2R93I

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I02
3U50C 2NVXI 3ESWA 4BY1I 4Y52I 2PK7A 4NBAA 4Y7NI 3HOWI 5CM2M 3VMIA 2R92I 3PO3S 3GTKI 2JNYA 2KPIA 1TWGI 1I50I 1LQLA 2AKLA 1R9TI 3GTJI 5FLMI 2JA6I 3D6WA 1L1OC 3GTMI 3S14I 4A3MI 1PFTA 3GTGI 1TWHI 4A3BI 4QTTA 3VB9A 4XX2A 4NBCA 3I4NI 3S1NI 4A3CI 2E2HI 1K83I 1TFIA 2JA5I 3K7AI 3Q87A 2DE5A 3HOXI 2E2JI 3S1RI 3HOUI 1ML8A 4NBHA 2R7ZI 1TWCI 4BXXI 1WW9A 4NOZA 2NVQI 1TWFI 2YU9I 1USPA 2VUMI 2P3YA 4A93I 3VMGA 4BBRI 1I3QI 2NVTI 3S15I 1DL6A 3PO3I 4A3GI 5C3EI 4NB8A 4QTUA 2JA8I 3S17I 3GTOI 3HOYI 3RZOI 2JR6A 3RZDI 2JS4A 3GKQA 3GTLI 2J6AA 2HF1A 1ZB8A 1VLAA 1I6HI 3PO2I 1Y1VS 3CQZI 3LUSA 1RLYA 3EERA 3I07A 4A3FI 4NBFA 4MH4A 4A3EI 3S1QI 5C4XI 4X6AI 3FKII 1WCMI 4NBBA 2BJOA 2RBLA 4NBGA 3GTPI 3GCFA 5IP9I 3H3VJ 5IP7I 3HOZI 4NB9A 2F4MA 5C4JI 1NUIA 5C44I 3I4MI 2F4OA 1RO4A 1TWAI 1SFOI 4A3JI 4A3II 3S1MI 3GTMS 1X3WA 3VMHA 3M3YI 2B63I 3S2DI 4BBSI 2DE6A 3H0GI 4BY7I 2K5RA 3M4OI 2E2II 4A3DI 2NVYI 4NBEA 1USPB 4NBDA 2DE7A 1QYPA 4A3LI 1Y1VI 3S2HI 2R93I 1Y1WI 2JA7I 3HOVI 3S16I 4A3KI 1ZB9A 1X3ZA 1N2FA 1YUAA 3GTQI
chains in the Genus database with same CATH superfamily
3CME1 2R6MA 2V8IA 4BY1I 4Y7NI 3HOWI 3VMIA 3IR7A 1WIIA 3CCUZ 2PMZA 4NFRA 3G6E1 1YHQZ 2RIQA 3D6WA 3F3PC 1K9M2 1M901 1Q822 1QXFA 4A3MI 1PFTA 4DK1A 3VB9A 1QVFZ 3I4NI 1N8R2 2E9HA 1VQ8Z 1YITZ 3Q87A 3HOXI 3S1RI 1FDOA 1YUKA 4NBHA 1WW9A 3CCV1 3NDIA 1TWFI 1USPA 3CXCZ 3CCEZ 2VUMI 2V3VA 2P3YA 4BBRI 1I3QI 3G71Z 4A3GI 2JUBA 2AYDA 4QTUA 1JWHC 3S17I 3GTOI 1VQP1 1Z02A 2JR6A 2HF1A 1ZB8A 2JIOA 1VQ5Z 5D1OA 4TNUA 3G4SZ 4A3FI 4DGLA 1Q812 4NBFA 4A3EI 5C4XI 4MD9A 1VQ91 2JIMA 2E7ZA 1KC81 2W04A 2WAQA 4NB9A 1QVGZ 3EEDA 5C4JI 1YJ91 3CMA1 1NUIA 2VPZA 1P9NA 2JIPA 5T6BA 3IF8A 3CCQZ 3S1MI 2ZAEB 2QRDB 2K5RA 3M4OI 3CCJ1 4A3DI 4NBEA 2Q4ZA 3S2HI 1W2BZ 1VQ61 1Z01A 2HU9A 3S16I 2O4HA 1YUAA 3GTQI 1VQM1 5IT9b 1QVGY 1M1K2 1Q862 2H85A 2EGTA 2QREB 3J80b 2R92I 1VQ7Z 