2QA4Z

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qa4Z00
3I56Z 3G4SZ 3CCEZ 3CCU1 1YJ91 3CCM1 1KC82 1K8A2 1K9M1 1VQL1 2OTLZ 1VQ41 1NJI1 3CCJ1 3G4S1 3CCE1 1VQ5Z 1YITZ 3CCQZ 1VQ4Z 3CMA1 1Q862 3CC2Z 1Q822 1YI2Z 1VQ61 1YJNZ 1YJ9Z 1KD11 3CMAZ 3OW2Y 1N8R1 1QVFY 3CD61 1Q7Y2 1VQO1 3CCJZ 3CCRZ 3CXCY 1Q811 3CC7Z 1YIT1 3CPWY 1YHQZ 1VQOZ 1YJWZ 1KQSZ 3I55Z 3CC4Z 1YJN1 1Q812 1VQM1 1YJW1 1VQK1 3G71Z 1QVFZ 3CME1 1K732 1Q821 1VQ7Z 3CPWZ 1YIJZ 1VQN1 1VQMZ 1VQ6Z 1KD12 1VQPZ 1W2BZ 1VQKZ 2QEX1 3CCL1 1K731 1VQ81 2OTL1 3CD6Z 1Q861 3I561 3OW2Z 1VQ71 1VQ8Z 1VQ9Z 1NJI2 1Q7Y1 1N8R2 1VQNZ 1VQ51 3CCQ1 1VQP1 1M1K2 1VQ91 1S72Z 2QEXZ 3CCLZ 2QA41 3CCSZ 1W2BY 3CC21 1QVGY 1S721 2OTJZ 3G6EZ 1KC81 1M902 1VQLZ 3CC71 3G6E1 1JJ2Z 1YIJ1 3I551 3CC41 1K9M2 1M901 1K8A1 1QVGZ 1YI21 3G711 3CMEZ 3CCR1 3CCUZ 3CCMZ 1M1K1 1JJ2Y 1YHQ1 2QA4Z 3CCV1 3CCS1 1KQSY 3CCVZ 3CXCZ 2OTJ1
chains in the Genus database with same CATH superfamily
3I56Z 3CCEZ 3CCM1 2P3YA 1K9M1 1VQL1 2OTLZ 4E33A 3I07A 3GCFA 4A3II 3HOUI 4E31A 3CC2Z 2DE7A 3OW2Y 3K7AI 1Q7Y2 2IZ3A 4NBHA 3CXCY 3J80b 1DL6A 1WIIA 5T6BA 1QF8A 4E32A 2VPXA 3VTNA 5D1OB 1YJWZ 4MONA 3I55Z 1YJN1 5D1OA 4Y52I 1K83I 3VMHA 3GTJI 2RPRA 1VQK1 3QWUA 2HU9A 5AN9F 2M6NA 3S16I 3HKZA 2M48A 1RLYA 1WJ2A 1VQPZ 3MZKB 2NVYI 2QEX1 3CCL1 1VQ81 3CD6Z 1Y1VS 1KRLA 4QTUA 3S1NI 1NJI2 3Q87A 1Q7Y1 1N8R2 3TE5B 1PFTA 1Y1VI 2NVXI 2Q4ZA 5A2Qf 1Y1WI 2HF1A 1Z02A 5LL6f 1VQ91 1M1K2 2OOXB 1NP6A 4E30A 1QVGY 3I4MI 2GU2A 1S721 3HOYI 2P28A 1I6HI 1VQLZ 3CC71 3D9XA 1P9NA 2JR6A 4TNUA 3CC41 5IT9b 1YI21 3KIFA 3EEDA 2RHBA 4A3EI 2JA5I 5IP7I 3CCMZ 5FLMI 4E2XA 1KQSY 2F4OA 3CCVZ 2V8JA 3CXCZ 2OTL1 3NDIA 2IZ4A 2J6AA 3D2LA 3G4SZ 3CCU1 1KC82 4BY7I 2V8IA 1ZB9A 3PO2I 1NUIA 1TWHI 3VMGA 4BBRI 1VQ5Z 1VQ4Z 3CMA1 1YUAA 3IF8A 3T4NB 1YJNZ 1YJ9Z 1KD11 4NOZA 1USPB 3CD61 4DK1A 1TWAI 3CCJZ 1USPA 3CC7Z 2JIMA 4DQYB 1VQOZ 2V3VA 3S15I 3S1MI 3MONA 3EERA 3NDJA 2JIRA 4MH4A 1VQM1 1YJW1 2VUGA 3HOVI 3G71Z 1RNIA 1TWFI 4NBBA 2RT9A 2WB1A 2VPYA 4NBEA 2V45A 3KIHA 3RZDI 3S2DI 2BJOA 1VQN1 4NBDA 1VQKZ 1K731 2GTHA 2VUMI 1Q861 2I3CA 3OW2Z 3S1QI 4HGZA 3BG0B 1VQ8Z 3GTLI 