4A3GI

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3gI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3gI02
4A3II 4A3GI 5C44I 1K83I 1I6HI 1TWGI 1X3WA 2F4MA 3RZDI 1VLAA 3ESWA 3VB9A 3S1NI 3HOUI 1L1OC 3S1RI 2KPIA 1WW9A 3U50C 3HOWI 4BXXI 3PO2I 3M4OI 4NOZA 1TWAI 3S14I 3Q87A 3GTMS 3S16I 1TFIA 2JA8I 2AKLA 1Y1VI 1USPA 4NBHA 3VMIA 5C4JI 2DE7A 2J6AA 1DL6A 4NBCA 3PO3S 3VMHA 1R9TI 1WCMI 3CQZI 3S2DI 4X6AI 4A3JI 4NBFA 5FLMI 4NB9A 1I50I 4A3FI 4NB8A 3S2HI 2JA6I 4A3KI 3I07A 4NBBA 1PFTA 2DE6A 1TWFI 4BBRI 2B63I 3GTKI 3GTPI 2R7ZI 1ZB8A 2NVQI 1ML8A 4XX2A 2JA7I 3M3YI 5C3EI 1TWHI 3FKII 2RBLA 4NBEA 2HF1A 3D6WA 3VMGA 2E2II 3H3VJ 3HOVI 3S1MI 3EERA 3LUSA 4A93I 4MH4A 4BY1I 3K7AI 2K5RA 4A3MI 1QYPA 2NVYI 2F4OA 1N2FA 1Y1VS 3GTLI 3GTQI 4QTTA 3GKQA 3S15I 4NBGA 2JS4A 4BBSI 2VUMI 2E2HI 2R93I 2JR6A 3I4NI 4NBDA 2BJOA 5IP9I 2R92I 1NUIA 4NBAA 3I4MI 2JNYA 2JA5I 1RLYA 2P3YA 3GTMI 4Y7NI 3RZOI 2NVXI 1ZB9A 4A3CI 1Y1WI 2DE5A 4QTUA 1X3ZA 3GTJI 5IP7I 5C4XI 5CM2M 1LQLA 4A3BI 3S17I 3H0GI 1USPB 4Y52I 2YU9I 3PO3I 3HOYI 3GTGI 3S1QI 1TWCI 2PK7A 1YUAA 4BY7I 3HOZI 1SFOI 1RO4A 2NVTI 4A3LI 3HOXI 1I3QI 4A3DI 3GTOI 2E2JI 3GCFA 4A3EI
chains in the Genus database with same CATH superfamily
5D1PA 3CD61 1N8R1 1VQKZ 3S1NI 1VQ51 1KC82 1NJI2 4DK1A 2O53A 1WW9A 1S7MA 4NOZA 1TWAI 3Q87A 1WZNA 1VQK1 1Y1VI 4NBHA 3CCR1 2R6MA 1YUKA 4NFRA 4RVFA 3F3FC 3NH4A 1WCMI 1ZH1A 3S2DI 1VQOZ 1RO2A 4MD9A 4E2ZA 4E32A 5IT9b 1K9M1 3CMAZ 3CPWY 3S2HI 2JA6I 2V3VA 2VPZA 4NBBA 3GTKI 1TWFI 2OZKA 4BBRI 3GTPI 2R7ZI 1VQO1 2AYDA 1KRLA 2GTHA 2RHBA 3I55Z 3FQQA 3D6WA 4NBEA 1YI2Z 3CMA1 2E2II 1W2BY 4RS4A 3CCVZ 2JIRA 3OW2Y 3CCMZ 3CMEZ 3NDJA 2JIMA 3G71Z 2K5RA 1QVFZ 3I551 1QYPA 1YI21 2F4OA 1QVGY 3CCV1 2V8KA 3CME1 3GTQI 3G711 1M901 2JS4A 4BBSI 2VF1A 2OOYB 2JR6A 3I4NI 2V8JA 5IP9I 3I4MI 2JNYA 3GTMI 1M1K2 4A3BI 4RVGA 1VQ8Z 4Y52I 1Q861 1JJ2Z 3HOYI 3GTGI 1S72Z 1TWCI 1YITZ 2NVTI 2VPYA 1VQ81 1KQSY 3GTOI 2E2JI 4E2WA 5FLXf 1Z01A 1S721 1K83I 1Q7Y2 1RNIA 3VTNA 1VQPZ 1YIT1 3RZDI 1YJN1 3J81f 2V45A 3J7A4 4RVHA 2LEXA 1Q16A 3U50C 1K731 4BXXI 1QF8A 1VQP1 3CC21 1SIWA 5FLXb 2ZAEB 1TFIA 1KD12 2JUBA 5C4JI 3CXCZ 2DE7A 1RQFA 4NBCA 3J81b 1FDOA 1VQ61 3VMHA 3PO3S 2RT9A 