3GTKI 2JNYA 2KPIA 2JIRA 1VQKZ 2WB1A 1I50I 1LQLA 4DQYB 2LEXA 4AYBA 3GTJI 5FLMI 1S721 1Q7Y2 3GTGI 1TWHI 3S1NI 3IX0A 4E2YA 2QR1B 2E2HI 2OTL1 3CC4Z 3G6EZ 2JIQA 2QA41 2E2JI 4BXXI 1TWCI 1S7MA 1RO0A 3CCS1 2JMOA 1RO2A 3CCM1 2NVQI 3P5JB 2YU9I 1KRLA 3VTNA 2YADA 2PM9A 2KI7B 1VQ41 1KD12 1VQO1 3VMGA 2NVTI 3J81b 3PO3I 5A2Qb 1WZNA 5C3EI 1YIJZ 1VQN1 3FQMA 2VF1A 1NJI1 3RZOI 4MD7A 3GKQA 3GTLI 2J6AA 2RHBA 3KIFA 3J80f 1VLAA 1YJN1 3PO2I 1K732 1K8A2 4E31A 1FDIA 4S1TA 3EERA 3I07A 5AN9F 1VQPZ 1NP6A 2OTJ1 4X6AI 3I55Z 4NBBA 1KQSZ 2RBLA 2VPXA 3GCFA 3CCU1 3F3FC 3CCR1 4MD8A 4RV9A 1QVFY 3NFZA 1VQ9Z 2VPYA 3I4MI 2Q51A 4A3JI 3CPWZ 1X3WA 3M3YI 1YI21 4BBSI 3MONA 2E2II 2QEXZ 1YJ9Z 1USPB 4NBDA 3CMAZ 1QYPA 2IZ3A 3CXCY 1KQSY 2JA7I 1M1K1 3CD6Z 4E33A 4A3KI 1ZB9A 1N2FA 3U50C 1SIWA 3CCJZ 1M902 2NVXI 3G711 1Q16A 1VQ6Z 4Y52I 4NBAA 4NH1C 3CPWY 3PO3S 5D1OB 1TWGI 1VQMZ 2AKLA 1R9TI 2LFUA 2GTIA 2JA6I 3GTMI 1L1OC 3G4S1 1JJ2Z 4A3BI 1RQFA 4NBCA 3CC21 3D9XA 1K83I 3D2LA 4HH4A 2JA5I 3K7AI 2DE5A 3TDHB 2P28A 1ML8A 4RS4A 3CCL1 3NDJA 4NOZA 2V8KA 1K9M1 1Q821 2OTLZ 3JAMb 4A93I 2QA4Z 3S15I 2GU2A 3CMEZ 1N8R1 1W2BY 2OOXB 4NB8A 4E32A 2JA8I 3CCSZ 2VPWA 3HOYI 4E30A 1JJ2Y 3RZDI 2JS4A 1VQ4Z 2RT9A 1KC82 5T64A 1VQOZ 1I6HI 3CQZI 3LUSA 1VQNZ 1Z03A 1VQL1 4MH4A 3S1QI 4RVFA 1WCMI 2VUGA 4RVHA 4E2XA 2V45A 3GTPI 4E2WA 1YJNZ 3I561 5IP9I 2M48A 1ZH1A 3HOZI 3OW2Z 5IT9f 3CCVZ 2OTJZ 3T4NB 4RVGA 2F4OA 2RPRA 1TWAI 1Q811 4E2ZA 4MXUA 3GTMS 1YJW1 2LIYA 2V8JA 3VMHA 2DE6A 3H0GI 4HGZA 3CCRZ 3FQQA 3CC71 3CC41 2QKDA 3JAMf 2NVYI 2GTHA 2DE7A 4A3LI 1Y8CA 1Y1VI 3HOVI 2NAPA 1YI2Z 2M6NA 3OW2Y 1YHQ1 2IV2X 1AA6A 3ESWA 1YIJ1 4HGYA 2PK7A 5CM2M 2OOYB 3NH5A 3NH8A 5FLXb 1VQ81 1YIT1 3J81f 3S14I 1RNIA 5A2Qf 1Q861 4MONA 4QTTA 3I551 4XX2A 3HKZA 4A3CI 4RVDA 3CCE1 1TFIA 2K3RA 1NJI2 3HOUI 2R7ZI 1QF8A 4EWCA 3IFUA 3CC2Z 1Q7Y1 5T67A 1DL6A 1VQ51 3CCLZ 2QEX1 2O53A 3BG1B 3NH4A 2G2KA 3CD61 2OZKA 1Y1VS 1RLYA 1KD11 5FLXf 1S72Z 3FKII 2BJOA 3CCQ1 2I3CA 4NBGA 3KIHA 3H3VJ 5IP7I 1K731 1K8A1 3CCMZ 2F4MA 1X0TA 3MZKB 5C44I 1VQLZ 2IZ4A 2W03A 3MZLB 5D1PA 1RO4A 1SFOI 3QWUA 4A3II 3J7A4 2B63I 3S2DI 3I56Z 4BY7I 2Y0SA 3TE5B 5LL6f 2QRCB 2R93I 4CL1A 1Y1WI 4MRIA 1YJWZ 1VQ71 2QLVB 1VQK1 1X3ZA 1WJ2A 3CC7Z 3BG0B
