2OOXB

Crystal structure of the adenylate sensor from amp-activated protein kinase complexed with amp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
93
structure length
93
Chain Sequence
SEQYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Crystal structures of the adenylate sensor from fission yeast AMP-activated protein kinase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 7
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ooxB01
2QR1B 2OOYB 2OOXB 2QLVB 2QRCB 3T4NB 3TDHB 2QREB 2QRDB 3TE5B
chains in the Genus database with same CATH superfamily
3CCQZ 3G4SZ 5D1OA 3S2DI 2LIYA 1S7MA 3HOWI 1YJ9Z 4MD7A 1YIT1 2QRCB 2Q4ZA 3I55Z 3BG0B 1N2FA 3G6EZ 2QRDB 1TWAI 4DQYB 1M1K1 1Q861 2V8IA 2ZAEB 3CCE1 5FLXb 5FLXf 4NBEA 3VTNA 3CME1 2IZ4A 3CCUZ 1NJI1 1QF8A 1Y8CA 1VQ91 1Q821 3CCQ1 1K8A1 1YIJZ 4HH4A 3FQQA 1TWCI 1LQLA 3J80f 3GTGI 1K83I 2G2KA 1RQFA 2KI7B 4MONA 1YUKA 2DE5A 1TWHI 3S1MI 3I551 3CCJZ 4A3JI 2OOYB 1KD11 1ZB8A 2F4OA 1NUIA 1VQLZ 2VPZA 2O4HA 3K7AI 1TFIA 4NH1C 4RVHA 4A3KI 3H0GI 2NAPA 1VQN1 4HGYA 2AKLA 3CPWZ 3VMGA 3RZOI 1VQ8Z 1USPA 1W2BZ 3S16I 5LL6f 1YJWZ 1RO0A 1KQSZ 1QYPA 3CCMZ 1QVFZ 5D1PA 4NFRA 3CC7Z 2HU9A 4NOZA 1VQL1 3I56Z 3J7A4 3PO3S 2E9HA 4NBAA 5FLMI 3CC41 2PMZA 3MZKB 4Y52I 1YITZ 1SIWA 2RHBA 2JIOA 4TNUA 3CXCY 1Q16A 2JIPA 3U50C 1VQ71 2Q51A 2QREB 3NFZA 1QXFA 2DE6A 2AYDA 1VQ81 1RLYA 4MD8A 2QR1B 3CCEZ 1YJW1 1K9M1 5IT9b 1KC81 2W04A 3CCM1 3GTPI 4QTTA 2E2HI 1Z01A 3S1RI 3CMEZ 4A3II 1VQ9Z 3IR7A 4NB9A 5T64A 3I561 1Q7Y2 1N8R1 1M902 1AA6A 5T6BA 3FQMA 2PK7A 4BBRI 3J81b 3HOZI 1WJ2A 1KRLA 3CCL1 3CQZI 3J81f 1ML8A 1NP6A 2M48A 5IP9I 3GTMS 5C4JI 1Q811 3ESWA 3JAMb 2IZ3A 4MRIA 4A3BI 2E2II 1JJ2Y 1VQNZ 1Y1VI 3NH5A 2VUMI 1K731 3NH8A 2VUGA 4E2XA 4RV9A 1VQ61 1DL6A 2K3RA 3GTLI 2JA5I 3GTOI 4EWCA 2GTHA 3IX0A 1FDOA 2QEX1 2NVYI 4DGLA 1ZH1A 1Z03A 4E2YA 3CC4Z 3MONA 1VQ41 3HKZA 3KIHA 4NBGA 1FDIA 4A3EI 3RZDI 4BY1I 4S1TA 4E2WA 1VQ7Z 