4X6AI 4A3JI 1P9NA 2IZ4A 4E30A 2OTJZ 1Q812 2LFUA 4A3KI 2B63I 1Z03A 2VPXA 2NVQI 3IF8A 1ML8A 1TWHI 2HF1A 3VMGA 3BG0B 3H3VJ 4A93I 3EERA 3LUSA 1VQ4Z 4MH4A 5LL6f 3IFUA 4BY1I 1N8R2 5A2Qf 1Y8CA 4A3MI 1K8A1 2H85A 2PM9A 3MZLB 2QA4Z 3CCJZ 1N2FA 4HGZA 1VQ41 2JIOA 1QVFY 3F3PC 2JMOA 3GTLI 3FQMA 5D1OB 2QA41 4DGLA 2E2HI 3NDIA 4RVDA 3CCLZ 2Q51A 4NBDA 2BJOA 3J80f 2R92I 1K9M2 2V8IA 3RZOI 4A3CI 3GTJI 5IP7I 5C4XI 5CM2M 2HU9A 1LQLA 3CCM1 1USPB 2G2KA 3MZKB 1VQNZ 1FDIA 1VQ7Z 1YUAA 2K3RA 3G6EZ 1YJ9Z 1SFOI 1RO4A 1I3QI 2M6NA 1VQN1 4A3EI 4A3II 5C44I 1VQ71 2QRCB 3G6E1 1I6HI 1AA6A 1TWGI 1X3WA 1M902 1VLAA 3IR7A 3ESWA 3VB9A 3HOUI 1L1OC 1RO0A 2KPIA 2Q4ZA 3S1RI 5AN9F 2GTIA 3M4OI 3OW2Z 4E31A 1VQMZ 1Q821 2JA8I 2J6AA 3KIFA 1VQM1 2IV2X 1Q862 1VQ9Z 5FLMI 2WB1A 4NB9A 5T64A 3IX0A 2OTLZ 3I07A 4HGYA 3HKZA 1PFTA 2JIPA 3NFZA 3FKII 3MONA 2I3CA 2PMZA 2RBLA 1VQ91 1WIIA 2QKDA 2OOXB 2OTL1 3CCSZ 3S1MI 5T6BA 3P5JB 1KD11 4AYBA 4MONA 4EWCA 2W03A 2M48A 1Y1VS 3TDHB 3CCS1 2QRDB 3GKQA 2VUMI 1Q811 1KC81 1NJI1 2OTJ1 2QLVB 3D2LA 4E2YA 1NUIA 1YJWZ 2LIYA 1RLYA 2KI7B 2P3YA 2VUGA 3CCEZ 4Y7NI 3QWUA 1ZB9A 2DE5A 2NAPA 3CC7Z 1X3ZA 2RPRA 3D9XA 3CCRZ 3EEDA 1YJW1 3PO3I 3CCE1 5IT9f 3CC71 4BY7I 5A2Qb 3CCJ1 5D1OA 3JAMf 4A3LI 3HOXI 1K8A2 2QR1B 2P28A 3GCFA 2IZ3A 4A3GI 5T67A 2YADA 2W04A 2F4MA 2QEXZ 2O4HA 3CCL1 3JAMb 3HOWI 2QREB 3PO2I 3S14I 3NH5A 3J80b 3GTMS 3S16I 2QEX1 2AKLA 1USPA 3VMIA 3CC4Z 1JJ2Y 3CCUZ 1DL6A 1R9TI 3CQZI 4S1TA 3CPWZ 1YJ91 4NBFA 4MRIA 3CC41 1WJ2A 1I50I 3CCU1 4A3FI 4NB8A 1M1K1 3CCQZ 2DE6A 1ZB8A 1W2BZ 4XX2A 2JA7I 1X0TA 5C3EI 3M3YI 3NH8A 2WAQA 3HOVI 3CCQ1 2E7ZA 3K7AI 1QVGZ 2E9HA 3CXCY 4MD7A 3BG1B 2NVYI 4NH1C 4CL1A 1VQLZ 1Q822 1Q7Y1 2GU2A 2Y0SA 4QTTA 4DQYB 3S15I 4MXUA 4NBGA 1VQL1 3TE5B 3T4NB 2R93I 1YJNZ 4E33A 4MD8A 1YIJZ 3G4SZ 4NBAA 3KIHA 2RIQA 2JA5I 1QXFA 3CC2Z 2NVXI 1YHQZ 1Y1WI 4QTUA 1YIJ1 1K732 3G4S1 4TNUA 3I56Z 3S17I 3H0GI 4E2XA 2YU9I 4HH4A 1VQ6Z 1YHQ1 3S1QI 1KQSZ 2PK7A 1NP6A 2VPWA 3CD6Z 4RV9A 3HOZI 2JIQA 1Z02A 3I561 4A3DI 2EGTA 1VQ5Z 1JWHC
chains in the Genus database with same CATH topology