chains in the Genus database with same CATH topology
3CME1 2R6MA 2V8IA 4BY1I 4Y7NI 3HOWI 3VMIA 1WIIA 3CCUZ 2PMZA 4NFRA 3G6E1 1YHQZ 2RIQA 3D6WA 3F3PC 1K9M2 1M901 1Q822 4A3MI 1PFTA 4DK1A 3VB9A 1QVFZ 3I4NI 1N8R2 2E9HA 1VQ8Z 1YITZ 3Q87A 3HOXI 3S1RI 1YUKA 4NBHA 1WW9A 3CCV1 3NDIA 1TWFI 1USPA 3CXCZ 3CCEZ 2VUMI 2P3YA 4BBRI 1I3QI 3G71Z 4A3GI 2JUBA 4QTUA 1JWHC 3S17I 3GTOI 1VQP1 1Z02A 2JR6A 2HF1A 1ZB8A 1VQ5Z 5D1OA 4TNUA 3G4SZ 4A3FI 4DGLA 1Q812 4NBFA 4A3EI 5C4XI 4MD9A 1VQ91 1KC81 2W04A 2WAQA 4NB9A 1QVGZ 3EEDA 5C4JI 1YJ91 3CMA1 1NUIA 1P9NA 5T6BA 3IF8A 3CCQZ 3S1MI 2ZAEB 2QRDB 2K5RA 3M4OI 3CCJ1 4A3DI 4NBEA 2Q4ZA 3S2HI 1W2BZ 1VQ61 1Z01A 2HU9A 3S16I 2O4HA 1YUAA 3GTQI 1VQM1 5IT9b 1QVGY 1M1K2 1Q862 2H85A 2EGTA 2QREB 3J80b 2R92I 1VQ7Z 3GTKI 2JNYA 2KPIA 1VQKZ 2WB1A 1I50I 1LQLA 4DQYB 4AYBA 3GTJI 5FLMI 1S721 1Q7Y2 3GTGI 1TWHI 3S1NI 3IX0A 4E2YA 2QR1B 2E2HI 2OTL1 3CC4Z 3G6EZ 2QA41 2E2JI 4BXXI 1TWCI 1S7MA 1RO0A 3CCS1 2JMOA 1RO2A 3CCM1 2NVQI 3P5JB 2YU9I 1KRLA 3VTNA 2YADA 2PM9A 2KI7B 1VQ41 1KD12 1VQO1 3VMGA 2NVTI 3J81b 3PO3I 5A2Qb 5C3EI 1YIJZ 1VQN1 3FQMA 2VF1A 1NJI1 3RZOI 4MD7A 3GKQA 3GTLI 2J6AA 2RHBA 3KIFA 3J80f 1VLAA 1YJN1 3PO2I 1K732 1K8A2 4E31A 4S1TA 3EERA 3I07A 5AN9F 1VQPZ 1NP6A 2OTJ1 4X6AI 3I55Z 4NBBA 1KQSZ 2RBLA 3GCFA 3CCU1 3F3FC 3CCR1 4MD8A 4RV9A 1QVFY 3NFZA 1VQ9Z 3I4MI 4A3JI 2Q51A 3CPWZ 1X3WA 3M3YI 1YI21 4BBSI 3MONA 2E2II 2QEXZ 1YJ9Z 1USPB 4NBDA 3CMAZ 1QYPA 2IZ3A 3CXCY 1KQSY 2JA7I 1M1K1 3CD6Z 4E33A 4A3KI 1ZB9A 1N2FA 3U50C 3CCJZ 1M902 2NVXI 3G711 1VQ6Z 4Y52I 4NBAA 4NH1C 3CPWY 3PO3S 5D1OB 1TWGI 1VQMZ 2AKLA 1R9TI 2LFUA 2GTIA 2JA6I 3GTMI 1L1OC 3G4S1 1JJ2Z 4A3BI 1RQFA 