2JIMA 5D1OB 4A3GI 2OTJ1 3G711 3GTKI 3CPWY 3BG1B 2E7ZA 4E33A 2P28A 5C4XI 1VLAA 2P3YA 4RVFA 2QKDA 3HOUI 2WAQA 1W2BY 1KQSY 2GU2A 4A3CI 1QVFY 4NBHA 4NBDA 2JA7I 3CD61 2V3VA 2JMOA 1YJNZ 3IF8A 3M3YI 3CCS1 1VQM1 4NB8A 3I07A 5CM2M 2OTL1 2VF1A 3CCV1 3S17I 1X0TA 1TWGI 1Z02A 5A2Qb 3OW2Z 4BY7I 5A2Qf 4E2ZA 5AN9F 3HOXI 3CCLZ 4RVDA 1P9NA 1Y1WI 1VQK1 1WZNA 2V8KA 3D2LA 3CMAZ 2NVQI 1X3WA 2NVTI 4RS4A 2H85A 2HF1A 5IT9f 2VPXA 2E2JI 1RNIA 1YJN1 2YU9I 3PO3I 1I3QI 1M1K2 1Q862 3EEDA 1QVGZ 2JIRA 1VQ6Z 3KIFA 1VQ51 2RBLA 1VQO1 2PM9A 1NJI2 4HGZA 3TE5B 2LEXA 2QEXZ 1PFTA 1Q822 3CCR1 2OOXB 4E30A 2J6AA 1K8A2 4AYBA 3CMA1 5IP7I 2LFUA 3LUSA 2RT9A 1VQ4Z 3I4NI 4E32A 2K5RA 3I4MI 3JAMf 2O53A 4CL1A 1TWFI 3Q87A 4NBCA 1I50I 2EGTA 1RO2A 5T67A 1S72Z 4NBBA 1KD12 3PO2I 2M6NA 1YI2Z 2OTJZ 2WB1A 3G71Z 2QLVB 4MH4A 1L1OC 1Q7Y1 3VMIA 3S14I 1I6HI 1M901 3GTJI 1JJ2Z 4MXUA 3D6WA 2Y0SA 3P5JB 3NDIA 1YHQ1 4A3FI 3GTMI 3CD6Z 4NBFA 1VQPZ 1YUAA 1SFOI 2R93I 1WIIA 2DE7A 3CCSZ 1VQMZ 2BJOA 2OTLZ 1WW9A 2QA4Z 3J80b 3CCVZ 3G4S1 2R7ZI 3MZLB 3FKII 4A3DI 2JUBA 3IFUA 4QTUA 1YJ91 2IV2X 3S2HI 2V45A 4MD9A 3F3PC 1S721 3S1NI 1YI21 1VQKZ 2V8JA 3G6E1 3HOYI 3EERA 4DK1A 4XX2A 1R9TI 2JA8I 3CC2Z 2KPIA 3CCU1 1VQP1 4X6AI 2F4MA 2W03A 2JR6A 2JS4A 3TDHB 2QA41 1YIJ1 1K9M2 1KC82 3HOVI 3T4NB 1VQ5Z 2R6MA 3QWUA 1VQOZ 4RVGA 4A3MI 2JIQA 2B63I 3OW2Y 4BXXI 3F3FC 3CCRZ 3CCJ1 2RPRA 2GTIA 2NVXI 1N8R2 2RIQA 3GCFA 3NH4A 4A93I 3VMHA 3H3VJ 1ZB9A 2I3CA 3M4OI 1X3ZA 2VPYA 2R92I 3CXCZ 5C3EI 3CC21 2VPWA 3S15I 4Y7NI 2JA6I 2JNYA 3GTQI 1Q812 1WCMI 2OZKA 4E31A 3S1QI 4BBSI 5C44I 1QVGY 3VB9A 3GKQA 1RO4A 3NDJA 1JWHC 4A3LI 1YHQZ 3D9XA 2YADA 3CC71 1USPB 1K732 1Y1VS
chains in the Genus database with same CATH topology
