2QA4Z

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qa4Z00
3CCSZ 1VQOZ 3G6E1 1M902 3CCLZ 1S72Z 3CCVZ 1YJWZ 1W2BZ 1YJNZ 1VQ8Z 1VQP1 1Q822 1YI2Z 1Q812 1VQ91 3CME1 1YIJ1 3OW2Y 3OW2Z 1K731 1YHQ1 2OTLZ 3I551 3CC21 1M1K1 3CC41 1KC81 1N8R2 3CCUZ 1VQ6Z 1K732 1K8A2 3CCMZ 3CD61 1QVGY 2QA4Z 1QVGZ 1M1K2 1VQ71 1KC82 3I56Z 2QEXZ 3CC71 3G711 1VQLZ 1VQN1 1Q861 3CCJ1 1YI21 1VQMZ 1YIT1 1VQK1 3CCRZ 1Q862 2OTJZ 1NJI1 2OTL1 3CPWY 3CPWZ 3G4S1 3CCQ1 3G6EZ 1YJ91 3CMAZ 1VQ5Z 3CCS1 1VQO1 1KQSY 1NJI2 1VQPZ 3CCL1 1VQ9Z 1S721 3CCV1 1YJW1 2QEX1 3CMEZ 1YJN1 1VQL1 1VQ4Z 1VQ81 1KD11 3CCEZ 1YHQZ 1K9M1 3I55Z 3CC4Z 1KD12 2OTJ1 3CD6Z 1K9M2 1VQ7Z 3CCU1 1Q7Y1 1W2BY 3CMA1 3CC7Z 1VQ51 1VQ61 3G71Z 1VQNZ 3CCM1 1KQSZ 3CCJZ 2QA41 1QVFY 1QVFZ 1YITZ 3I561 1VQKZ 1YIJZ 1N8R1 1VQ41 1Q7Y2 3CCE1 1VQM1 1K8A1 1M901 3CC2Z 3G4SZ 3CCQZ 3CXCY 3CCR1 3CXCZ 1YJ9Z 1JJ2Y 1Q821 1Q811 1JJ2Z
chains in the Genus database with same CATH superfamily
2DE7A 2QLVB 2F4MA 2P28A 1Q822 2LIYA 1VQ91 1I50I 2W04A 1WW9A 3D2LA 1WIIA 3BG1B 3NH5A 3FKII 1YIJ1 3JAMf 4NFRA 3GTJI 3IR7A 2F4OA 4A3KI 1M1K1 1ZB8A 3CC41 4BY7I 1JWHC 1N8R2 2AYDA 3BG0B 1VQ6Z 4Y7NI 1K732 4E31A 4RVFA 2K3RA 1VQ71 2QEXZ 3CC71 1VQLZ 2P3YA 3ESWA 5LL6f 2GTIA 1TWCI 2JNYA 1VQK1 3D9XA 3CCRZ 5C4XI 2OTJZ 2Q4ZA 1QYPA 2IV2X 1PFTA 3GTQI 2JIQA 3FQQA 1YJ91 3HKZA 2R92I 1VQ5Z 2VF1A 1NJI2 4A93I 4E2ZA 3S16I 3CMEZ 1Q16A 2NVXI 1AA6A 3CCEZ 4A3GI 4X6AI 2M48A 5AN9F 4MONA 2HF1A 4RVHA 1KD12 1I6HI 3MZLB 1TWAI 4A3EI 3CD6Z 3CMA1 1VQ61 4RV9A 3G71Z 3MZKB 1VQNZ 3HOXI 3CCJZ 5T67A 2O4HA 3KIFA 1TWGI 1YIJZ 4DGLA 1VQ41 2VPZA 2EGTA 4A3FI 2QRCB 5C44I 3LUSA 4NBGA 4E30A 3CCR1 1TWFI 3CXCY 3G4SZ 3CXCZ 3EERA 3F3FC 4RS4A 1Q821 1RO4A 1QXFA 2M6NA 1M902 1FDOA 4MD7A 3CCVZ 3K7AI 1YJNZ 1VQ8Z 4MD9A 2NVYI 1Q812 2VUGA 3J80b 1LQLA 2JA6I 2E2JI 2KI7B 4NBDA 3CME1 2RIQA 3S1NI 5CM2M 1K731 5T6BA 3RZDI 2IZ4A 3GTMS 3U50C 3FQMA 2OZKA 3CCMZ 3H0GI 3CD61 3HOYI 5FLXf 1KC82 2JIOA 2JA8I 3I56Z 5A2Qb 3G711 1VQN1 3J7A4 3CCJ1 1YI21 1VQMZ 1RO0A 1YUAA 1Z01A 4E32A 2VUMI 2YADA 3HOZI 1NJI1 3PO3I 3G4S1 4HH4A 3M3YI 4NBAA 3CMAZ 3VMGA 1KQSY 1S7MA 5D1OB 2Y0SA 3I07A 