2Q4ZA 4A3MI 3CD6Z 2OTJZ 2NVTI 3S14I 3FKII 1W2BY 3GTJI 2QRDB 3S17I 1Q861 3JAMf 3CC21 2KPIA 4MH4A 3NH4A 3GTMI 3GKQA 4BY1I 2O53A 1S721 3S2DI 1KQSZ 3CMAZ 4NB8A 3NFZA 3CC7Z 4BBRI 1VQO1 1N2FA 1VQ6Z 5C44I 3CCQZ 4NBCA 4A3EI 1YJW1 3JAMb 3KIHA 1NJI2 1M901 3HOUI 1Q812 3GTGI 4NBAA 3I4MI 2PM9A 4NB9A 4BXXI 4HGYA 1Y1VS 4NBEA 2RT9A 3BG0B 4A3LI 2QRCB 4CL1A 1YIT1 2YU9I 3NH8A 1VQP1 1ZB8A 4A3KI 4E2YA 2LFUA 2QLVB 3CCJ1 1K9M1 2OTLZ 3PO3S 4NBHA 2QR1B 2E2JI 4HGZA 4TNUA 1VQN1 2F4MA 4BBSI 5D1PA 1RNIA 3T4NB 1L1OC 3TE5B 3CCRZ 3OW2Y 2ZAEB 5C4JI 4A3BI 1I6HI 2DE6A 3GTMS 2J6AA 5FLXf 1WW9A 1VQ4Z 1VLAA 2Q51A 2P28A 2RHBA 1YIJZ 1VQ91 3D9XA 2JA6I 4A93I 1Z02A 1USPB 1YJ91 1M1K2 2JA7I 1KQSY 3VTNA 1ZH1A 3P5JB 5D1OB 5LL6f 4A3JI 2BJOA 3CME1 5FLXb 1X3ZA 2JR6A 3D6WA 3H0GI 1YI2Z 2PMZA 3CPWY 2R92I 3VB9A 3CCM1 1VQKZ 1Z01A 3F3PC 3NDIA 3CCSZ 2R7ZI 2B63I 1Q821 3G71Z 1YHQZ 3HOVI 3IX0A 2I3CA 3CCE1 1ZB9A 3CD61 1TWCI 2P3YA 4EWCA 3IFUA 3H3VJ 3M4OI 2QEXZ 4BY7I 5C4XI 2K5RA 2RPRA 3I56Z 1SFOI 3CMA1 4E2ZA 3CC71 1VQ7Z 3I55Z 3HOYI 1VQ61 1QVGY 3CCUZ 2HU9A 2E2II 2JS4A 1NP6A 1JWHC 1YJNZ 3CCV1 3GTPI 1TWGI 3EEDA 3CPWZ 1KD12 5C3EI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N I;  3PO3 S;  3S2H I;  4NBH A;  3GTL I;  2E2J I;  3EER A;  1TWH I;  3S15 I;  3HOW I;  2VUM I;  2F4M A;  4BBS I;  2JA5 I;  4Y7N I;  1X3W A;  5FLM I;  3HOZ I;  1L1O C;  1RLY A;  5C4J I;  4A3B I;  4X6A I;  1I6H I;  3M3Y I;  2DE6 A;  2NVX I;  2JA8 I;  2JNY A;  4NBG A;  3GTM S;  2J6A A;  2PK7 A;  1TWA I;  1WW9 A;  3K7A I;  3RZD I;  1I50 I;  1VLA A;  1I3Q I;  3S1R I;  1WCM I;  1TWF I;  3GCF A;  2JA6 I;  3Q87 A;  4A93 I;  1USP B;  3PO3 I;  2JA7 I;  2E2H I;  3LUS A;  5IP7 I;  4A3M I;  2NVY I;  2F4O A;  2NVT I;  2AKL A;  3S14 I;  3FKI I;  4A3J I;  2BJO A;  3VMH A;  1TFI A;  1X3Z A;  2JR6 A;  3GTJ I;  3H0G I;  3D6W A;  3GTO I;  3RZO I;  3S17 I;  2RBL A;  4NOZ A;  2R92 I;  3I07 A;  5CM2 M;  3VB9 A;  2R93 I;  