3CCQZ 3G4SZ 5D1OA 3S2DI 2LIYA 1S7MA 3HOWI 1YJ9Z 4MD7A 1YIT1 2QRCB 2Q4ZA 3I55Z 3BG0B 1N2FA 3G6EZ 2QRDB 1TWAI 4DQYB 1M1K1 1Q861 2V8IA 2ZAEB 3CCE1 5FLXb 5FLXf 4NBEA 3VTNA 3CME1 2IZ4A 3CCUZ 1NJI1 1QF8A 1VQ91 1Q821 3CCQ1 1K8A1 1YIJZ 4HH4A 3FQQA 1TWCI 1LQLA 3J80f 3GTGI 1K83I 2G2KA 1RQFA 2KI7B 4MONA 1YUKA 2DE5A 1TWHI 3S1MI 3I551 3CCJZ 4A3JI 2OOYB 1KD11 1ZB8A 2F4OA 1NUIA 1VQLZ 2O4HA 3K7AI 1TFIA 4NH1C 4RVHA 4A3KI 3H0GI 1VQN1 4HGYA 2AKLA 3CPWZ 3VMGA 3RZOI 1VQ8Z 1USPA 1W2BZ 3S16I 5LL6f 1YJWZ 1RO0A 1KQSZ 1QYPA 3CCMZ 1QVFZ 5D1PA 4NFRA 3CC7Z 2HU9A 4NOZA 1VQL1 3I56Z 3J7A4 3PO3S 2E9HA 4NBAA 5FLMI 3CC41 2PMZA 3MZKB 4Y52I 1YITZ 2RHBA 4TNUA 3CXCY 3U50C 1VQ71 2Q51A 2QREB 3NFZA 2DE6A 1VQ81 1RLYA 4MD8A 2QR1B 3CCEZ 1YJW1 1K9M1 5IT9b 1KC81 2W04A 3CCM1 3GTPI 4QTTA 2E2HI 1Z01A 3S1RI 3CMEZ 4A3II 1VQ9Z 4NB9A 5T64A 3I561 1Q7Y2 1N8R1 1M902 5T6BA 3FQMA 2PK7A 4BBRI 3J81b 3HOZI 1KRLA 3CCL1 3CQZI 3J81f 1ML8A 1NP6A 2M48A 5IP9I 3GTMS 5C4JI 1Q811 3ESWA 3JAMb 2IZ3A 4MRIA 4A3BI 2E2II 1JJ2Y 1VQNZ 1Y1VI 3NH5A 2VUMI 1K731 3NH8A 2VUGA 4E2XA 4RV9A 1VQ61 1DL6A 2K3RA 3GTLI 2JA5I 3GTOI 4EWCA 2GTHA 3IX0A 2QEX1 2NVYI 4DGLA 1ZH1A 1Z03A 4E2YA 3CC4Z 3MONA 1VQ41 3HKZA 3KIHA 4NBGA 4A3EI 3RZDI 4BY1I 4S1TA 4E2WA 1VQ7Z 5D1OB 4A3GI 2OTJ1 3G711 3GTKI 3CPWY 3BG1B 4E33A 2P28A 5C4XI 1VLAA 2P3YA 4RVFA 2QKDA 3HOUI 2WAQA 1W2BY 1KQSY 2GU2A 4A3CI 1QVFY 4NBHA 4NBDA 2JA7I 3CD61 2JMOA 1YJNZ 3IF8A 3M3YI 3CCS1 1VQM1 4NB8A 3I07A 5CM2M 2OTL1 2VF1A 3CCV1 3S17I 1X0TA 1TWGI 1Z02A 5A2Qb 3OW2Z 4BY7I 5A2Qf 4E2ZA 5AN9F 3HOXI 3CCLZ 4RVDA 1P9NA 1Y1WI 1VQK1 2V8KA 3CMAZ 2NVQI 1X3WA 2NVTI 4RS4A 2H85A 2HF1A 5IT9f 2E2JI 1RNIA 1YJN1 2YU9I 3PO3I 1I3QI 1M1K2 1Q862 3EEDA 1QVGZ 1VQ6Z 3KIFA 1VQ51 2RBLA 1VQO1 2PM9A 1NJI2 4HGZA 3TE5B 2QEXZ 1PFTA 1Q822 3CCR1 2OOXB 4E30A 2J6AA 1K8A2 4AYBA 3CMA1 5IP7I 2LFUA 3LUSA 2RT9A 1VQ4Z 3I4NI 4E32A 2K5RA 3I4MI 3JAMf 2O53A 4CL1A 1TWFI 3Q87A 4NBCA 1I50I 2EGTA 1RO2A 5T67A 1S72Z 4NBBA 1KD12 3PO2I 2M6NA 1YI2Z 2OTJZ 2WB1A 3G71Z 2QLVB 4MH4A 1L1OC 1Q7Y1 3VMIA 3S14I 1I6HI 1M901 3GTJI 1JJ2Z 4MXUA 3D6WA 2Y0SA 3P5JB 3NDIA 1YHQ1 4A3FI 3GTMI 3CD6Z 4NBFA 1VQPZ 1YUAA 1SFOI 2R93I 1WIIA 2DE7A 