3CCV1 1YJN1 2I3CA 1R9TI 1VQ4Z 2DE6A 1VQ81 2JA5I 1KD11 2VPWA 3S1QI 4A3MI 3I55Z 2IZ3A 2Q51A 3F3PC 2W03A 2R7ZI 3IX0A 1K9M2 1W2BY 4NBBA 4AYBA 3CCM1 3I4NI 3I561 5IT9b 1VQM1 1I3QI 4A3CI 2NAPA 1M901 3I4MI 3CCQZ 2V45A 2RPRA 4NOZA 3S1RI 1Q811 3CCSZ 3GTKI 2K5RA 4MRIA 3CCLZ 1FDIA 4MH4A 4NBHA 1YJWZ 3MONA 3IFUA 2WAQA 2RBLA 2VPXA 3J81b 5D1OA 1YI2Z 3S15I 2J6AA 5T64A 1RQFA 1Y1WI 2NVTI 2V8JA 1SIWA 4A3LI 3VMIA 3OW2Y 2AKLA 3OW2Z 3GKQA 1USPB 3VTNA 2G2KA 1Y8CA 3I551 1KC81 4Y52I 2OOYB 2R6MA 2KPIA 4TNUA 4E33A 2NVQI 5IP9I 3Q87A 4A3BI 4QTTA 3S14I 2ZAEB 2H85A 4NB8A 3QWUA 1X3ZA 3S2DI 3VB9A 2QREB 1Q862 5D1PA 2OTL1 3CPWY 3CPWZ 3CCQ1 3G6EZ 2R93I 2PK7A 3JAMb 3EEDA 3CCS1 3P5JB 4MXUA 1VQPZ 2JR6A 1VLAA 3CCL1 1P9NA 1WCMI 1YJW1 1WJ2A 1NUIA 1X0TA 3IF8A 2O53A 3TDHB 1RO2A 1KRLA 1TWHI 1YHQZ 3M4OI 1K9M1 1USPA 1NP6A 3J80f 4RVDA 3NH8A 2E2HI 1K83I 3T4NB 4BBSI 4CL1A 2JUBA 1Y1VI 3NDJA 1KQSZ 3GTMI 2PMZA 1ZB9A 3GTGI 1YITZ 3NH4A 4DQYB 1Q7Y2 1K8A1 4HGZA 4E2XA 2OOXB 2JIMA 3GTOI 4NH1C 5A2Qf 1JJ2Y 2VPYA 1JJ2Z 4RVGA 1VQOZ 2RT9A 3HOVI 3G6E1 1S72Z 4NBCA 1YUKA 4MD8A 1W2BZ 1WZNA 1ZH1A 4NBEA 1VQP1 3GTPI 2V8KA 3HOUI 4BBRI 4HGYA 1YHQ1 3HOWI 2OTLZ 3S17I 3CC21 3NFZA 3RZOI 3CCUZ 4E2WA 4A3II 3S2HI 5IP7I 1K8A2 2JIPA 2QKDA 4NB9A 1QVGY 2QA4Z 4XX2A 1QVGZ 1M1K2 4BY1I 4QTUA 1Q861 1L1OC 1YIT1 1X3WA 3KIHA 2DE5A 2JS4A 2QR1B 3VMHA 1RNIA 2HU9A 3TE5B 2BJOA 3NDIA 2E7ZA 4DK1A 5C4JI 5IT9f 4A3DI 1VQO1 5C3EI 3H3VJ 1S721 1VQ9Z 2JIRA 1Z02A 2QEX1 1VQL1 1QF8A 3D6WA 2GU2A 3CC4Z 2PM9A 5FLXb 2V8IA 4EWCA 4NBFA 3J81f 2OTJ1 2V3VA 4A3JI 4E2YA 2RHBA 1VQ7Z 3CCU1 2JA7I 1Q7Y1 2WB1A 3CC7Z 1VQ51 1RLYA 4BXXI 2LFUA 1N2FA 4S1TA 2GTHA 2QA41 1QVFY 1QVFZ 1VQKZ 2E9HA 2LEXA 1N8R1 3PO3S 5FLMI 3CCE1 1SFOI 3CQZI 2E2II 3GCFA 1DL6A 1Y1VS 3CC2Z 2B63I 3GTLI 2YU9I 3PO2I 3S1MI 1YJ9Z 2JMOA 1Z03A 1TFIA 1ML8A 2QRDB
chains in the Genus database with same CATH topology