1N2FA 2O53A 3J80f 2KPIA 4NB8A 1ML8A 1ZH1A 3CCLZ 4RVGA 4NBCA 2QEXZ 1S72Z 4A3LI 1SFOI 3H3VJ 2DE5A 2Y0SA 3JAMb 4HGYA 4MD7A 1Z03A 1KC81 1M902 3G6E1 1JJ2Z 3CQZI 1SIWA 3IR7A 3GTPI 3FKII 4A3BI 2QKDA 4NBAA 1K9M2 1K8A1 1Z01A 4MXUA 3G711 3CMEZ 3I4NI 2YU9I 3D6WA 3JAMf 2NVQI 4Y7NI 3S1RI 2AKLA 3CCV1 3ESWA 2QRDB 3VMIA 2K5RA 2QLVB 2OTJ1 2JNYA 1RQFA 2LFUA 1YJ91 3GTQI 2RBLA 4A3FI 1K8A2 3NH4A 1VQ41 1NJI1 3CCJ1 3G4S1 4A3MI 2E2JI 2JIQA 2OZKA 3P5JB 2VF1A 1YI2Z 1Q822 5IT9f 3CMAZ 1N8R1 4RVHA 4E2YA 1VQO1 2PK7A 5C4XI 1YIT1 1X3WA 1YHQZ 2E2HI 2LIYA 1KQSZ 3S2HI 1Q812 4BY1I 3VB9A 3NH8A 2Q51A 2W03A 1QVFZ 4NH1C 1WCMI 2QREB 4HH4A 1K732 1VQ7Z 1RO4A 5T67A 2O4HA 3H0GI 3HOWI 1QXFA 1VQMZ 1VQ6Z 4A3JI 2GTIA 1W2BZ 5CM2M 1VLAA 2H85A 2W04A 5IP9I 3I561 4A93I 4BXXI 2K3RA 1VQNZ 2QR1B 4MD8A 3FQMA 3CCSZ 4A3KI 3GTGI 2R7ZI 2OTJZ 1RO0A 3BG1B 3G6EZ 5C44I 4NBFA 2RIQA 3FQQA 1QYPA 1YIJ1 4QTTA 2NVTI 2OOYB 3HOZI 4NBGA 5FLXb 4NFRA 2VPZA 2JS4A 2ZAEB 3GTMS 2VPWA 1WZNA 1S7MA 3MZLB 2LEXA 1M1K1 2NAPA 1YHQ1 2QA4Z 4A3GI 5FLXf 2IV2X 3GTKI 3GTMI 5A2Qb 1TWGI 3S17I 3PO3I 4MRIA 2B63I 5C3EI 2PM9A 3CCE1 4RV9A 5T64A 4A3DI 3PO3S 1YITZ 3CCQZ 1Q862 2JIPA 1VQ61 4RS4A 3U50C 1QVFY 3GKQA 3CCRZ 1Q811 3J81b 3F3PC 4AYBA 3CPWY 2PMZA 3CC4Z 3NH5A 2JMOA 2G2KA 3CME1 1FDIA 2E2II 4E2ZA 1Q821 2JIOA 2WAQA 3F3FC 3J7A4 3CPWZ 1R9TI 1TFIA 3S14I 2E7ZA 1Q16A 1YIJZ 1KD12 1WW9A 2JA7I 4E2WA 5C4JI 2KI7B 1VQ71 2JUBA 1VQ9Z 1ZB8A 2EGTA 1LQLA 3IFUA 3GTOI 1VQ51 2AYDA 3CCQ1 1VQP1 4MD9A 2QA41 1W2BY 3CC21 4X6AI 2R6MA 1YUKA 3TDHB 2F4MA 4RVDA 4BBSI 4DGLA 3HOXI 3IX0A 1I3QI 3J81f 1Y8CA 3RZOI 3I551 2R93I 4A3CI 1M901 1TWCI 1L1OC 4XX2A 1QVGZ 3M3YI 4EWCA 4RVFA 1X0TA 1I50I 3LUSA 5D1PA 4S1TA 2DE6A 3CCR1 3CCUZ 1JWHC 1RO2A 2JA8I 1X3ZA 1JJ2Y 4CL1A 2YADA 1FDOA 3CCS1 2E9HA 2QRCB 2V8KA 2JA6I 2R92I 1AA6A 3NFZA 3M4OI 4NB9A
chains in the Genus database with same CATH topology