3CCSZ 1VQMZ 2BJOA 2OTLZ 1WW9A 2QA4Z 3J80b 3CCVZ 3G4S1 2R7ZI 3MZLB 3FKII 4A3DI 2JUBA 3IFUA 4QTUA 1YJ91 3S2HI 4MD9A 3F3PC 1S721 3S1NI 1YI21 1VQKZ 2V8JA 3G6E1 3HOYI 3EERA 4DK1A 4XX2A 1R9TI 2JA8I 3CC2Z 2KPIA 3CCU1 1VQP1 4X6AI 2F4MA 2W03A 2JR6A 2JS4A 3TDHB 2QA41 1YIJ1 1K9M2 1KC82 3HOVI 3T4NB 1VQ5Z 2R6MA 3QWUA 1VQOZ 4RVGA 4A3MI 2B63I 3OW2Y 4BXXI 3F3FC 3CCRZ 3CCJ1 2RPRA 2GTIA 2NVXI 1N8R2 2RIQA 3GCFA 3NH4A 4A93I 3VMHA 3H3VJ 1ZB9A 2I3CA 3M4OI 1X3ZA 2R92I 3CXCZ 5C3EI 3CC21 3S15I 4Y7NI 2JA6I 2JNYA 3GTQI 1Q812 1WCMI 2OZKA 4E31A 3S1QI 4BBSI 5C44I 1QVGY 3VB9A 3GKQA 1RO4A 3NDJA 1JWHC 4A3LI 1YHQZ 3D9XA 2YADA 3CC71 1USPB 1K732 1Y1VS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QR1 B;  2OOY B;  2OOX B;  2QLV B;  2QRC B;  3T4N B;  3TDH B;  2QRE B;  2QRD B;  3TE5 B; 
#chains in the Genus database with same CATH topology
 3CCQ Z;  3G4S Z;  5D1O A;  3S2D I;  2LIY A;  1S7M A;  3HOW I;  1YJ9 Z;  4MD7 A;  1YIT 1;  2QRC B;  2Q4Z A;  3I55 Z;  3BG0 B;  1N2F A;  3G6E Z;  2QRD B;  1TWA I;  4DQY B;  1M1K 1;  1Q86 1;  2V8I A;  2ZAE B;  3CCE 1;  5FLX b;  5FLX f;  4NBE A;  3VTN A;  3CME 1;  2IZ4 A;  3CCU Z;  1NJI 1;  1QF8 A;  1Y8C A;  1VQ9 1;  1Q82 1;  3CCQ 1;  1K8A 1;  1YIJ Z;  4HH4 A;  3FQQ A;  1TWC I;  1LQL A;  3J80 f;  3GTG I;  1K83 I;  2G2K A;  1RQF A;  2KI7 B;  4MON A;  1YUK A;  2DE5 A;  1TWH I;  3S1M I;  3I55 1;  3CCJ Z;  4A3J I;  2OOY B;  1KD1 1;  1ZB8 A;  2F4O A;  1NUI A;  1VQL Z;  2VPZ A;  2O4H A;  3K7A I;  1TFI A;  4NH1 C;  4RVH A;  4A3K I;  3H0G I;  2NAP A;  1VQN 1;  4HGY A;  2AKL A;  3CPW Z;  3VMG A;  3RZO I;  1VQ8 Z;  1USP A;  1W2B Z;  3S16 I;  5LL6 f;  1YJW Z;  1RO0 A;  1KQS Z;  1QYP A;  3CCM Z;  1QVF Z;  5D1P A;  4NFR A;  3CC7 Z;  2HU9 A;  4NOZ A;  1VQL 1;  3I56 Z;  3J7A 4;  3PO3 S;  2E9H A;  4NBA A;  5FLM I;  3CC4 1;  2PMZ A;  3MZK B;  4Y52 I;  1YIT Z;  1SIW A;  2RHB A;  2JIO A;  4TNU A;  3CXC Y;  1Q16 A;  2JIP A;  3U50 