2DE7A 2QLVB 2F4MA 2P28A 1Q822 2LIYA 1VQ91 1I50I 2W04A 1WW9A 1WIIA 3BG1B 3NH5A 3FKII 1YIJ1 3JAMf 4NFRA 3GTJI 2F4OA 4A3KI 1M1K1 1ZB8A 3CC41 4BY7I 1JWHC 1N8R2 3BG0B 1VQ6Z 4Y7NI 1K732 4E31A 4RVFA 2K3RA 1VQ71 2QEXZ 3CC71 1VQLZ 2P3YA 3ESWA 5LL6f 2GTIA 1TWCI 2JNYA 1VQK1 3D9XA 3CCRZ 5C4XI 2OTJZ 2Q4ZA 1QYPA 1PFTA 3GTQI 3FQQA 1YJ91 3HKZA 2R92I 1VQ5Z 2VF1A 1NJI2 4A93I 4E2ZA 3S16I 3CMEZ 2NVXI 3CCEZ 4A3GI 4X6AI 2M48A 5AN9F 4MONA 2HF1A 4RVHA 1KD12 1I6HI 3MZLB 1TWAI 4A3EI 3CD6Z 3CMA1 1VQ61 4RV9A 3G71Z 3MZKB 1VQNZ 3HOXI 3CCJZ 5T67A 2O4HA 3KIFA 1TWGI 1YIJZ 4DGLA 1VQ41 2EGTA 4A3FI 2QRCB 5C44I 3LUSA 4NBGA 4E30A 3CCR1 1TWFI 3CXCY 3G4SZ 3CXCZ 3EERA 3F3FC 4RS4A 1Q821 1RO4A 2M6NA 1M902 4MD7A 3CCVZ 3K7AI 1YJNZ 1VQ8Z 4MD9A 2NVYI 1Q812 2VUGA 3J80b 1LQLA 2JA6I 2E2JI 2KI7B 4NBDA 3CME1 2RIQA 3S1NI 5CM2M 1K731 5T6BA 3RZDI 2IZ4A 3GTMS 3U50C 3FQMA 2OZKA 3CCMZ 3H0GI 3CD61 3HOYI 5FLXf 1KC82 2JA8I 3I56Z 5A2Qb 3G711 1VQN1 3J7A4 3CCJ1 1YI21 1VQMZ 1RO0A 1YUAA 1Z01A 4E32A 2VUMI 2YADA 3HOZI 1NJI1 3PO3I 3G4S1 4HH4A 3M3YI 4NBAA 3CMAZ 3VMGA 1KQSY 1S7MA 5D1OB 2Y0SA 3I07A 3CCV1 1YJN1 2I3CA 1R9TI 1VQ4Z 2DE6A 1VQ81 2JA5I 1KD11 3S1QI 4A3MI 3I55Z 2IZ3A 2Q51A 3F3PC 2W03A 2R7ZI 3IX0A 1K9M2 1W2BY 4NBBA 4AYBA 3CCM1 3I4NI 3I561 5IT9b 1VQM1 1I3QI 4A3CI 1M901 3I4MI 3CCQZ 2RPRA 4NOZA 3S1RI 1Q811 3CCSZ 3GTKI 2K5RA 4MRIA 3CCLZ 4MH4A 4NBHA 1YJWZ 3MONA 3IFUA 2WAQA 2RBLA 3J81b 5D1OA 1YI2Z 3S15I 2J6AA 5T64A 1RQFA 1Y1WI 2NVTI 2V8JA 4A3LI 3VMIA 3OW2Y 2AKLA 3OW2Z 3GKQA 1USPB 3VTNA 2G2KA 3I551 1KC81 4Y52I 2OOYB 2R6MA 2KPIA 4TNUA 4E33A 2NVQI 5IP9I 3Q87A 4A3BI 4QTTA 3S14I 2ZAEB 2H85A 4NB8A 3QWUA 1X3ZA 3S2DI 3VB9A 2QREB 1Q862 5D1PA 2OTL1 3CPWY 3CPWZ 3CCQ1 3G6EZ 2R93I 2PK7A 3JAMb 3EEDA 3CCS1 3P5JB 4MXUA 1VQPZ 2JR6A 1VLAA 3CCL1 1P9NA 1WCMI 1YJW1 1NUIA 1X0TA 3IF8A 2O53A 3TDHB 1RO2A 1KRLA 1TWHI 1YHQZ 3M4OI 1K9M1 1USPA 1NP6A 3J80f 4RVDA 3NH8A 2E2HI 1K83I 3T4NB 4BBSI 4CL1A 2JUBA 1Y1VI 3NDJA 1KQSZ 3GTMI 2PMZA 1ZB9A 3GTGI 1YITZ 3NH4A 4DQYB 1Q7Y2 1K8A1 4HGZA 4E2XA 2OOXB 3GTOI 4NH1C 5A2Qf 1JJ2Y 1JJ2Z 4RVGA 1VQOZ 2RT9A 3HOVI 3G6E1 1S72Z 4NBCA 1YUKA 4MD8A 1W2BZ 1ZH1A 4NBEA 1VQP1 3GTPI 2V8KA 3HOUI 4BBRI 4HGYA 1YHQ1 3HOWI 2OTLZ 3S17I 3CC21 3NFZA 3RZOI 3CCUZ 4E2WA 4A3II 3S2HI 5IP7I 1K8A2 2QKDA 4NB9A 1QVGY 2QA4Z 4XX2A 1QVGZ 1M1K2 4BY1I 4QTUA 1Q861 1L1OC 1YIT1 1X3WA 3KIHA 2DE5A 2JS4A 2QR1B 3VMHA 