2KPI A;  4MH4 A;  3GTM I;  3GKQ A;  4BY1 I;  4Y52 I;  1RO4 A;  2R7Z I;  3GTQ I;  2B63 I;  3ESW A;  3S2D I;  4A3C I;  3HOV I;  3S1N I;  4NB8 A;  1ZB9 A;  5IP9 I;  4NBD A;  4A3I I;  4BBR I;  1TWC I;  3GTK I;  2P3Y A;  3U50 C;  1N2F A;  2DE7 A;  4NBB A;  5C44 I;  4NBC A;  3PO2 I;  4A3E I;  4NBF A;  1NUI A;  4XX2 A;  3H3V J;  3S1Q I;  3M4O I;  2HF1 A;  4BY7 I;  3CQZ I;  5C4X I;  1LQL A;  3HOU I;  2K5R A;  4A3D I;  3GTG I;  4NBA A;  4QTU A;  3HOX I;  4A3F I;  1SFO I;  1PFT A;  3I4M I;  1Y1W I;  4NB9 A;  3S1M I;  4BXX I;  1QYP A;  3VMG A;  1R9T I;  2NVQ I;  3S16 I;  3HOY I;  1Y1V S;  4NBE A;  4A3L I;  1ML8 A;  1Y1V I;  2YU9 I;  4QTT A;  2JS4 A;  2E2I I;  1YUA A;  3GTP I;  1TWG I;  3VMI A;  2DE5 A;  1USP A;  1ZB8 A;  1K83 I;  4A3K I;  5C3E I;  1DL6 A;  4A3G I; 
#chains in the Genus database with same CATH topology
 3I4N I;  4RS4 A;  3S2H I;  3CC2 Z;  3GTL I;  1WII A;  3EER A;  3HOW I;  2W04 A;  5IT9 f;  2W03 A;  4S1T A;  5FLM I;  3G4S Z;  1JJ2 Y;  5T67 A;  2IZ4 A;  4RVD A;  1VQO Z;  1RLY A;  5A2Q f;  4X6A I;  3M3Y I;  3IF8 A;  2JNY A;  4NBG A;  1M1K 1;  1TWA I;  4DK1 A;  1YJW Z;  1I50 I;  2EGT A;  1WCM I;  2LIY A;  1N8R 2;  5IT9 b;  1P9N A;  3Q87 A;  1VQ8 Z;  1Q86 2;  1RO0 A;  1QVG Z;  2E2H I;  4NH1 C;  1Z03 A;  5IP7 I;  5A2Q b;  4RVF A;  2GU2 A;  3VMH A;  1TFI A;  3RZO I;  3GTO I;  4NOZ A;  5CM2 M;  1K8A 1;  2E9H A;  1YUK A;  3IR7 A;  2R93 I;  1RO4 A;  3CCJ Z;  3F3F C;  1Q16 A;  1Y8C A;  4A3C I;  3MZL B;  2YAD A;  3S1N I;  1VQL 1;  1VQN Z;  4NBD A;  2V8K A;  2Y0S A;  1JJ2 Z;  3GTK I;  3CCL Z;  2VUG A;  2DE7 A;  4NBB A;  1S7M A;  2VPY A;  4XX2 A;  3S1Q I;  1FDO A;  2G2K A;  3CQZ I;  1VQK 1;  1SIW A;  1VQM 1;  2QA4 1;  4A3D I;  3CCS 1;  1K73 2;  4QTU A;  3HOX I;  3G71 1;  4A3F I;  1PFT A;  1Y1W I;  3TDH B;  2AYD A;  5T64 A;  1QYP A;  1R9T I;  1KD1 1;  2JUB A;  3S16 I;  4MD7 A;  1NJI 1;  2OTJ 1;  3CXC Y;  1Q81 1;  1KC8 