C;  1VQ7 1;  2Q51 A;  2QRE B;  3NFZ A;  1QXF A;  2DE6 A;  2AYD A;  1VQ8 1;  1RLY A;  4MD8 A;  2QR1 B;  3CCE Z;  1YJW 1;  1K9M 1;  5IT9 b;  1KC8 1;  2W04 A;  3CCM 1;  3GTP I;  4QTT A;  2E2H I;  1Z01 A;  3S1R I;  3CME Z;  4A3I I;  1VQ9 Z;  3IR7 A;  4NB9 A;  5T64 A;  3I56 1;  1Q7Y 2;  1N8R 1;  1M90 2;  1AA6 A;  5T6B A;  3FQM A;  2PK7 A;  4BBR I;  3J81 b;  3HOZ I;  1WJ2 A;  1KRL A;  3CCL 1;  3CQZ I;  3J81 f;  1ML8 A;  1NP6 A;  2M48 A;  5IP9 I;  3GTM S;  5C4J I;  1Q81 1;  3ESW A;  3JAM b;  2IZ3 A;  4MRI A;  4A3B I;  2E2I I;  1JJ2 Y;  1VQN Z;  1Y1V I;  3NH5 A;  2VUM I;  1K73 1;  3NH8 A;  2VUG A;  4E2X A;  4RV9 A;  1VQ6 1;  1DL6 A;  2K3R A;  3GTL I;  2JA5 I;  3GTO I;  4EWC A;  2GTH A;  3IX0 A;  1FDO A;  2QEX 1;  2NVY I;  4DGL A;  1ZH1 A;  1Z03 A;  4E2Y A;  3CC4 Z;  3MON A;  1VQ4 1;  3HKZ A;  3KIH A;  4NBG A;  1FDI A;  4A3E I;  3RZD I;  4BY1 I;  4S1T A;  4E2W A;  1VQ7 Z;  2JIM A;  5D1O B;  4A3G I;  2OTJ 1;  3G71 1;  3GTK I;  3CPW Y;  3BG1 B;  2E7Z A;  4E33 A;  2P28 A;  5C4X I;  1VLA A;  2P3Y A;  4RVF A;  2QKD A;  3HOU I;  2WAQ A;  1W2B Y;  1KQS Y;  2GU2 A;  4A3C I;  1QVF Y;  4NBH A;  4NBD A;  2JA7 I;  3CD6 1;  2V3V A;  2JMO A;  1YJN Z;  3IF8 A;  3M3Y I;  3CCS 1;  1VQM 1;  4NB8 A;  3I07 A;  5CM2 M;  2OTL 1;  2VF1 A;  3CCV 1;  3S17 I;  1X0T A;  1TWG I;  1Z02 A;  5A2Q b;  3OW2 Z;  4BY7 I;  5A2Q f;  4E2Z A;  5AN9 F;  3HOX I;  3CCL Z;  4RVD A;  1P9N A;  1Y1W I;  1VQK 1;  1WZN A;  2V8K A;  3D2L A;  3CMA Z;  2NVQ I;  1X3W A;  2NVT I;  4RS4 A;  2H85 A;  2HF1 A;  5IT9 f;  2VPX A;  2E2J I;  1RNI A;  1YJN 1;  2YU9 I;  3PO3 I;  1I3Q I;  1M1K 2;  1Q86 2;  3EED A;  1QVG Z;  2JIR A;  1VQ6 Z;  3KIF A;  1VQ5 1;  2RBL A;  1VQO 1;  2PM9 A;  1NJI 2;  4HGZ A;  3TE5 B;  2LEX A;  2QEX Z;  1PFT A;  1Q82 2;  3CCR 1;  2OOX B;  4E30 A;  2J6A A;  1K8A 2;  4AYB A;  3CMA 1;  5IP7 I;  2LFU A;  3LUS A;  2RT9 A;  1VQ4 Z;  3I4N I;  4E32 A;  2K5R A;  