1RNIA 2HU9A 3TE5B 2BJOA 3NDIA 4DK1A 5IT9f 5C4JI 4A3DI 1VQO1 5C3EI 3H3VJ 1S721 1VQ9Z 1Z02A 2QEX1 1VQL1 1QF8A 3D6WA 2GU2A 3CC4Z 2PM9A 5FLXb 2V8IA 4EWCA 4NBFA 3J81f 2OTJ1 4A3JI 4E2YA 2RHBA 1VQ7Z 3CCU1 2JA7I 1Q7Y1 2WB1A 3CC7Z 1VQ51 1RLYA 4BXXI 2LFUA 1N2FA 4S1TA 2GTHA 2QA41 1QVFY 1QVFZ 1VQKZ 2E9HA 1N8R1 3PO3S 5FLMI 3CCE1 1SFOI 3CQZI 2E2II 3GCFA 1DL6A 1Y1VS 3CC2Z 2B63I 3GTLI 2YU9I 3PO2I 3S1MI 1YJ9Z 2JMOA 1Z03A 1TFIA 1ML8A 2QRDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Z;  1VQO Z;  3G6E 1;  1M90 2;  3CCL Z;  1S72 Z;  3CCV Z;  1YJW Z;  1W2B Z;  1YJN Z;  1VQ8 Z;  1VQP 1;  1Q82 2;  1YI2 Z;  1Q81 2;  1VQ9 1;  3CME 1;  1YIJ 1;  3OW2 Y;  3OW2 Z;  1K73 1;  1YHQ 1;  2OTL Z;  3I55 1;  3CC2 1;  1M1K 1;  3CC4 1;  1KC8 1;  1N8R 2;  3CCU Z;  1VQ6 Z;  1K73 2;  1K8A 2;  3CCM Z;  3CD6 1;  1QVG Y;  2QA4 Z;  1QVG Z;  1M1K 2;  1VQ7 1;  1KC8 2;  3I56 Z;  2QEX Z;  3CC7 1;  3G71 1;  1VQL Z;  1VQN 1;  1Q86 1;  3CCJ 1;  1YI2 1;  1VQM Z;  1YIT 1;  1VQK 1;  3CCR Z;  1Q86 2;  2OTJ Z;  1NJI 1;  2OTL 1;  3CPW Y;  3CPW Z;  3G4S 1;  3CCQ 1;  3G6E Z;  1YJ9 1;  3CMA Z;  1VQ5 Z;  3CCS 1;  1VQO 1;  1KQS Y;  1NJI 2;  1VQP Z;  3CCL 1;  1VQ9 Z;  1S72 1;  3CCV 1;  1YJW 1;  2QEX 1;  3CME Z;  1YJN 1;  1VQL 1;  1VQ4 Z;  1VQ8 1;  1KD1 1;  3CCE Z;  1YHQ Z;  1K9M 1;  3I55 Z;  3CC4 Z;  1KD1 2;  2OTJ 1;  3CD6 Z;  1K9M 2;  1VQ7 Z;  3CCU 1;  1Q7Y 1;  1W2B Y;  3CMA 1;  3CC7 Z;  1VQ5 1;  1VQ6 1;  3G71 Z;  1VQN Z;  3CCM 1;  1KQS Z;  3CCJ Z;  2QA4 1;  1QVF Y;  1QVF Z;  1YIT Z;  3I56 1;  1VQK Z;  1YIJ Z;  1N8R 1;  1VQ4 1;  1Q7Y 2;  3CCE 1;  1VQM 1;  1K8A 1;  1M90 1;  3CC2 Z;  3G4S Z;  3CCQ Z;  3CXC Y;  3CCR 1;  3CXC Z;  1YJ9 Z;  1JJ2 Y;  1Q82 1;  1Q81 1;  1JJ2 Z; 
#chains in the Genus database with same CATH topology
 2DE7 A;  2QLV B;  2F4M A;  2P28 A;  1Q82 2;  2LIY A;  1VQ9 1;  1I50 I;  2W04 A;  1WW9 A;  3D2L A;  1WII A;  3BG1 B;  3NH5 A;  3FKI I;  1YIJ 1;  3JAM f;  4NFR A;  3GTJ I;  3IR7 A;  2F4O A;  4A3K I;  1M1K 1;  1ZB8 A;  3CC4 1;  4BY7 I;  1JWH C;  1N8R 2;  2AYD A;  3BG0 B;  1VQ6 Z;  4Y7N I;  1K73 2;  4E31 A;  4RVF A;  2K3R