2;  1K9M 2;  1Y1V I;  1WZN A;  1QVF Z;  2QEX 1;  2QRE B;  1YUA A;  3CC4 Z;  2JIM A;  1Q7Y 2;  4RVG A;  1VQ5 Z;  3I56 1;  3CME Z;  2RIQ A;  1DL6 A;  3KIF A;  4E2X A;  4A3G I;  1VQ7 1;  3I55 1;  3FQQ A;  3CCM Z;  1TWH I;  3S15 I;  2VUM I;  3CCU 1;  2JA5 I;  2OZK A;  2R6M A;  3J7A 4;  1X3W A;  1YJN 1;  3CCQ 1;  2QKD A;  3HOZ I;  3G6E Z;  1QF8 A;  1N8R 1;  2IZ3 A;  2JA8 I;  3K7A I;  4MD9 A;  3RZD I;  1I3Q I;  4NFR A;  4DGL A;  1TWF I;  3NH5 A;  3G4S 1;  1S72 Z;  3CXC Z;  3LUS A;  2V3V A;  2KI7 B;  2H85 A;  2V8J A;  2JIR A;  2F4O A;  2NVY I;  3QWU A;  3FQM A;  2AKL A;  2M6N A;  4RVH A;  1Q82 2;  4RV9 A;  1RO2 A;  3CCV Z;  3NDJ A;  2RBL A;  4MON A;  3I07 A;  2OOX B;  2OTL 1;  1RQF A;  2VF1 A;  4Y52 I;  1VQ8 1;  3MON A;  3GTQ I;  3BG1 B;  3ESW A;  4E2W A;  1FDI A;  3HKZ A;  2M48 A;  4E33 A;  5IP9 I;  3CCR 1;  4A3I I;  2JIQ A;  1K73 1;  2V8I A;  3U50 C;  2GTI A;  2LEX A;  1W2B Z;  4HH4 A;  3PO2 I;  4NBF A;  1NUI A;  1QVF Y;  1YIT Z;  1VQ4 1;  2HF1 A;  1LQL A;  4DQY B;  1WJ2 A;  1YIJ 1;  1VQP Z;  5AN9 F;  1KC8 1;  4MD8 A;  3S1M I;  1Q7Y 1;  3VMG A;  2VPX A;  3CCL 1;  2NVQ I;  3J80 f;  2OOY B;  1M90 2;  4E31 A;  1ML8 A;  4E32 A;  4QTT A;  2VPW A;  1YI2 1;  5T6B A;  3VMI A;  2DE5 A;  1USP A;  4MXU A;  4AYB A;  1K83 I;  4MRI A;  3J81 f;  3MZK B;  2K3R A;  2WAQ A;  2WB1 A;  5D1O A;  2JIO A;  1YHQ 1;  3J80 b;  1QXF A;  2GTH A;  1VQ9 Z;  4Y7N I;  2V45 A;  3CC4 1;  1VQL Z;  1YJ9 Z;  1KRL A;  1VQ5 1;  4E30 A;  3J81 b;  2NVX I;  2PK7 A;  2JMO A;  3D2L A;  3S1R I;  1VQM Z;  2QA4 Z;  2O4H A;  3GCF A;  3G6E 1;  3PO3 I;  2IV2 X;  1X0T A;  3OW2 Z;  1K8A 2;  3CCE Z;  1AA6 A;  2Q4Z A;  4A3M I;  3CD6 Z;  2OTJ Z;  2NVT I;  3S14 I;  3FKI I;  1W2B Y;  3GTJ I;  2QRD B;  3S17 I;  1Q86 1;  3JAM f;  3CC2 1;  2KPI A;  4MH4 A;  3NH4 A;  3GTM I;  3GKQ A;  4BY1 I;  2O53 A;  1S72 1;  3S2D I;  1KQS Z;  2JIP A;  3CMA Z;  4NB8 A;  3NFZ A;  3CC7 