3I4M I;  3JAM f;  2O53 A;  4CL1 A;  1TWF I;  3Q87 A;  4NBC A;  1I50 I;  2EGT A;  1RO2 A;  5T67 A;  1S72 Z;  4NBB A;  1KD1 2;  3PO2 I;  2M6N A;  1YI2 Z;  2OTJ Z;  2WB1 A;  3G71 Z;  2QLV B;  4MH4 A;  1L1O C;  1Q7Y 1;  3VMI A;  3S14 I;  1I6H I;  1M90 1;  3GTJ I;  1JJ2 Z;  4MXU A;  3D6W A;  2Y0S A;  3P5J B;  3NDI A;  1YHQ 1;  4A3F I;  3GTM I;  3CD6 Z;  4NBF A;  1VQP Z;  1YUA A;  1SFO I;  2R93 I;  1WII A;  2DE7 A;  3CCS Z;  1VQM Z;  2BJO A;  2OTL Z;  1WW9 A;  2QA4 Z;  3J80 b;  3CCV Z;  3G4S 1;  2R7Z I;  3MZL B;  3FKI I;  4A3D I;  2JUB A;  3IFU A;  4QTU A;  1YJ9 1;  2IV2 X;  3S2H I;  2V45 A;  4MD9 A;  3F3P C;  1S72 1;  3S1N I;  1YI2 1;  1VQK Z;  2V8J A;  3G6E 1;  3HOY I;  3EER A;  4DK1 A;  4XX2 A;  1R9T I;  2JA8 I;  3CC2 Z;  2KPI A;  3CCU 1;  1VQP 1;  4X6A I;  2F4M A;  2W03 A;  2JR6 A;  2JS4 A;  3TDH B;  2QA4 1;  1YIJ 1;  1K9M 2;  1KC8 2;  3HOV I;  3T4N B;  1VQ5 Z;  2R6M A;  3QWU A;  1VQO Z;  4RVG A;  4A3M I;  2JIQ A;  2B63 I;  3OW2 Y;  4BXX I;  3F3F C;  3CCR Z;  3CCJ 1;  2RPR A;  2GTI A;  2NVX I;  1N8R 2;  2RIQ A;  3GCF A;  3NH4 A;  4A93 I;  3VMH A;  3H3V J;  1ZB9 A;  2I3C A;  3M4O I;  1X3Z A;  2VPY A;  2R92 I;  3CXC Z;  5C3E I;  3CC2 1;  2VPW A;  3S15 I;  4Y7N I;  2JA6 I;  2JNY A;  3GTQ I;  1Q81 2;  1WCM I;  2OZK A;  4E31 A;  3S1Q I;  4BBS I;  5C44 I;  1QVG Y;  3VB9 A;  3GKQ A;  1RO4 A;  3NDJ A;  1JWH C;  4A3L I;  1YHQ Z;  3D9X A;  2YAD A;  3CC7 1;  1USP B;  1K73 2;  1Y1V S; 
#chains in the Genus database with same CATH homology
 3CCQ Z;  3G4S Z;  5D1O A;  3S2D I;  2LIY A;  1S7M A;  3HOW I;  1YJ9 Z;  4MD7 A;  1YIT 1;  2QRC B;  2Q4Z A;  3I55 Z;  3BG0 B;  1N2F A;  3G6E Z;  2QRD B;  1TWA I;  4DQY B;  1M1K 1;  1Q86 1;  2V8I A;  2ZAE B;  3CCE 1;  5FLX b;  5FLX f;  4NBE A;  3VTN A;  3CME 1;  2IZ4 A;  3CCU Z;  1NJI 1;  1QF8 A;  1VQ9 1;  1Q82 1;  3CCQ 1;  1K8A 1;  1YIJ Z;  4HH4 A;  3FQQ A;  1TWC I;  1LQL A;  3J80 f;  