A;  1VQ7 1;  2QEX Z;  3CC7 1;  1VQL Z;  2P3Y A;  3ESW A;  5LL6 f;  2GTI A;  1TWC I;  2JNY A;  1VQK 1;  3D9X A;  3CCR Z;  5C4X I;  2OTJ Z;  2Q4Z A;  1QYP A;  2IV2 X;  1PFT A;  3GTQ I;  2JIQ A;  3FQQ A;  1YJ9 1;  3HKZ A;  2R92 I;  1VQ5 Z;  2VF1 A;  1NJI 2;  4A93 I;  4E2Z A;  3S16 I;  3CME Z;  1Q16 A;  2NVX I;  1AA6 A;  3CCE Z;  4A3G I;  4X6A I;  2M48 A;  5AN9 F;  4MON A;  2HF1 A;  4RVH A;  1KD1 2;  1I6H I;  3MZL B;  1TWA I;  4A3E I;  3CD6 Z;  3CMA 1;  1VQ6 1;  4RV9 A;  3G71 Z;  3MZK B;  1VQN Z;  3HOX I;  3CCJ Z;  5T67 A;  2O4H A;  3KIF A;  1TWG I;  1YIJ Z;  4DGL A;  1VQ4 1;  2VPZ A;  2EGT A;  4A3F I;  2QRC B;  5C44 I;  3LUS A;  4NBG A;  4E30 A;  3CCR 1;  1TWF I;  3CXC Y;  3G4S Z;  3CXC Z;  3EER A;  3F3F C;  4RS4 A;  1Q82 1;  1RO4 A;  1QXF A;  2M6N A;  1M90 2;  1FDO A;  4MD7 A;  3CCV Z;  3K7A I;  1YJN Z;  1VQ8 Z;  4MD9 A;  2NVY I;  1Q81 2;  2VUG A;  3J80 b;  1LQL A;  2JA6 I;  2E2J I;  2KI7 B;  4NBD A;  3CME 1;  2RIQ A;  3S1N I;  5CM2 M;  1K73 1;  5T6B A;  3RZD I;  2IZ4 A;  3GTM S;  3U50 C;  3FQM A;  2OZK A;  3CCM Z;  3H0G I;  3CD6 1;  3HOY I;  5FLX f;  1KC8 2;  2JIO A;  2JA8 I;  3I56 Z;  5A2Q b;  3G71 1;  1VQN 1;  3J7A 4;  3CCJ 1;  1YI2 1;  1VQM Z;  1RO0 A;  1YUA A;  1Z01 A;  4E32 A;  2VUM I;  2YAD A;  3HOZ I;  1NJI 1;  3PO3 I;  3G4S 1;  4HH4 A;  3M3Y I;  4NBA A;  3CMA Z;  3VMG A;  1KQS Y;  1S7M A;  5D1O B;  2Y0S A;  3I07 A;  3CCV 1;  1YJN 1;  2I3C A;  1R9T I;  1VQ4 Z;  2DE6 A;  1VQ8 1;  2JA5 I;  1KD1 1;  2VPW A;  3S1Q I;  4A3M I;  3I55 Z;  2IZ3 A;  2Q51 A;  3F3P C;  2W03 A;  2R7Z I;  3IX0 A;  1K9M 2;  1W2B Y;  4NBB A;  4AYB A;  3CCM 1;  3I4N I;  3I56 1;  5IT9 b;  1VQM 1;  1I3Q I;  4A3C I;  2NAP A;  1M90 1;  3I4M I;  3CCQ Z;  2V45 A;  2RPR A;  4NOZ A;  3S1R I;  1Q81 1;  3CCS Z;  3GTK I;  2K5R A;  4MRI A;  3CCL Z;  1FDI A;  4MH4 A;  4NBH A;  1YJW Z;  3MON A;  3IFU A;  2WAQ A;  2RBL A;  2VPX A;  3J81 b;  5D1O A;  1YI2 Z;  3S15 I;  2J6A A;  5T64 A;  1RQF A;  1Y1W I;  2NVT I;  2V8J A;  1SIW A;  4A3L I;  3VMI A;  3OW2 Y;  2AKL A;  3OW2 Z;  3GKQ A;  1USP B;  3VTN A;  2G2K A;  1Y8C A;  