3I56Z 3CCEZ 3CCM1 2P3YA 1K9M1 1VQL1 2OTLZ 4E33A 3I07A 3GCFA 4A3II 3HOUI 4E31A 3CC2Z 2DE7A 3OW2Y 3K7AI 1Q7Y2 2IZ3A 4NBHA 3CXCY 3J80b 1DL6A 1WIIA 5T6BA 1QF8A 4E32A 3VTNA 5D1OB 1YJWZ 4MONA 3I55Z 1YJN1 5D1OA 4Y52I 1K83I 3VMHA 3GTJI 2RPRA 1VQK1 3QWUA 2HU9A 5AN9F 2M6NA 3S16I 3HKZA 2M48A 1RLYA 1VQPZ 3MZKB 2NVYI 2QEX1 3CCL1 1VQ81 3CD6Z 1Y1VS 1KRLA 4QTUA 3S1NI 1NJI2 3Q87A 1Q7Y1 1N8R2 3TE5B 1PFTA 1Y1VI 2NVXI 2Q4ZA 5A2Qf 1Y1WI 2HF1A 1Z02A 5LL6f 1VQ91 1M1K2 2OOXB 1NP6A 4E30A 1QVGY 3I4MI 2GU2A 1S721 3HOYI 2P28A 1I6HI 1VQLZ 3CC71 3D9XA 1P9NA 2JR6A 4TNUA 3CC41 5IT9b 1YI21 3KIFA 3EEDA 2RHBA 4A3EI 2JA5I 5IP7I 3CCMZ 5FLMI 4E2XA 1KQSY 2F4OA 3CCVZ 2V8JA 3CXCZ 2OTL1 3NDIA 2IZ4A 2J6AA 3G4SZ 3CCU1 1KC82 4BY7I 2V8IA 1ZB9A 3PO2I 1NUIA 1TWHI 3VMGA 4BBRI 1VQ5Z 1VQ4Z 3CMA1 1YUAA 3IF8A 3T4NB 1YJNZ 1YJ9Z 1KD11 4NOZA 1USPB 3CD61 4DK1A 1TWAI 3CCJZ 1USPA 3CC7Z 4DQYB 1VQOZ 3S15I 3S1MI 3MONA 3EERA 3NDJA 4MH4A 1VQM1 1YJW1 2VUGA 3HOVI 3G71Z 1RNIA 1TWFI 4NBBA 2RT9A 2WB1A 4NBEA 3KIHA 3RZDI 3S2DI 2BJOA 1VQN1 4NBDA 1VQKZ 1K731 2GTHA 2VUMI 1Q861 2I3CA 3OW2Z 3S1QI 4HGZA 3BG0B 1VQ8Z 3GTLI 1N2FA 2O53A 3J80f 2KPIA 4NB8A 1ML8A 1ZH1A 3CCLZ 4RVGA 4NBCA 2QEXZ 1S72Z 4A3LI 1SFOI 3H3VJ 2DE5A 2Y0SA 3JAMb 4HGYA 4MD7A 1Z03A 1KC81 1M902 3G6E1 1JJ2Z 3CQZI 3GTPI 3FKII 4A3BI 2QKDA 4NBAA 1K9M2 1K8A1 1Z01A 4MXUA 3G711 3CMEZ 3I4NI 2YU9I 3D6WA 3JAMf 2NVQI 4Y7NI 3S1RI 2AKLA 3CCV1 3ESWA 2QRDB 3VMIA 2K5RA 2QLVB 2OTJ1 2JNYA 1RQFA 2LFUA 1YJ91 3GTQI 2RBLA 4A3FI 1K8A2 3NH4A 1VQ41 1NJI1 3CCJ1 3G4S1 4A3MI 2E2JI 2OZKA 3P5JB 2VF1A 1YI2Z 1Q822 5IT9f 3CMAZ 1N8R1 4RVHA 4E2YA 1VQO1 2PK7A 5C4XI 1YIT1 1X3WA 1YHQZ 2E2HI 2LIYA 1KQSZ 3S2HI 1Q812 4BY1I 3VB9A 3NH8A 2Q51A 2W03A 1QVFZ 4NH1C 1WCMI 2QREB 4HH4A 1K732 1VQ7Z 1RO4A 5T67A 2O4HA 3H0GI 3HOWI 1VQMZ 1VQ6Z 4A3JI 2GTIA 1W2BZ 5CM2M 1VLAA 2H85A 2W04A 5IP9I 3I561 4A93I 4BXXI 2K3RA 1VQNZ 2QR1B 4MD8A 3FQMA 3CCSZ 4A3KI 3GTGI 2R7ZI 2OTJZ 1RO0A 3BG1B 3G6EZ 5C44I 4NBFA 2RIQA 3FQQA 1QYPA 1YIJ1 4QTTA 2NVTI 2OOYB 3HOZI 4NBGA 5FLXb 4NFRA 2JS4A 2ZAEB 3GTMS 1S7MA 3MZLB 1M1K1 1YHQ1 2QA4Z 4A3GI 5FLXf 3GTKI 3GTMI 5A2Qb 1TWGI 3S17I 3PO3I 4MRIA 2B63I 5C3EI 2PM9A 3CCE1 4RV9A 5T64A 4A3DI 3PO3S 1YITZ 3CCQZ 1Q862 1VQ61 4RS4A 3U50C 1QVFY 3GKQA 1Q811 3CCRZ 3J81b 3F3PC 4AYBA 3CPWY 2PMZA 3CC4Z 3NH5A 2JMOA 2G2KA 3CME1 2E2II 4E2ZA 1Q821 2WAQA 3F3FC 3J7A4 3CPWZ 1R9TI 1TFIA 