3GTG I;  1K83 I;  2G2K A;  1RQF A;  2KI7 B;  4MON A;  1YUK A;  2DE5 A;  1TWH I;  3S1M I;  3I55 1;  3CCJ Z;  4A3J I;  2OOY B;  1KD1 1;  1ZB8 A;  2F4O A;  1NUI A;  1VQL Z;  2O4H A;  3K7A I;  1TFI A;  4NH1 C;  4RVH A;  4A3K I;  3H0G I;  1VQN 1;  4HGY A;  2AKL A;  3CPW Z;  3VMG A;  3RZO I;  1VQ8 Z;  1USP A;  1W2B Z;  3S16 I;  5LL6 f;  1YJW Z;  1RO0 A;  1KQS Z;  1QYP A;  3CCM Z;  1QVF Z;  5D1P A;  4NFR A;  3CC7 Z;  2HU9 A;  4NOZ A;  1VQL 1;  3I56 Z;  3J7A 4;  3PO3 S;  2E9H A;  4NBA A;  5FLM I;  3CC4 1;  2PMZ A;  3MZK B;  4Y52 I;  1YIT Z;  2RHB A;  4TNU A;  3CXC Y;  3U50 C;  1VQ7 1;  2Q51 A;  2QRE B;  3NFZ A;  2DE6 A;  1VQ8 1;  1RLY A;  4MD8 A;  2QR1 B;  3CCE Z;  1YJW 1;  1K9M 1;  5IT9 b;  1KC8 1;  2W04 A;  3CCM 1;  3GTP I;  4QTT A;  2E2H I;  1Z01 A;  3S1R I;  3CME Z;  4A3I I;  1VQ9 Z;  4NB9 A;  5T64 A;  3I56 1;  1Q7Y 2;  1N8R 1;  1M90 2;  5T6B A;  3FQM A;  2PK7 A;  4BBR I;  3J81 b;  3HOZ I;  1KRL A;  3CCL 1;  3CQZ I;  3J81 f;  1ML8 A;  1NP6 A;  2M48 A;  5IP9 I;  3GTM S;  5C4J I;  1Q81 1;  3ESW A;  3JAM b;  2IZ3 A;  4MRI A;  4A3B I;  2E2I I;  1JJ2 Y;  1VQN Z;  1Y1V I;  3NH5 A;  2VUM I;  1K73 1;  3NH8 A;  2VUG A;  4E2X A;  4RV9 A;  1VQ6 1;  1DL6 A;  2K3R A;  3GTL I;  2JA5 I;  3GTO I;  4EWC A;  2GTH A;  3IX0 A;  2QEX 1;  2NVY I;  4DGL A;  1ZH1 A;  1Z03 A;  4E2Y A;  3CC4 Z;  3MON A;  1VQ4 1;  3HKZ A;  3KIH A;  4NBG A;  4A3E I;  3RZD I;  4BY1 I;  4S1T A;  4E2W A;  1VQ7 Z;  5D1O B;  4A3G I;  2OTJ 1;  3G71 1;  3GTK I;  3CPW Y;  3BG1 B;  4E33 A;  2P28 A;  5C4X I;  1VLA A;  2P3Y A;  4RVF A;  2QKD A;  3HOU I;  2WAQ A;  1W2B Y;  1KQS Y;  2GU2 A;  4A3C I;  1QVF Y;  4NBH A;  4NBD A;  2JA7 I;  3CD6 1;  2JMO A;  1YJN Z;  3IF8 A;  3M3Y I;  3CCS 1;  1VQM 1;  4NB8 A;  3I07 A;  5CM2 M;  2OTL 1;  2VF1 A;  3CCV 1;  3S17 I;  1X0T A;  1TWG I;  1Z02 A;  5A2Q b;  3OW2 Z;  4BY7 I;  5A2Q f;  4E2Z A;  5AN9 F;  3HOX I;  3CCL Z;  4RVD A;  1P9N