Z;  4BBR I;  1VQO 1;  1N2F A;  1VQ6 Z;  5C44 I;  3CCQ Z;  4NBC A;  4A3E I;  1YJW 1;  3JAM b;  3KIH A;  1NJI 2;  1M90 1;  3HOU I;  1Q81 2;  3GTG I;  4NBA A;  3I4M I;  2PM9 A;  4NB9 A;  4BXX I;  4HGY A;  1Y1V S;  4NBE A;  2RT9 A;  3BG0 B;  4A3L I;  4CL1 A;  2QRC B;  1YIT 1;  2YU9 I;  3NH8 A;  2NAP A;  1VQP 1;  1ZB8 A;  4A3K I;  4E2Y A;  2LFU A;  2QLV B;  3CCJ 1;  1K9M 1;  2OTL Z;  3PO3 S;  4NBH A;  2QR1 B;  2E2J I;  4HGZ A;  4TNU A;  1VQN 1;  2F4M A;  4BBS I;  5D1P A;  1RNI A;  3T4N B;  1L1O C;  3TE5 B;  3CCR Z;  3OW2 Y;  2ZAE B;  5C4J I;  4A3B I;  2VPZ A;  1I6H I;  2DE6 A;  3GTM S;  2J6A A;  5FLX f;  1WW9 A;  1VQ4 Z;  1VLA A;  2Q51 A;  2P28 A;  2RHB A;  1YIJ Z;  1VQ9 1;  3D9X A;  2JA6 I;  4A93 I;  1Z02 A;  1USP B;  1YJ9 1;  1M1K 2;  2JA7 I;  1KQS Y;  3VTN A;  1ZH1 A;  3P5J B;  5D1O B;  5LL6 f;  4A3J I;  2BJO A;  3CME 1;  5FLX b;  1X3Z A;  2JR6 A;  3D6W A;  3H0G I;  1YI2 Z;  2PMZ A;  3CPW Y;  2R92 I;  2E7Z A;  3VB9 A;  3CCM 1;  1VQK Z;  1Z01 A;  3F3P C;  3NDI A;  3CCS Z;  2R7Z I;  2B63 I;  1Q82 1;  3G71 Z;  1YHQ Z;  3HOV I;  3IX0 A;  2I3C A;  3CCE 1;  1ZB9 A;  3CD6 1;  1TWC I;  2P3Y A;  4EWC A;  3IFU A;  3H3V J;  3M4O I;  2QEX Z;  4BY7 I;  5C4X I;  2K5R A;  2RPR A;  3I56 Z;  1SFO I;  3CMA 1;  4E2Z A;  3CC7 1;  1VQ7 Z;  3I55 Z;  3HOY I;  1VQ6 1;  1QVG Y;  3CCU Z;  2HU9 A;  2E2I I;  2JS4 A;  1NP6 A;  1JWH C;  1YJN Z;  3CCV 1;  3GTP I;  1TWG I;  3EED A;  3CPW Z;  1KD1 2;  5C3E I; 
#chains in the Genus database with same CATH homology
 3I4N I;  4RS4 A;  3S2H I;  3CC2 Z;  3GTL I;  1WII A;  3EER A;  3HOW I;  2W04 A;  5IT9 f;  2W03 A;  4S1T A;  5FLM I;  3G4S Z;  1JJ2 Y;  5T67 A;  2IZ4 A;  4RVD A;  1VQO Z;  1RLY A;  5A2Q f;  4X6A I;  3M3Y I;  3IF8 A;  2JNY A;  4NBG A;  1M1K 1;  1TWA I;  4DK1 A;  1YJW Z;  1I50 I;  2EGT A;  1WCM I;  2LIY A;  1N8R 2;  5IT9 b;  1P9N A;  3Q87 A;  1VQ8 Z;  1Q86 2;  1RO0 A;  1QVG Z;  2E2H I;  