5D1PA 3CD61 1N8R1 1VQKZ 3S1NI 1VQ51 1KC82 1NJI2 4DK1A 2O53A 1WW9A 1S7MA 4NOZA 1TWAI 3Q87A 1VQK1 1Y1VI 4NBHA 3CCR1 2R6MA 1YUKA 4NFRA 4RVFA 3F3FC 3NH4A 1WCMI 1ZH1A 3S2DI 1VQOZ 1RO2A 4MD9A 4E2ZA 4E32A 5IT9b 1K9M1 3CMAZ 3CPWY 3S2HI 2JA6I 4NBBA 3GTKI 1TWFI 2OZKA 4BBRI 3GTPI 2R7ZI 1VQO1 1KRLA 2GTHA 2RHBA 3I55Z 3FQQA 3D6WA 4NBEA 1YI2Z 3CMA1 2E2II 1W2BY 4RS4A 3CCVZ 3OW2Y 3CCMZ 3CMEZ 3NDJA 3G71Z 2K5RA 1QVFZ 3I551 1QYPA 1YI21 2F4OA 1QVGY 3CCV1 2V8KA 3CME1 3GTQI 3G711 1M901 2JS4A 4BBSI 2VF1A 2OOYB 2JR6A 3I4NI 2V8JA 5IP9I 3I4MI 2JNYA 3GTMI 1M1K2 4A3BI 4RVGA 1VQ8Z 4Y52I 1Q861 1JJ2Z 3HOYI 3GTGI 1S72Z 1TWCI 1YITZ 2NVTI 1VQ81 1KQSY 3GTOI 2E2JI 4E2WA 5FLXf 1Z01A 1S721 1K83I 1Q7Y2 1RNIA 3VTNA 1VQPZ 1YIT1 3RZDI 1YJN1 3J81f 3J7A4 4RVHA 3U50C 1K731 4BXXI 1QF8A 1VQP1 3CC21 5FLXb 2ZAEB 1TFIA 1KD12 2JUBA 5C4JI 3CXCZ 2DE7A 1RQFA 4NBCA 3J81b 1VQ61 3PO3S 3VMHA 2RT9A 4X6AI 4A3JI 1P9NA 2IZ4A 4E30A 2OTJZ 1Q812 2LFUA 4A3KI 2B63I 1Z03A 2NVQI 3IF8A 1ML8A 1TWHI 2HF1A 3VMGA 3BG0B 3H3VJ 4A93I 3EERA 3LUSA 1VQ4Z 4MH4A 5LL6f 3IFUA 4BY1I 1N8R2 5A2Qf 4A3MI 1K8A1 2H85A 2PM9A 3MZLB 2QA4Z 3CCJZ 1N2FA 4HGZA 1VQ41 1QVFY 3F3PC 2JMOA 3GTLI 3FQMA 5D1OB 2QA41 4DGLA 2E2HI 3NDIA 4RVDA 3CCLZ 2Q51A 4NBDA 2BJOA 3J80f 2R92I 1K9M2 2V8IA 3RZOI 4A3CI 3GTJI 5IP7I 5C4XI 5CM2M 2HU9A 1LQLA 3CCM1 1USPB 2G2KA 3MZKB 1VQNZ 1VQ7Z 1YUAA 2K3RA 3G6EZ 1YJ9Z 1SFOI 1RO4A 1I3QI 2M6NA 1VQN1 4A3EI 4A3II 5C44I 1VQ71 2QRCB 3G6E1 1I6HI 1TWGI 1X3WA 1M902 1VLAA 3ESWA 3VB9A 3HOUI 3S1RI 1L1OC 1RO0A 2KPIA 2Q4ZA 5AN9F 2GTIA 3M4OI 3OW2Z 4E31A 1VQMZ 1Q821 2JA8I 2J6AA 3KIFA 1VQM1 1Q862 1VQ9Z 5FLMI 2WB1A 4NB9A 5T64A 3IX0A 2OTLZ 3I07A 4HGYA 3HKZA 1PFTA 3NFZA 3FKII 3MONA 2I3CA 2PMZA 2RBLA 1VQ91 1WIIA 2QKDA 2OOXB 2OTL1 3CCSZ 3S1MI 5T6BA 3P5JB 1KD11 4AYBA 4MONA 4EWCA 2W03A 2M48A 1Y1VS 3TDHB 3CCS1 2QRDB 3GKQA 2VUMI 1Q811 1KC81 1NJI1 2OTJ1 2QLVB 4E2YA 1NUIA 1YJWZ 2LIYA 1RLYA 2KI7B 2P3YA 2VUGA 3CCEZ 4Y7NI 3QWUA 1ZB9A 2DE5A 3CC7Z 1X3ZA 2RPRA 3D9XA 3CCRZ 3EEDA 1YJW1 3PO3I 3CCE1 5IT9f 3CC71 4BY7I 5A2Qb 3CCJ1 5D1OA 3JAMf 4A3LI 3HOXI 1K8A2 2QR1B 2P28A 3GCFA 2IZ3A 4A3GI 5T67A 2YADA 2W04A 2F4MA 2QEXZ 2O4HA 3CCL1 3JAMb 3HOWI 2QREB 3PO2I 3S14I 3NH5A 3J80b 3GTMS 3S16I 2QEX1 2AKLA 1USPA 3VMIA 3CC4Z 1JJ2Y 3CCUZ 1DL6A 1R9TI 3CQZI 4S1TA 3CPWZ 1YJ91 4NBFA 4MRIA 3CC41 1I50I 