A;  1Y1W I;  1VQK 1;  2V8K A;  3CMA Z;  2NVQ I;  1X3W A;  2NVT I;  4RS4 A;  2H85 A;  2HF1 A;  5IT9 f;  2E2J I;  1RNI A;  1YJN 1;  2YU9 I;  3PO3 I;  1I3Q I;  1M1K 2;  1Q86 2;  3EED A;  1QVG Z;  1VQ6 Z;  3KIF A;  1VQ5 1;  2RBL A;  1VQO 1;  2PM9 A;  1NJI 2;  4HGZ A;  3TE5 B;  2QEX Z;  1PFT A;  1Q82 2;  3CCR 1;  2OOX B;  4E30 A;  2J6A A;  1K8A 2;  4AYB A;  3CMA 1;  5IP7 I;  2LFU A;  3LUS A;  2RT9 A;  1VQ4 Z;  3I4N I;  4E32 A;  2K5R A;  3I4M I;  3JAM f;  2O53 A;  4CL1 A;  1TWF I;  3Q87 A;  4NBC A;  1I50 I;  2EGT A;  1RO2 A;  5T67 A;  1S72 Z;  4NBB A;  1KD1 2;  3PO2 I;  2M6N A;  1YI2 Z;  2OTJ Z;  2WB1 A;  3G71 Z;  2QLV B;  4MH4 A;  1L1O C;  1Q7Y 1;  3VMI A;  3S14 I;  1I6H I;  1M90 1;  3GTJ I;  1JJ2 Z;  4MXU A;  3D6W A;  2Y0S A;  3P5J B;  3NDI A;  1YHQ 1;  4A3F I;  3GTM I;  3CD6 Z;  4NBF A;  1VQP Z;  1YUA A;  1SFO I;  2R93 I;  1WII A;  2DE7 A;  3CCS Z;  1VQM Z;  2BJO A;  2OTL Z;  1WW9 A;  2QA4 Z;  3J80 b;  3CCV Z;  3G4S 1;  2R7Z I;  3MZL B;  3FKI I;  4A3D I;  2JUB A;  3IFU A;  4QTU A;  1YJ9 1;  3S2H I;  4MD9 A;  3F3P C;  1S72 1;  3S1N I;  1YI2 1;  1VQK Z;  2V8J A;  3G6E 1;  3HOY I;  3EER A;  4DK1 A;  4XX2 A;  1R9T I;  2JA8 I;  3CC2 Z;  2KPI A;  3CCU 1;  1VQP 1;  4X6A I;  2F4M A;  2W03 A;  2JR6 A;  2JS4 A;  3TDH B;  2QA4 1;  1YIJ 1;  1K9M 2;  1KC8 2;  3HOV I;  3T4N B;  1VQ5 Z;  2R6M A;  3QWU A;  1VQO Z;  4RVG A;  4A3M I;  2B63 I;  3OW2 Y;  4BXX I;  3F3F C;  3CCR Z;  3CCJ 1;  2RPR A;  2GTI A;  2NVX I;  1N8R 2;  2RIQ A;  3GCF A;  3NH4 A;  4A93 I;  3VMH A;  3H3V J;  1ZB9 A;  2I3C A;  3M4O I;  1X3Z A;  2R92 I;  3CXC Z;  5C3E I;  3CC2 1;  3S15 I;  4Y7N I;  2JA6 I;  2JNY A;  3GTQ I;  1Q81 2;  1WCM I;  2OZK A;  4E31 A;  3S1Q I;  4BBS I;  5C44 I;  1QVG Y;  3VB9 A;  3GKQ A;  1RO4 A;  3NDJ A;  1JWH C;  4A3L I;  1YHQ Z;  3D9X A;  2YAD A;  3CC7 1;  1USP B;  1K73 2;  1Y1V S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...