3S14I 1YIJZ 1KD12 1WW9A 2JA7I 4E2WA 5C4JI 2KI7B 1VQ71 2JUBA 1VQ9Z 1ZB8A 2EGTA 1LQLA 3IFUA 3GTOI 1VQ51 3CCQ1 1VQP1 4MD9A 2QA41 1W2BY 3CC21 4X6AI 2R6MA 1YUKA 3TDHB 2F4MA 4RVDA 4BBSI 4DGLA 3HOXI 3IX0A 1I3QI 3J81f 3RZOI 3I551 2R93I 4A3CI 1M901 1TWCI 1L1OC 4XX2A 1QVGZ 3M3YI 4EWCA 4RVFA 1X0TA 1I50I 3LUSA 5D1PA 4S1TA 2DE6A 3CCR1 3CCUZ 1JWHC 1RO2A 2JA8I 1X3ZA 1JJ2Y 4CL1A 2YADA 3CCS1 2E9HA 2QRCB 2V8KA 2JA6I 2R92I 3NFZA 3M4OI 4NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Z;  3G4S Z;  3CCE Z;  3CCU 1;  1YJ9 1;  3CCM 1;  1KC8 2;  1K8A 2;  1K9M 1;  1VQL 1;  2OTL Z;  1VQ4 1;  1NJI 1;  3CCJ 1;  3G4S 1;  3CCE 1;  1VQ5 Z;  1YIT Z;  3CCQ Z;  1VQ4 Z;  3CMA 1;  1Q86 2;  3CC2 Z;  1Q82 2;  1YI2 Z;  1VQ6 1;  1YJN Z;  1YJ9 Z;  1KD1 1;  3CMA Z;  3OW2 Y;  1N8R 1;  1QVF Y;  3CD6 1;  1Q7Y 2;  1VQO 1;  3CCJ Z;  3CCR Z;  3CXC Y;  1Q81 1;  3CC7 Z;  1YIT 1;  3CPW Y;  1YHQ Z;  1VQO Z;  1YJW Z;  1KQS Z;  3I55 Z;  3CC4 Z;  1YJN 1;  1Q81 2;  1VQM 1;  1YJW 1;  1VQK 1;  3G71 Z;  1QVF Z;  3CME 1;  1K73 2;  1Q82 1;  1VQ7 Z;  3CPW Z;  1YIJ Z;  1VQN 1;  1VQM Z;  1VQ6 Z;  1KD1 2;  1VQP Z;  1W2B Z;  1VQK Z;  2QEX 1;  3CCL 1;  1K73 1;  1VQ8 1;  2OTL 1;  3CD6 Z;  1Q86 1;  3I56 1;  3OW2 Z;  1VQ7 1;  1VQ8 Z;  1VQ9 Z;  1NJI 2;  1Q7Y 1;  1N8R 2;  1VQN Z;  1VQ5 1;  3CCQ 1;  1VQP 1;  1M1K 2;  1VQ9 1;  1S72 Z;  2QEX Z;  3CCL Z;  2QA4 1;  3CCS Z;  1W2B Y;  3CC2 1;  1QVG Y;  1S72 1;  2OTJ Z;  3G6E Z;  1KC8 1;  1M90 2;  1VQL Z;  3CC7 1;  3G6E 1;  1JJ2 Z;  1YIJ 1;  3I55 1;  3CC4 1;  1K9M 2;  1M90 1;  1K8A 1;  1QVG Z;  1YI2 1;  3G71 1;  3CME Z;  3CCR 1;  3CCU Z;  3CCM Z;  1M1K 1;  1JJ2 Y;  1YHQ 1;  2QA4 Z;  3CCV 1;  3CCS 1;  1KQS Y;  3CCV Z;  3CXC Z;  2OTJ 1; 
#chains in the Genus database with same CATH topology
 3I56 Z;  3CCE Z;  3CCM 1;  2P3Y A;  1K9M 1;  1VQL 1;  2OTL Z;  4E33 A;  3I07 A;  3GCF A;  4A3I I;  3HOU I;  4E31 A;  3CC2 Z;  2DE7 A;  3OW2 Y;  3K7A I;  1Q7Y 2;  2IZ3 A;  4NBH A;  3CXC Y;  3J80 b;  1DL6 A;  1WII A;  5T6B A;  1QF8 A;  4E32 A;  2VPX A;  3VTN A;  5D1O B;  1YJW Z;  4MON A;  3I55 Z;  1YJN 1;  5D1O A;  4Y52 