3CCU1 4A3FI 4NB8A 1M1K1 3CCQZ 2DE6A 1ZB8A 1W2BZ 4XX2A 2JA7I 1X0TA 5C3EI 3M3YI 3NH8A 2WAQA 3HOVI 3CCQ1 3K7AI 1QVGZ 2E9HA 3CXCY 4MD7A 3BG1B 2NVYI 4NH1C 4CL1A 1VQLZ 1Q822 1Q7Y1 2GU2A 2Y0SA 4QTTA 4DQYB 3S15I 4MXUA 4NBGA 1VQL1 3TE5B 3T4NB 2R93I 1YJNZ 4E33A 4MD8A 1YIJZ 3G4SZ 4NBAA 3KIHA 2RIQA 2JA5I 3CC2Z 2NVXI 1YHQZ 1Y1WI 4QTUA 1YIJ1 1K732 3G4S1 4TNUA 3I56Z 3S17I 3H0GI 4E2XA 2YU9I 4HH4A 1VQ6Z 1YHQ1 3S1QI 1KQSZ 2PK7A 1NP6A 3CD6Z 4RV9A 3HOZI 1Z02A 3I561 4A3DI 2EGTA 1VQ5Z 1JWHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I I;  4A3G I;  5C44 I;  1K83 I;  1I6H I;  1TWG I;  1X3W A;  2F4M A;  3RZD I;  1VLA A;  3ESW A;  3VB9 A;  3S1N I;  3HOU I;  1L1O C;  3S1R I;  2KPI A;  1WW9 A;  3U50 C;  3HOW I;  4BXX I;  3PO2 I;  3M4O I;  4NOZ A;  1TWA I;  3S14 I;  3Q87 A;  3GTM S;  3S16 I;  1TFI A;  2JA8 I;  2AKL A;  1Y1V I;  1USP A;  4NBH A;  3VMI A;  5C4J I;  2DE7 A;  2J6A A;  1DL6 A;  4NBC A;  3PO3 S;  3VMH A;  1R9T I;  1WCM I;  3CQZ I;  3S2D I;  4X6A I;  4A3J I;  4NBF A;  5FLM I;  4NB9 A;  1I50 I;  4A3F I;  4NB8 A;  3S2H I;  2JA6 I;  4A3K I;  3I07 A;  4NBB A;  1PFT A;  2DE6 A;  1TWF I;  4BBR I;  2B63 I;  3GTK I;  3GTP I;  2R7Z I;  1ZB8 A;  2NVQ I;  1ML8 A;  4XX2 A;  2JA7 I;  3M3Y I;  5C3E I;  1TWH I;  3FKI I;  2RBL A;  4NBE A;  2HF1 A;  3D6W A;  3VMG A;  2E2I I;  3H3V J;  3HOV I;  3S1M I;  3EER A;  3LUS A;  4A93 I;  4MH4 A;  4BY1 I;  3K7A I;  2K5R A;  4A3M I;  1QYP A;  2NVY I;  2F4O A;  1N2F A;  1Y1V S;  3GTL I;  3GTQ I;  4QTT A;  3GKQ A;  3S15 I;  4NBG A;  2JS4 A;  4BBS I;  2VUM I;  2E2H I;  2R93 I;  2JR6 A;  3I4N I;  4NBD A;  2BJO A;  5IP9 I;  2R92 I;  1NUI A;  4NBA A;  3I4M I;  2JNY A;  2JA5 I;  1RLY A;  2P3Y A;  3GTM I;  4Y7N I;  3RZO I;  2NVX I;  1ZB9 A;  4A3C I;  1Y1W I;  2DE5 A;  4QTU A;  1X3Z A;  3GTJ I;  5IP7 I;  5C4X I;  5CM2 M;  1LQL A;  4A3B I;  3S17 I;  3H0G I;  1USP B;  4Y52 I;  2YU9 I;  3PO3 I;  3HOY I;  3GTG I;  3S1Q I;  1TWC I;  2PK7 A;  1YUA A;  4BY7 I;  3HOZ I;  1SFO I;  1RO4 A;  2NVT I;  4A3L I;  3HOX I;  1I3Q I;  4A3D I;  3GTO I;  2E2J I;  3GCF A;  4A3E I; 
#chains in the Genus database with same CATH topology