3I55 1;  1KC8 1;  4Y52 I;  2OOY B;  2R6M A;  2KPI A;  4TNU A;  4E33 A;  2NVQ I;  5IP9 I;  3Q87 A;  4A3B I;  4QTT A;  3S14 I;  2ZAE B;  2H85 A;  4NB8 A;  3QWU A;  1X3Z A;  3S2D I;  3VB9 A;  2QRE B;  1Q86 2;  5D1P A;  2OTL 1;  3CPW Y;  3CPW Z;  3CCQ 1;  3G6E Z;  2R93 I;  2PK7 A;  3JAM b;  3EED A;  3CCS 1;  3P5J B;  4MXU A;  1VQP Z;  2JR6 A;  1VLA A;  3CCL 1;  1P9N A;  1WCM I;  1YJW 1;  1WJ2 A;  1NUI A;  1X0T A;  3IF8 A;  2O53 A;  3TDH B;  1RO2 A;  1KRL A;  1TWH I;  1YHQ Z;  3M4O I;  1K9M 1;  1USP A;  1NP6 A;  3J80 f;  4RVD A;  3NH8 A;  2E2H I;  1K83 I;  3T4N B;  4BBS I;  4CL1 A;  2JUB A;  1Y1V I;  3NDJ A;  1KQS Z;  3GTM I;  2PMZ A;  1ZB9 A;  3GTG I;  1YIT Z;  3NH4 A;  4DQY B;  1Q7Y 2;  1K8A 1;  4HGZ A;  4E2X A;  2OOX B;  2JIM A;  3GTO I;  4NH1 C;  5A2Q f;  1JJ2 Y;  2VPY A;  1JJ2 Z;  4RVG A;  1VQO Z;  2RT9 A;  3HOV I;  3G6E 1;  1S72 Z;  4NBC A;  1YUK A;  4MD8 A;  1W2B Z;  1WZN A;  1ZH1 A;  4NBE A;  1VQP 1;  3GTP I;  2V8K A;  3HOU I;  4BBR I;  4HGY A;  1YHQ 1;  3HOW I;  2OTL Z;  3S17 I;  3CC2 1;  3NFZ A;  3RZO I;  3CCU Z;  4E2W A;  4A3I I;  3S2H I;  5IP7 I;  1K8A 2;  2JIP A;  2QKD A;  4NB9 A;  1QVG Y;  2QA4 Z;  4XX2 A;  1QVG Z;  1M1K 2;  4BY1 I;  4QTU A;  1Q86 1;  1L1O C;  1YIT 1;  1X3W A;  3KIH A;  2DE5 A;  2JS4 A;  2QR1 B;  3VMH A;  1RNI A;  2HU9 A;  3TE5 B;  2BJO A;  3NDI A;  2E7Z A;  4DK1 A;  5C4J I;  5IT9 f;  4A3D I;  1VQO 1;  5C3E I;  3H3V J;  1S72 1;  1VQ9 Z;  2JIR A;  1Z02 A;  2QEX 1;  1VQL 1;  1QF8 A;  3D6W A;  2GU2 A;  3CC4 Z;  2PM9 A;  5FLX b;  2V8I A;  4EWC A;  4NBF A;  3J81 f;  2OTJ 1;  2V3V A;  4A3J I;  4E2Y A;  2RHB A;  1VQ7 Z;  3CCU 1;  2JA7 I;  1Q7Y 1;  2WB1 A;  3CC7 Z;  1VQ5 1;  1RLY A;  4BXX I;  2LFU A;  1N2F A;  4S1T A;  2GTH A;  2QA4 1;  1QVF Y;  1QVF Z;  1VQK Z;  2E9H A;  2LEX A;  1N8R 1;  3PO3 S;  5FLM I;  3CCE 1;  1SFO I;  3CQZ I;  2E2I I;  3GCF A;  1DL6 A;  1Y1V S;  3CC2 Z;  2B63 I;  3GTL I;  2YU9 I;  3PO2 I;  3S1M I;  1YJ9 Z;  2JMO A;  1Z03 A;  1TFI A;  1ML8 A;  2QRD B; 
#chains in the Genus database with same CATH homology