I;  1K83 I;  3VMH A;  3GTJ I;  2RPR A;  1VQK 1;  3QWU A;  2HU9 A;  5AN9 F;  2M6N A;  3S16 I;  3HKZ A;  2M48 A;  1RLY A;  1WJ2 A;  1VQP Z;  3MZK B;  2NVY I;  2QEX 1;  3CCL 1;  1VQ8 1;  3CD6 Z;  1Y1V S;  1KRL A;  4QTU A;  3S1N I;  1NJI 2;  3Q87 A;  1Q7Y 1;  1N8R 2;  3TE5 B;  1PFT A;  1Y1V I;  2NVX I;  2Q4Z A;  5A2Q f;  1Y1W I;  2HF1 A;  1Z02 A;  5LL6 f;  1VQ9 1;  1M1K 2;  2OOX B;  1NP6 A;  4E30 A;  1QVG Y;  3I4M I;  2GU2 A;  1S72 1;  3HOY I;  2P28 A;  1I6H I;  1VQL Z;  3CC7 1;  3D9X A;  1P9N A;  2JR6 A;  4TNU A;  3CC4 1;  5IT9 b;  1YI2 1;  3KIF A;  3EED A;  2RHB A;  4A3E I;  2JA5 I;  5IP7 I;  3CCM Z;  5FLM I;  4E2X A;  1KQS Y;  2F4O A;  3CCV Z;  2V8J A;  3CXC Z;  2OTL 1;  3NDI A;  2IZ4 A;  2J6A A;  3D2L A;  3G4S Z;  3CCU 1;  1KC8 2;  4BY7 I;  2V8I A;  1ZB9 A;  3PO2 I;  1NUI A;  1TWH I;  3VMG A;  4BBR I;  1VQ5 Z;  1VQ4 Z;  3CMA 1;  1YUA A;  3IF8 A;  3T4N B;  1YJN Z;  1YJ9 Z;  1KD1 1;  4NOZ A;  1USP B;  3CD6 1;  4DK1 A;  1TWA I;  3CCJ Z;  1USP A;  3CC7 Z;  2JIM A;  4DQY B;  1VQO Z;  2V3V A;  3S15 I;  3S1M I;  3MON A;  3EER A;  3NDJ A;  2JIR A;  4MH4 A;  1VQM 1;  1YJW 1;  2VUG A;  3HOV I;  3G71 Z;  1RNI A;  1TWF I;  4NBB A;  2RT9 A;  2WB1 A;  2VPY A;  4NBE A;  2V45 A;  3KIH A;  3RZD I;  3S2D I;  2BJO A;  1VQN 1;  4NBD A;  1VQK Z;  1K73 1;  2GTH A;  2VUM I;  1Q86 1;  2I3C A;  3OW2 Z;  3S1Q I;  4HGZ A;  3BG0 B;  1VQ8 Z;  3GTL I;  1N2F A;  2O53 A;  3J80 f;  2KPI A;  4NB8 A;  1ML8 A;  1ZH1 A;  3CCL Z;  4RVG A;  4NBC A;  2QEX Z;  1S72 Z;  4A3L I;  1SFO I;  3H3V J;  2DE5 A;  2Y0S A;  3JAM b;  4HGY A;  4MD7 A;  1Z03 A;  1KC8 1;  1M90 2;  3G6E 1;  1JJ2 Z;  3CQZ I;  1SIW A;  3IR7 A;  3GTP I;  3FKI I;  4A3B I;  2QKD A;  4NBA A;  1K9M 2;  1K8A 1;  1Z01 A;  4MXU A;  3G71 1;  3CME Z;  3I4N I;  2YU9 I;  3D6W A;  3JAM f;  2NVQ I;  4Y7N I;  3S1R I;  2AKL A;  3CCV 1;  3ESW A;  2QRD B;  3VMI A;  2K5R A;  2QLV B;  2OTJ 1;  2JNY A;  1RQF A;  2LFU A;  1YJ9 1;  3GTQ I;  2RBL A;  4A3F I;  1K8A 2;  3NH4 A;  1VQ4 1;  1NJI 1;  3CCJ 1;  3G4S 1;  4A3M I;  2E2J I;  2JIQ A;  2OZK A;  3P5J B;  2VF1 A;  1YI2 Z;  