 5D1P A;  3CD6 1;  1N8R 1;  1VQK Z;  3S1N I;  1VQ5 1;  1KC8 2;  1NJI 2;  4DK1 A;  2O53 A;  1WW9 A;  1S7M A;  4NOZ A;  1TWA I;  3Q87 A;  1WZN A;  1VQK 1;  1Y1V I;  4NBH A;  3CCR 1;  2R6M A;  1YUK A;  4NFR A;  4RVF A;  3F3F C;  3NH4 A;  1WCM I;  1ZH1 A;  3S2D I;  1VQO Z;  1RO2 A;  4MD9 A;  4E2Z A;  4E32 A;  5IT9 b;  1K9M 1;  3CMA Z;  3CPW Y;  3S2H I;  2JA6 I;  2V3V A;  2VPZ A;  4NBB A;  3GTK I;  1TWF I;  2OZK A;  4BBR I;  3GTP I;  2R7Z I;  1VQO 1;  2AYD A;  1KRL A;  2GTH A;  2RHB A;  3I55 Z;  3FQQ A;  3D6W A;  4NBE A;  1YI2 Z;  3CMA 1;  2E2I I;  1W2B Y;  4RS4 A;  3CCV Z;  2JIR A;  3OW2 Y;  3CCM Z;  3CME Z;  3NDJ A;  2JIM A;  3G71 Z;  2K5R A;  1QVF Z;  3I55 1;  1QYP A;  1YI2 1;  2F4O A;  1QVG Y;  3CCV 1;  2V8K A;  3CME 1;  3GTQ I;  3G71 1;  1M90 1;  2JS4 A;  4BBS I;  2VF1 A;  2OOY B;  2JR6 A;  3I4N I;  2V8J A;  5IP9 I;  3I4M I;  2JNY A;  3GTM I;  1M1K 2;  4A3B I;  4RVG A;  1VQ8 Z;  4Y52 I;  1Q86 1;  1JJ2 Z;  3HOY I;  3GTG I;  1S72 Z;  1TWC I;  1YIT Z;  2NVT I;  2VPY A;  1VQ8 1;  1KQS Y;  3GTO I;  2E2J I;  4E2W A;  5FLX f;  1Z01 A;  1S72 1;  1K83 I;  1Q7Y 2;  1RNI A;  3VTN A;  1VQP Z;  1YIT 1;  3RZD I;  1YJN 1;  3J81 f;  2V45 A;  3J7A 4;  4RVH A;  2LEX A;  1Q16 A;  3U50 C;  1K73 1;  4BXX I;  1QF8 A;  1VQP 1;  3CC2 1;  1SIW A;  5FLX b;  2ZAE B;  1TFI A;  1KD1 2;  2JUB A;  5C4J I;  3CXC Z;  2DE7 A;  1RQF A;  4NBC A;  3J81 b;  1FDO A;  1VQ6 1;  3VMH A;  3PO3 S;  2RT9 A;  4X6A I;  4A3J I;  1P9N A;  2IZ4 A;  4E30 A;  2OTJ Z;  1Q81 2;  2LFU A;  4A3K I;  2B63 I;  1Z03 A;  2VPX A;  2NVQ I;  3IF8 A;  1ML8 A;  1TWH I;  2HF1 A;  3VMG A;  3BG0 B;  3H3V J;  4A93 I;  3EER A;  3LUS A;  1VQ4 Z;  4MH4 A;  5LL6 f;  3IFU A;  4BY1 I;  1N8R 2;  5A2Q f;  1Y8C A;  4A3M I;  1K8A 1;  2H85 A;  2PM9 A;  3MZL B;  2QA4 Z;  3CCJ Z;  1N2F A;  4HGZ A;  1VQ4 1;  2JIO A;  1QVF Y;  3F3P C;  2JMO A;  3GTL I;  3FQM A;  5D1O B;  2QA4 1;  4DGL A;  2E2H I;  3NDI A;  4RVD A;  3CCL Z;  2Q51 A;  4NBD A;  2BJO A;  3J80 f;  2R92 I;  1K9M 2;  2V8I A;  3RZO I;  4A3C I;  3GTJ I;  5IP7 I;  5C4X I;  5CM2 M;  2HU9 A;  1LQL A;  3CCM 1;  1USP B;  2G2K A;  3MZK B;  1VQN Z;  1FDI A;  1VQ7 Z;  1YUA A;  2K3R A;  3G6E Z;  1YJ9 Z;  1SFO I;  1RO4 