4NH1 C;  1Z03 A;  5IP7 I;  5A2Q b;  4RVF A;  2GU2 A;  3VMH A;  1TFI A;  3RZO I;  3GTO I;  4NOZ A;  5CM2 M;  1K8A 1;  2E9H A;  1YUK A;  2R93 I;  1RO4 A;  3CCJ Z;  3F3F C;  4A3C I;  3MZL B;  2YAD A;  3S1N I;  1VQL 1;  1VQN Z;  4NBD A;  2V8K A;  2Y0S A;  1JJ2 Z;  3GTK I;  3CCL Z;  2VUG A;  2DE7 A;  4NBB A;  1S7M A;  4XX2 A;  3S1Q I;  2G2K A;  3CQZ I;  1VQK 1;  1VQM 1;  2QA4 1;  4A3D I;  3CCS 1;  1K73 2;  4QTU A;  3HOX I;  3G71 1;  4A3F I;  1PFT A;  1Y1W I;  3TDH B;  5T64 A;  1QYP A;  1R9T I;  1KD1 1;  2JUB A;  3S16 I;  4MD7 A;  1NJI 1;  2OTJ 1;  3CXC Y;  1Q81 1;  1KC8 2;  1K9M 2;  1Y1V I;  1QVF Z;  2QEX 1;  2QRE B;  1YUA A;  3CC4 Z;  1Q7Y 2;  4RVG A;  1VQ5 Z;  3I56 1;  3CME Z;  2RIQ A;  1DL6 A;  3KIF A;  4E2X A;  4A3G I;  1VQ7 1;  3I55 1;  3FQQ A;  3CCM Z;  1TWH I;  3S15 I;  2VUM I;  3CCU 1;  2JA5 I;  2OZK A;  2R6M A;  3J7A 4;  1X3W A;  1YJN 1;  3CCQ 1;  2QKD A;  3HOZ I;  3G6E Z;  1QF8 A;  1N8R 1;  2IZ3 A;  2JA8 I;  3K7A I;  4MD9 A;  3RZD I;  1I3Q I;  4NFR A;  4DGL A;  1TWF I;  3NH5 A;  3G4S 1;  1S72 Z;  3CXC Z;  3LUS A;  2KI7 B;  2H85 A;  2V8J A;  2NVY I;  2F4O A;  3QWU A;  3FQM A;  2AKL A;  2M6N A;  4RVH A;  1Q82 2;  4RV9 A;  1RO2 A;  3CCV Z;  3NDJ A;  2RBL A;  4MON A;  3I07 A;  2OOX B;  2OTL 1;  1RQF A;  2VF1 A;  4Y52 I;  1VQ8 1;  3MON A;  3GTQ I;  3BG1 B;  3ESW A;  4E2W A;  3HKZ A;  2M48 A;  4E33 A;  5IP9 I;  3CCR 1;  4A3I I;  1K73 1;  2V8I A;  3U50 C;  2GTI A;  1W2B Z;  4HH4 A;  3PO2 I;  4NBF A;  1NUI A;  1QVF Y;  1YIT Z;  1VQ4 1;  2HF1 A;  1LQL A;  4DQY B;  1YIJ 1;  1VQP Z;  5AN9 F;  1KC8 1;  4MD8 A;  3S1M I;  1Q7Y 1;  3VMG A;  3CCL 1;  2NVQ I;  3J80 f;  2OOY B;  1M90 2;  4E31 A;  1ML8 A;  4E32 A;  4QTT A;  1YI2 1;  5T6B A;  3VMI A;  2DE5 A;  1USP A;  4MXU A;  4AYB A;  1K83 I;  4MRI A;  3J81 f;  3MZK B;  2K3R A;  2WAQ A;  2WB1 A;  5D1O A;  1YHQ 1;  3J80 b;  2GTH A;  1VQ9 Z;  4Y7N I;  3CC4 1;  1VQL Z;  1YJ9 