1Q82 2;  5IT9 f;  3CMA Z;  1N8R 1;  4RVH A;  4E2Y A;  1VQO 1;  2PK7 A;  5C4X I;  1YIT 1;  1X3W A;  1YHQ Z;  2E2H I;  2LIY A;  1KQS Z;  3S2H I;  1Q81 2;  4BY1 I;  3VB9 A;  3NH8 A;  2Q51 A;  2W03 A;  1QVF Z;  4NH1 C;  1WCM I;  2QRE B;  4HH4 A;  1K73 2;  1VQ7 Z;  1RO4 A;  5T67 A;  2O4H A;  3H0G I;  3HOW I;  1QXF A;  1VQM Z;  1VQ6 Z;  4A3J I;  2GTI A;  1W2B Z;  5CM2 M;  1VLA A;  2H85 A;  2W04 A;  5IP9 I;  3I56 1;  4A93 I;  4BXX I;  2K3R A;  1VQN Z;  2QR1 B;  4MD8 A;  3FQM A;  3CCS Z;  4A3K I;  3GTG I;  2R7Z I;  2OTJ Z;  1RO0 A;  3BG1 B;  3G6E Z;  5C44 I;  4NBF A;  2RIQ A;  3FQQ A;  1QYP A;  1YIJ 1;  4QTT A;  2NVT I;  2OOY B;  3HOZ I;  4NBG A;  5FLX b;  4NFR A;  2VPZ A;  2JS4 A;  2ZAE B;  3GTM S;  2VPW A;  1WZN A;  1S7M A;  3MZL B;  2LEX A;  1M1K 1;  2NAP A;  1YHQ 1;  2QA4 Z;  4A3G I;  5FLX f;  2IV2 X;  3GTK I;  3GTM I;  5A2Q b;  1TWG I;  3S17 I;  3PO3 I;  4MRI A;  2B63 I;  5C3E I;  2PM9 A;  3CCE 1;  4RV9 A;  5T64 A;  4A3D I;  3PO3 S;  1YIT Z;  3CCQ Z;  1Q86 2;  2JIP A;  1VQ6 1;  4RS4 A;  3U50 C;  1QVF Y;  3GKQ A;  3CCR Z;  1Q81 1;  3J81 b;  3F3P C;  4AYB A;  3CPW Y;  2PMZ A;  3CC4 Z;  3NH5 A;  2JMO A;  2G2K A;  3CME 1;  1FDI A;  2E2I I;  4E2Z A;  1Q82 1;  2JIO A;  2WAQ A;  3F3F C;  3J7A 4;  3CPW Z;  1R9T I;  1TFI A;  3S14 I;  2E7Z A;  1Q16 A;  1YIJ Z;  1KD1 2;  1WW9 A;  2JA7 I;  4E2W A;  5C4J I;  2KI7 B;  1VQ7 1;  2JUB A;  1VQ9 Z;  1ZB8 A;  2EGT A;  1LQL A;  3IFU A;  3GTO I;  1VQ5 1;  2AYD A;  3CCQ 1;  1VQP 1;  4MD9 A;  2QA4 1;  1W2B Y;  3CC2 1;  4X6A I;  2R6M A;  1YUK A;  3TDH B;  2F4M A;  4RVD A;  4BBS I;  4DGL A;  3HOX I;  3IX0 A;  1I3Q I;  3J81 f;  1Y8C A;  3RZO I;  3I55 1;  2R93 I;  4A3C I;  1M90 1;  1TWC I;  1L1O C;  4XX2 A;  1QVG Z;  3M3Y I;  4EWC A;  4RVF A;  1X0T A;  1I50 I;  3LUS A;  5D1P A;  4S1T A;  2DE6 A;  3CCR 1;  3CCU Z;  1JWH C;  1RO2 A;  2JA8 I;  1X3Z A;  1JJ2 Y;  4CL1 A;  2YAD A;  1FDO A;  3CCS 1;  2E9H A;  2QRC B;  2V8K A;  2JA6 I;  2R92 I;  1AA6 A;  3NFZ A;  3M4O I;  4NB9 A; 
#chains in the Genus database with same CATH homology