A;  1I3Q I;  2M6N A;  1VQN 1;  4A3E I;  4A3I I;  5C44 I;  1VQ7 1;  2QRC B;  3G6E 1;  1I6H I;  1AA6 A;  1TWG I;  1X3W A;  1M90 2;  1VLA A;  3IR7 A;  3ESW A;  3VB9 A;  3HOU I;  1L1O C;  1RO0 A;  2KPI A;  2Q4Z A;  3S1R I;  5AN9 F;  2GTI A;  3M4O I;  3OW2 Z;  4E31 A;  1VQM Z;  1Q82 1;  2JA8 I;  2J6A A;  3KIF A;  1VQM 1;  2IV2 X;  1Q86 2;  1VQ9 Z;  5FLM I;  2WB1 A;  4NB9 A;  5T64 A;  3IX0 A;  2OTL Z;  3I07 A;  4HGY A;  3HKZ A;  1PFT A;  2JIP A;  3NFZ A;  3FKI I;  3MON A;  2I3C A;  2PMZ A;  2RBL A;  1VQ9 1;  1WII A;  2QKD A;  2OOX B;  2OTL 1;  3CCS Z;  3S1M I;  5T6B A;  3P5J B;  1KD1 1;  4AYB A;  4MON A;  4EWC A;  2W03 A;  2M48 A;  1Y1V S;  3TDH B;  3CCS 1;  2QRD B;  3GKQ A;  2VUM I;  1Q81 1;  1KC8 1;  1NJI 1;  2OTJ 1;  2QLV B;  3D2L A;  4E2Y A;  1NUI A;  1YJW Z;  2LIY A;  1RLY A;  2KI7 B;  2P3Y A;  2VUG A;  3CCE Z;  4Y7N I;  3QWU A;  1ZB9 A;  2DE5 A;  2NAP A;  3CC7 Z;  1X3Z A;  2RPR A;  3D9X A;  3CCR Z;  3EED A;  1YJW 1;  3PO3 I;  3CCE 1;  5IT9 f;  3CC7 1;  4BY7 I;  5A2Q b;  3CCJ 1;  5D1O A;  3JAM f;  4A3L I;  3HOX I;  1K8A 2;  2QR1 B;  2P28 A;  3GCF A;  2IZ3 A;  4A3G I;  5T67 A;  2YAD A;  2W04 A;  2F4M A;  2QEX Z;  2O4H A;  3CCL 1;  3JAM b;  3HOW I;  2QRE B;  3PO2 I;  3S14 I;  3NH5 A;  3J80 b;  3GTM S;  3S16 I;  2QEX 1;  2AKL A;  1USP A;  3VMI A;  3CC4 Z;  1JJ2 Y;  3CCU Z;  1DL6 A;  1R9T I;  3CQZ I;  4S1T A;  3CPW Z;  1YJ9 1;  4NBF A;  4MRI A;  3CC4 1;  1WJ2 A;  1I50 I;  3CCU 1;  4A3F I;  4NB8 A;  1M1K 1;  3CCQ Z;  2DE6 A;  1ZB8 A;  1W2B Z;  4XX2 A;  2JA7 I;  1X0T A;  5C3E I;  3M3Y I;  3NH8 A;  2WAQ A;  3HOV I;  3CCQ 1;  2E7Z A;  3K7A I;  1QVG Z;  2E9H A;  3CXC Y;  4MD7 A;  3BG1 B;  2NVY I;  4NH1 C;  4CL1 A;  1VQL Z;  1Q82 2;  1Q7Y 1;  2GU2 A;  2Y0S A;  4QTT A;  4DQY B;  3S15 I;  4MXU A;  4NBG A;  1VQL 1;  3TE5 B;  3T4N B;  2R93 I;  1YJN Z;  4E33 A;  4MD8 A;  1YIJ Z;  3G4S Z;  4NBA A;  3KIH A;  2RIQ A;  2JA5 I;  1QXF A;  3CC2 Z;  2NVX I;  1YHQ Z;  1Y1W I;  4QTU A;  1YIJ 1;  1K73 2;  3G4S 1;  4TNU A;  3I56 Z;  3S17 I;  3H0G I;  4E2X A;  2YU9 I;  4HH4 A;  1VQ6 Z;  1YHQ 1;  3S1Q I;  1KQS Z;  2PK7 A;  1NP6 A;  2VPW A;  3CD6 Z;  4RV9 A;  3HOZ I;  2JIQ A;  1Z02 A;  3I56 1;  4A3D I;  2EGT A;  1VQ5 Z;  1JWH C; 