 2DE7 A;  2QLV B;  2F4M A;  2P28 A;  1Q82 2;  2LIY A;  1VQ9 1;  1I50 I;  2W04 A;  1WW9 A;  1WII A;  3BG1 B;  3NH5 A;  3FKI I;  1YIJ 1;  3JAM f;  4NFR A;  3GTJ I;  2F4O A;  4A3K I;  1M1K 1;  1ZB8 A;  3CC4 1;  4BY7 I;  1JWH C;  1N8R 2;  3BG0 B;  1VQ6 Z;  4Y7N I;  1K73 2;  4E31 A;  4RVF A;  2K3R A;  1VQ7 1;  2QEX Z;  3CC7 1;  1VQL Z;  2P3Y A;  3ESW A;  5LL6 f;  2GTI A;  1TWC I;  2JNY A;  1VQK 1;  3D9X A;  3CCR Z;  5C4X I;  2OTJ Z;  2Q4Z A;  1QYP A;  1PFT A;  3GTQ I;  3FQQ A;  1YJ9 1;  3HKZ A;  2R92 I;  1VQ5 Z;  2VF1 A;  1NJI 2;  4A93 I;  4E2Z A;  3S16 I;  3CME Z;  2NVX I;  3CCE Z;  4A3G I;  4X6A I;  2M48 A;  5AN9 F;  4MON A;  2HF1 A;  4RVH A;  1KD1 2;  1I6H I;  3MZL B;  1TWA I;  4A3E I;  3CD6 Z;  3CMA 1;  1VQ6 1;  4RV9 A;  3G71 Z;  3MZK B;  1VQN Z;  3HOX I;  3CCJ Z;  5T67 A;  2O4H A;  3KIF A;  1TWG I;  1YIJ Z;  4DGL A;  1VQ4 1;  2EGT A;  4A3F I;  2QRC B;  5C44 I;  3LUS A;  4NBG A;  4E30 A;  3CCR 1;  1TWF I;  3CXC Y;  3G4S Z;  3CXC Z;  3EER A;  3F3F C;  4RS4 A;  1Q82 1;  1RO4 A;  2M6N A;  1M90 2;  4MD7 A;  3CCV Z;  3K7A I;  1YJN Z;  1VQ8 Z;  4MD9 A;  2NVY I;  1Q81 2;  2VUG A;  3J80 b;  1LQL A;  2JA6 I;  2E2J I;  2KI7 B;  4NBD A;  3CME 1;  2RIQ A;  3S1N I;  5CM2 M;  1K73 1;  5T6B A;  3RZD I;  2IZ4 A;  3GTM S;  3U50 C;  3FQM A;  2OZK A;  3CCM Z;  3H0G I;  3CD6 1;  3HOY I;  5FLX f;  1KC8 2;  2JA8 I;  3I56 Z;  5A2Q b;  3G71 1;  1VQN 1;  3J7A 4;  3CCJ 1;  1YI2 1;  1VQM Z;  1RO0 A;  1YUA A;  1Z01 A;  4E32 A;  2VUM I;  2YAD A;  3HOZ I;  1NJI 1;  3PO3 I;  3G4S 1;  4HH4 A;  3M3Y I;  4NBA A;  3CMA Z;  3VMG A;  1KQS Y;  1S7M A;  5D1O B;  2Y0S A;  3I07 A;  3CCV 1;  1YJN 1;  2I3C A;  1R9T I;  1VQ4 Z;  2DE6 A;  1VQ8 1;  2JA5 I;  1KD1 1;  3S1Q I;  4A3M I;  3I55 Z;  2IZ3 A;  2Q51 A;  3F3P C;  2W03 A;  2R7Z I;  3IX0 A;  1K9M 2;  1W2B Y;  4NBB A;  4AYB A;  3CCM 1;  3I4N I;  3I56 1;  5IT9 b;  1VQM 1;  1I3Q I;  4A3C I;  1M90 1;  3I4M I;  3CCQ Z;  2RPR A;  4NOZ A;  3S1R I;  1Q81 1;  3CCS Z;  3GTK I;  2K5R A;  4MRI A;  3CCL Z;  4MH4 A;  4NBH A;  1YJW Z;  3MON A;  3IFU A;  2WAQ A;  2RBL A;  3J81 b;  5D1O A;  1YI2 Z;  3S15 I;  2J6A A;  5T64 A;  