 3I56 Z;  3CCE Z;  3CCM 1;  2P3Y A;  1K9M 1;  1VQL 1;  2OTL Z;  4E33 A;  3I07 A;  3GCF A;  4A3I I;  3HOU I;  4E31 A;  3CC2 Z;  2DE7 A;  3OW2 Y;  3K7A I;  1Q7Y 2;  2IZ3 A;  4NBH A;  3CXC Y;  3J80 b;  1DL6 A;  1WII A;  5T6B A;  1QF8 A;  4E32 A;  3VTN A;  5D1O B;  1YJW Z;  4MON A;  3I55 Z;  1YJN 1;  5D1O A;  4Y52 I;  1K83 I;  3VMH A;  3GTJ I;  2RPR A;  1VQK 1;  3QWU A;  2HU9 A;  5AN9 F;  2M6N A;  3S16 I;  3HKZ A;  2M48 A;  1RLY A;  1VQP Z;  3MZK B;  2NVY I;  2QEX 1;  3CCL 1;  1VQ8 1;  3CD6 Z;  1Y1V S;  1KRL A;  4QTU A;  3S1N I;  1NJI 2;  3Q87 A;  1Q7Y 1;  1N8R 2;  3TE5 B;  1PFT A;  1Y1V I;  2NVX I;  2Q4Z A;  5A2Q f;  1Y1W I;  2HF1 A;  1Z02 A;  5LL6 f;  1VQ9 1;  1M1K 2;  2OOX B;  1NP6 A;  4E30 A;  1QVG Y;  3I4M I;  2GU2 A;  1S72 1;  3HOY I;  2P28 A;  1I6H I;  1VQL Z;  3CC7 1;  3D9X A;  1P9N A;  2JR6 A;  4TNU A;  3CC4 1;  5IT9 b;  1YI2 1;  3KIF A;  3EED A;  2RHB A;  4A3E I;  2JA5 I;  5IP7 I;  3CCM Z;  5FLM I;  4E2X A;  1KQS Y;  2F4O A;  3CCV Z;  2V8J A;  3CXC Z;  2OTL 1;  3NDI A;  2IZ4 A;  2J6A A;  3G4S Z;  3CCU 1;  1KC8 2;  4BY7 I;  2V8I A;  1ZB9 A;  3PO2 I;  1NUI A;  1TWH I;  3VMG A;  4BBR I;  1VQ5 Z;  1VQ4 Z;  3CMA 1;  1YUA A;  3IF8 A;  3T4N B;  1YJN Z;  1YJ9 Z;  1KD1 1;  4NOZ A;  1USP B;  3CD6 1;  4DK1 A;  1TWA I;  3CCJ Z;  1USP A;  3CC7 Z;  4DQY B;  1VQO Z;  3S15 I;  3S1M I;  3MON A;  3EER A;  3NDJ A;  4MH4 A;  1VQM 1;  1YJW 1;  2VUG A;  3HOV I;  3G71 Z;  1RNI A;  1TWF I;  4NBB A;  2RT9 A;  2WB1 A;  4NBE A;  3KIH A;  3RZD I;  3S2D I;  2BJO A;  1VQN 1;  4NBD A;  1VQK Z;  1K73 1;  2GTH A;  2VUM I;  1Q86 1;  2I3C A;  3OW2 Z;  3S1Q I;  4HGZ A;  3BG0 B;  1VQ8 Z;  3GTL I;  1N2F A;  2O53 A;  3J80 f;  2KPI A;  4NB8 A;  1ML8 A;  1ZH1 A;  3CCL Z;  4RVG A;  4NBC A;  2QEX Z;  1S72 Z;  4A3L I;  1SFO I;  3H3V J;  2DE5 A;  2Y0S A;  3JAM b;  4HGY A;  4MD7 A;  1Z03 A;  1KC8 1;  1M90 2;  3G6E 1;  1JJ2 Z;  3CQZ I;  3GTP I;  3FKI I;  4A3B I;  2QKD A;  4NBA A;  1K9M 2;  1K8A 1;  1Z01 A;  4MXU A;  3G71 1;  3CME Z;  3I4N I;  2YU9 I;  3D6W A;  3JAM f;  2NVQ I;  4Y7N I;  3S1R I;  2AKL A;  3CCV 1;  3ESW A;  2QRD B;  3VMI A;  2K5R A;  2QLV