#chains in the Genus database with same CATH homology
 5D1P A;  3CD6 1;  1N8R 1;  1VQK Z;  3S1N I;  1VQ5 1;  1KC8 2;  1NJI 2;  4DK1 A;  2O53 A;  1WW9 A;  1S7M A;  4NOZ A;  1TWA I;  3Q87 A;  1VQK 1;  1Y1V I;  4NBH A;  3CCR 1;  2R6M A;  1YUK A;  4NFR A;  4RVF A;  3F3F C;  3NH4 A;  1WCM I;  1ZH1 A;  3S2D I;  1VQO Z;  1RO2 A;  4MD9 A;  4E2Z A;  4E32 A;  5IT9 b;  1K9M 1;  3CMA Z;  3CPW Y;  3S2H I;  2JA6 I;  4NBB A;  3GTK I;  1TWF I;  2OZK A;  4BBR I;  3GTP I;  2R7Z I;  1VQO 1;  1KRL A;  2GTH A;  2RHB A;  3I55 Z;  3FQQ A;  3D6W A;  4NBE A;  1YI2 Z;  3CMA 1;  2E2I I;  1W2B Y;  4RS4 A;  3CCV Z;  3OW2 Y;  3CCM Z;  3CME Z;  3NDJ A;  3G71 Z;  2K5R A;  1QVF Z;  3I55 1;  1QYP A;  1YI2 1;  2F4O A;  1QVG Y;  3CCV 1;  2V8K A;  3CME 1;  3GTQ I;  3G71 1;  1M90 1;  2JS4 A;  4BBS I;  2VF1 A;  2OOY B;  2JR6 A;  3I4N I;  2V8J A;  5IP9 I;  3I4M I;  2JNY A;  3GTM I;  1M1K 2;  4A3B I;  4RVG A;  1VQ8 Z;  4Y52 I;  1Q86 1;  1JJ2 Z;  3HOY I;  3GTG I;  1S72 Z;  1TWC I;  1YIT Z;  2NVT I;  1VQ8 1;  1KQS Y;  3GTO I;  2E2J I;  4E2W A;  5FLX f;  1Z01 A;  1S72 1;  1K83 I;  1Q7Y 2;  1RNI A;  3VTN A;  1VQP Z;  1YIT 1;  3RZD I;  1YJN 1;  3J81 f;  3J7A 4;  4RVH A;  3U50 C;  1K73 1;  4BXX I;  1QF8 A;  1VQP 1;  3CC2 1;  5FLX b;  2ZAE B;  1TFI A;  1KD1 2;  2JUB A;  5C4J I;  3CXC Z;  2DE7 A;  1RQF A;  4NBC A;  3J81 b;  1VQ6 1;  3PO3 S;  3VMH A;  2RT9 A;  4X6A I;  4A3J I;  1P9N A;  2IZ4 A;  4E30 A;  2OTJ Z;  1Q81 2;  2LFU A;  4A3K I;  2B63 I;  1Z03 A;  2NVQ I;  3IF8 A;  1ML8 A;  1TWH I;  2HF1 A;  3VMG A;  3BG0 B;  3H3V J;  4A93 I;  3EER A;  3LUS A;  1VQ4 Z;  4MH4 A;  5LL6 f;  3IFU A;  4BY1 I;  1N8R 2;  5A2Q f;  4A3M I;  1K8A 1;  2H85 A;  2PM9 A;  3MZL B;  2QA4 Z;  3CCJ Z;  1N2F A;  4HGZ A;  1VQ4 1;  1QVF Y;  3F3P C;  2JMO A;  3GTL I;  3FQM A;  5D1O B;  2QA4 1;  4DGL A;  2E2H I;  3NDI A;  4RVD A;  3CCL Z;  2Q51 A;  4NBD A;  2BJO A;  3J80 f;  2R92 I;  1K9M 2;  2V8I A;  3RZO I;  4A3C I;  3GTJ I;  5IP7 I;  5C4X I;  5CM2 M;  2HU9 A;  1LQL A;  3CCM 1;  1USP B;  2G2K A;  3MZK B;  1VQN Z;  1VQ7 Z;  1YUA A;  2K3R A;  3G6E Z;  1YJ9 Z;  1SFO I;  1RO4 A;  