Z;  1KRL A;  1VQ5 1;  4E30 A;  3J81 b;  2NVX I;  2PK7 A;  2JMO A;  3S1R I;  1VQM Z;  2QA4 Z;  2O4H A;  3GCF A;  3G6E 1;  3PO3 I;  1X0T A;  3OW2 Z;  1K8A 2;  3CCE Z;  2Q4Z A;  4A3M I;  3CD6 Z;  2OTJ Z;  2NVT I;  3S14 I;  3FKI I;  1W2B Y;  3GTJ I;  2QRD B;  3S17 I;  1Q86 1;  3JAM f;  3CC2 1;  2KPI A;  4MH4 A;  3NH4 A;  3GTM I;  3GKQ A;  4BY1 I;  2O53 A;  1S72 1;  3S2D I;  1KQS Z;  3CMA Z;  4NB8 A;  3NFZ A;  3CC7 Z;  4BBR I;  1VQO 1;  1N2F A;  1VQ6 Z;  5C44 I;  3CCQ Z;  4NBC A;  4A3E I;  1YJW 1;  3JAM b;  3KIH A;  1NJI 2;  1M90 1;  3HOU I;  1Q81 2;  3GTG I;  4NBA A;  3I4M I;  2PM9 A;  4NB9 A;  4BXX I;  4HGY A;  1Y1V S;  4NBE A;  2RT9 A;  3BG0 B;  4A3L I;  2QRC B;  4CL1 A;  1YIT 1;  2YU9 I;  3NH8 A;  1VQP 1;  1ZB8 A;  4A3K I;  4E2Y A;  2LFU A;  2QLV B;  3CCJ 1;  1K9M 1;  2OTL Z;  3PO3 S;  4NBH A;  2QR1 B;  2E2J I;  4HGZ A;  4TNU A;  1VQN 1;  2F4M A;  4BBS I;  5D1P A;  1RNI A;  3T4N B;  1L1O C;  3TE5 B;  3CCR Z;  3OW2 Y;  2ZAE B;  5C4J I;  4A3B I;  1I6H I;  2DE6 A;  3GTM S;  2J6A A;  5FLX f;  1WW9 A;  1VQ4 Z;  1VLA A;  2Q51 A;  2P28 A;  2RHB A;  1YIJ Z;  1VQ9 1;  3D9X A;  2JA6 I;  4A93 I;  1Z02 A;  1USP B;  1YJ9 1;  1M1K 2;  2JA7 I;  1KQS Y;  3VTN A;  1ZH1 A;  3P5J B;  5D1O B;  5LL6 f;  4A3J I;  2BJO A;  3CME 1;  5FLX b;  1X3Z A;  2JR6 A;  3D6W A;  3H0G I;  1YI2 Z;  2PMZ A;  3CPW Y;  2R92 I;  3VB9 A;  3CCM 1;  1VQK Z;  1Z01 A;  3F3P C;  3NDI A;  3CCS Z;  2R7Z I;  2B63 I;  1Q82 1;  3G71 Z;  1YHQ Z;  3HOV I;  3IX0 A;  2I3C A;  3CCE 1;  1ZB9 A;  3CD6 1;  1TWC I;  2P3Y A;  4EWC A;  3IFU A;  3H3V J;  3M4O I;  2QEX Z;  4BY7 I;  5C4X I;  2K5R A;  2RPR A;  3I56 Z;  1SFO I;  3CMA 1;  4E2Z A;  3CC7 1;  1VQ7 Z;  3I55 Z;  3HOY I;  1VQ6 1;  1QVG Y;  3CCU Z;  2HU9 A;  2E2I I;  2JS4 A;  1NP6 A;  1JWH C;  1YJN Z;  3CCV 1;  3GTP I;  1TWG I;  3EED A;  3CPW Z;  1KD1 2;  5C3E I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...