B;  2OTJ 1;  2JNY A;  1RQF A;  2LFU A;  1YJ9 1;  3GTQ I;  2RBL A;  4A3F I;  1K8A 2;  3NH4 A;  1VQ4 1;  1NJI 1;  3CCJ 1;  3G4S 1;  4A3M I;  2E2J I;  2OZK A;  3P5J B;  2VF1 A;  1YI2 Z;  1Q82 2;  5IT9 f;  3CMA Z;  1N8R 1;  4RVH A;  4E2Y A;  1VQO 1;  2PK7 A;  5C4X I;  1YIT 1;  1X3W A;  1YHQ Z;  2E2H I;  2LIY A;  1KQS Z;  3S2H I;  1Q81 2;  4BY1 I;  3VB9 A;  3NH8 A;  2Q51 A;  2W03 A;  1QVF Z;  4NH1 C;  1WCM I;  2QRE B;  4HH4 A;  1K73 2;  1VQ7 Z;  1RO4 A;  5T67 A;  2O4H A;  3H0G I;  3HOW I;  1VQM Z;  1VQ6 Z;  4A3J I;  2GTI A;  1W2B Z;  5CM2 M;  1VLA A;  2H85 A;  2W04 A;  5IP9 I;  3I56 1;  4A93 I;  4BXX I;  2K3R A;  1VQN Z;  2QR1 B;  4MD8 A;  3FQM A;  3CCS Z;  4A3K I;  3GTG I;  2R7Z I;  2OTJ Z;  1RO0 A;  3BG1 B;  3G6E Z;  5C44 I;  4NBF A;  2RIQ A;  3FQQ A;  1QYP A;  1YIJ 1;  4QTT A;  2NVT I;  2OOY B;  3HOZ I;  4NBG A;  5FLX b;  4NFR A;  2JS4 A;  2ZAE B;  3GTM S;  1S7M A;  3MZL B;  1M1K 1;  1YHQ 1;  2QA4 Z;  4A3G I;  5FLX f;  3GTK I;  3GTM I;  5A2Q b;  1TWG I;  3S17 I;  3PO3 I;  4MRI A;  2B63 I;  5C3E I;  2PM9 A;  3CCE 1;  4RV9 A;  5T64 A;  4A3D I;  3PO3 S;  1YIT Z;  3CCQ Z;  1Q86 2;  1VQ6 1;  4RS4 A;  3U50 C;  1QVF Y;  3GKQ A;  1Q81 1;  3CCR Z;  3J81 b;  3F3P C;  4AYB A;  3CPW Y;  2PMZ A;  3CC4 Z;  3NH5 A;  2JMO A;  2G2K A;  3CME 1;  2E2I I;  4E2Z A;  1Q82 1;  2WAQ A;  3F3F C;  3J7A 4;  3CPW Z;  1R9T I;  1TFI A;  3S14 I;  1YIJ Z;  1KD1 2;  1WW9 A;  2JA7 I;  4E2W A;  5C4J I;  2KI7 B;  1VQ7 1;  2JUB A;  1VQ9 Z;  1ZB8 A;  2EGT A;  1LQL A;  3IFU A;  3GTO I;  1VQ5 1;  3CCQ 1;  1VQP 1;  4MD9 A;  2QA4 1;  1W2B Y;  3CC2 1;  4X6A I;  2R6M A;  1YUK A;  3TDH B;  2F4M A;  4RVD A;  4BBS I;  4DGL A;  3HOX I;  3IX0 A;  1I3Q I;  3J81 f;  3RZO I;  3I55 1;  2R93 I;  4A3C I;  1M90 1;  1TWC I;  1L1O C;  4XX2 A;  1QVG Z;  3M3Y I;  4EWC A;  4RVF A;  1X0T A;  1I50 I;  3LUS A;  5D1P A;  4S1T A;  2DE6 A;  3CCR 1;  3CCU Z;  1JWH C;  1RO2 A;  2JA8 I;  1X3Z A;  1JJ2 Y;  4CL1 A;  2YAD A;  3CCS 1;  2E9H A;  2QRC B;  2V8K A;  2JA6 I;  2R92 I;  3NFZ A;  3M4O I;  4NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...