1I3Q I;  2M6N A;  1VQN 1;  4A3E I;  4A3I I;  5C44 I;  1VQ7 1;  2QRC B;  3G6E 1;  1I6H I;  1TWG I;  1X3W A;  1M90 2;  1VLA A;  3ESW A;  3VB9 A;  3HOU I;  3S1R I;  1L1O C;  1RO0 A;  2KPI A;  2Q4Z A;  5AN9 F;  2GTI A;  3M4O I;  3OW2 Z;  4E31 A;  1VQM Z;  1Q82 1;  2JA8 I;  2J6A A;  3KIF A;  1VQM 1;  1Q86 2;  1VQ9 Z;  5FLM I;  2WB1 A;  4NB9 A;  5T64 A;  3IX0 A;  2OTL Z;  3I07 A;  4HGY A;  3HKZ A;  1PFT A;  3NFZ A;  3FKI I;  3MON A;  2I3C A;  2PMZ A;  2RBL A;  1VQ9 1;  1WII A;  2QKD A;  2OOX B;  2OTL 1;  3CCS Z;  3S1M I;  5T6B A;  3P5J B;  1KD1 1;  4AYB A;  4MON A;  4EWC A;  2W03 A;  2M48 A;  1Y1V S;  3TDH B;  3CCS 1;  2QRD B;  3GKQ A;  2VUM I;  1Q81 1;  1KC8 1;  1NJI 1;  2OTJ 1;  2QLV B;  4E2Y A;  1NUI A;  1YJW Z;  2LIY A;  1RLY A;  2KI7 B;  2P3Y A;  2VUG A;  3CCE Z;  4Y7N I;  3QWU A;  1ZB9 A;  2DE5 A;  3CC7 Z;  1X3Z A;  2RPR A;  3D9X A;  3CCR Z;  3EED A;  1YJW 1;  3PO3 I;  3CCE 1;  5IT9 f;  3CC7 1;  4BY7 I;  5A2Q b;  3CCJ 1;  5D1O A;  3JAM f;  4A3L I;  3HOX I;  1K8A 2;  2QR1 B;  2P28 A;  3GCF A;  2IZ3 A;  4A3G I;  5T67 A;  2YAD A;  2W04 A;  2F4M A;  2QEX Z;  2O4H A;  3CCL 1;  3JAM b;  3HOW I;  2QRE B;  3PO2 I;  3S14 I;  3NH5 A;  3J80 b;  3GTM S;  3S16 I;  2QEX 1;  2AKL A;  1USP A;  3VMI A;  3CC4 Z;  1JJ2 Y;  3CCU Z;  1DL6 A;  1R9T I;  3CQZ I;  4S1T A;  3CPW Z;  1YJ9 1;  4NBF A;  4MRI A;  3CC4 1;  1I50 I;  3CCU 1;  4A3F I;  4NB8 A;  1M1K 1;  3CCQ Z;  2DE6 A;  1ZB8 A;  1W2B Z;  4XX2 A;  2JA7 I;  1X0T A;  5C3E I;  3M3Y I;  3NH8 A;  2WAQ A;  3HOV I;  3CCQ 1;  3K7A I;  1QVG Z;  2E9H A;  3CXC Y;  4MD7 A;  3BG1 B;  2NVY I;  4NH1 C;  4CL1 A;  1VQL Z;  1Q82 2;  1Q7Y 1;  2GU2 A;  2Y0S A;  4QTT A;  4DQY B;  3S15 I;  4MXU A;  4NBG A;  1VQL 1;  3TE5 B;  3T4N B;  2R93 I;  1YJN Z;  4E33 A;  4MD8 A;  1YIJ Z;  3G4S Z;  4NBA A;  3KIH A;  2RIQ A;  2JA5 I;  3CC2 Z;  2NVX I;  1YHQ Z;  1Y1W I;  4QTU A;  1YIJ 1;  1K73 2;  3G4S 1;  4TNU A;  3I56 Z;  3S17 I;  3H0G I;  4E2X A;  2YU9 I;  4HH4 A;  1VQ6 Z;  1YHQ 1;  3S1Q I;  1KQS Z;  2PK7 A;  1NP6 A;  3CD6 Z;  4RV9 A;  3HOZ I;  1Z02 A;  3I56 1;  4A3D I;  2EGT A;  1VQ5 Z;  1JWH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...