1RQF A;  1Y1W I;  2NVT I;  2V8J A;  4A3L I;  3VMI A;  3OW2 Y;  2AKL A;  3OW2 Z;  3GKQ A;  1USP B;  3VTN A;  2G2K A;  3I55 1;  1KC8 1;  4Y52 I;  2OOY B;  2R6M A;  2KPI A;  4TNU A;  4E33 A;  2NVQ I;  5IP9 I;  3Q87 A;  4A3B I;  4QTT A;  3S14 I;  2ZAE B;  2H85 A;  4NB8 A;  3QWU A;  1X3Z A;  3S2D I;  3VB9 A;  2QRE B;  1Q86 2;  5D1P A;  2OTL 1;  3CPW Y;  3CPW Z;  3CCQ 1;  3G6E Z;  2R93 I;  2PK7 A;  3JAM b;  3EED A;  3CCS 1;  3P5J B;  4MXU A;  1VQP Z;  2JR6 A;  1VLA A;  3CCL 1;  1P9N A;  1WCM I;  1YJW 1;  1NUI A;  1X0T A;  3IF8 A;  2O53 A;  3TDH B;  1RO2 A;  1KRL A;  1TWH I;  1YHQ Z;  3M4O I;  1K9M 1;  1USP A;  1NP6 A;  3J80 f;  4RVD A;  3NH8 A;  2E2H I;  1K83 I;  3T4N B;  4BBS I;  4CL1 A;  2JUB A;  1Y1V I;  3NDJ A;  1KQS Z;  3GTM I;  2PMZ A;  1ZB9 A;  3GTG I;  1YIT Z;  3NH4 A;  4DQY B;  1Q7Y 2;  1K8A 1;  4HGZ A;  4E2X A;  2OOX B;  3GTO I;  4NH1 C;  5A2Q f;  1JJ2 Y;  1JJ2 Z;  4RVG A;  1VQO Z;  2RT9 A;  3HOV I;  3G6E 1;  1S72 Z;  4NBC A;  1YUK A;  4MD8 A;  1W2B Z;  1ZH1 A;  4NBE A;  1VQP 1;  3GTP I;  2V8K A;  3HOU I;  4BBR I;  4HGY A;  1YHQ 1;  3HOW I;  2OTL Z;  3S17 I;  3CC2 1;  3NFZ A;  3RZO I;  3CCU Z;  4E2W A;  4A3I I;  3S2H I;  5IP7 I;  1K8A 2;  2QKD A;  4NB9 A;  1QVG Y;  2QA4 Z;  4XX2 A;  1QVG Z;  1M1K 2;  4BY1 I;  4QTU A;  1Q86 1;  1L1O C;  1YIT 1;  1X3W A;  3KIH A;  2DE5 A;  2JS4 A;  2QR1 B;  3VMH A;  1RNI A;  2HU9 A;  3TE5 B;  2BJO A;  3NDI A;  4DK1 A;  5IT9 f;  5C4J I;  4A3D I;  1VQO 1;  5C3E I;  3H3V J;  1S72 1;  1VQ9 Z;  1Z02 A;  2QEX 1;  1VQL 1;  1QF8 A;  3D6W A;  2GU2 A;  3CC4 Z;  2PM9 A;  5FLX b;  2V8I A;  4EWC A;  4NBF A;  3J81 f;  2OTJ 1;  4A3J I;  4E2Y A;  2RHB A;  1VQ7 Z;  3CCU 1;  2JA7 I;  1Q7Y 1;  2WB1 A;  3CC7 Z;  1VQ5 1;  1RLY A;  4BXX I;  2LFU A;  1N2F A;  4S1T A;  2GTH A;  2QA4 1;  1QVF Y;  1QVF Z;  1VQK Z;  2E9H A;  1N8R 1;  3PO3 S;  5FLM I;  3CCE 1;  1SFO I;  3CQZ I;  2E2I I;  3GCF A;  1DL6 A;  1Y1V S;  3CC2 Z;  2B63 I;  3GTL I;  2YU9 I;  3PO2 I;  3S1M I;  1YJ9 Z;  2JMO A;  1Z03 A;  1TFI A;  1ML8 A;  2QRD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...