4NBCA 3CC21 3D9XA 1K83I 4HH4A 2JA5I 3K7AI 2DE5A 3TDHB 2P28A 1ML8A 4RS4A 3CCL1 3NDJA 4NOZA 2V8KA 1K9M1 1Q821 2OTLZ 3JAMb 4A93I 2QA4Z 3S15I 2GU2A 3CMEZ 1N8R1 1W2BY 2OOXB 4NB8A 4E32A 2JA8I 3CCSZ 3HOYI 4E30A 1JJ2Y 3RZDI 2JS4A 1VQ4Z 2RT9A 1KC82 5T64A 1VQOZ 1I6HI 3CQZI 3LUSA 1VQNZ 1Z03A 1VQL1 4MH4A 3S1QI 4RVFA 1WCMI 2VUGA 4RVHA 4E2XA 3GTPI 4E2WA 1YJNZ 3I561 5IP9I 2M48A 1ZH1A 3HOZI 3OW2Z 5IT9f 3CCVZ 2OTJZ 3T4NB 4RVGA 2F4OA 2RPRA 1TWAI 1Q811 4E2ZA 4MXUA 3GTMS 1YJW1 2LIYA 2V8JA 3VMHA 2DE6A 3H0GI 4HGZA 3CCRZ 3FQQA 3CC71 3CC41 2QKDA 3JAMf 2NVYI 2GTHA 2DE7A 4A3LI 1Y1VI 3HOVI 1YI2Z 2M6NA 3OW2Y 1YHQ1 3ESWA 1YIJ1 4HGYA 2PK7A 5CM2M 2OOYB 3NH5A 3NH8A 5FLXb 1VQ81 1YIT1 3J81f 3S14I 1RNIA 5A2Qf 1Q861 4MONA 4QTTA 3I551 4XX2A 3HKZA 4A3CI 4RVDA 3CCE1 1TFIA 2K3RA 1NJI2 3HOUI 2R7ZI 1QF8A 4EWCA 3IFUA 3CC2Z 1Q7Y1 5T67A 1DL6A 1VQ51 3CCLZ 2QEX1 2O53A 3BG1B 3NH4A 2G2KA 3CD61 2OZKA 1Y1VS 1RLYA 1KD11 5FLXf 1S72Z 3FKII 2BJOA 3CCQ1 2I3CA 4NBGA 3KIHA 3H3VJ 5IP7I 1K731 1K8A1 3CCMZ 2F4MA 1X0TA 3MZKB 5C44I 1VQLZ 2IZ4A 2W03A 3MZLB 5D1PA 1RO4A 1SFOI 3QWUA 4A3II 3J7A4 2B63I 3S2DI 3I56Z 4BY7I 2Y0SA 3TE5B 5LL6f 2QRCB 2R93I 4CL1A 1Y1WI 4MRIA 1YJWZ 1VQ71 2QLVB 1VQK1 1X3ZA 3CC7Z 3BG0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  2NVX I;  3ESW A;  4BY1 I;  4Y52 I;  2PK7 A;  4NBA A;  4Y7N I;  3HOW I;  5CM2 M;  3VMI A;  2R92 I;  3PO3 S;  3GTK I;  2JNY A;  2KPI A;  1TWG I;  1I50 I;  1LQL A;  2AKL A;  1R9T I;  3GTJ I;  5FLM I;  2JA6 I;  3D6W A;  1L1O C;  3GTM I;  3S14 I;  4A3M I;  1PFT A;  3GTG I;  1TWH I;  4A3B I;  4QTT A;  3VB9 A;  4XX2 A;  4NBC A;  3I4N I;  3S1N I;  4A3C I;  2E2H I;  1K83 I;  1TFI A;  2JA5 I;  3K7A I;  3Q87 A;  2DE5 A;  3HOX I;  2E2J I;  3S1R I;  3HOU I;  1ML8 A;  4NBH A;  2R7Z I;  1TWC I;  4BXX I;  1WW9 A;  4NOZ A;  2NVQ I;  1TWF I;  2YU9 I;  1USP A;  2VUM I;  2P3Y A;  4A93 I;  3VMG A;  4BBR I;  1I3Q I;  2NVT I;  3S15 I;  1DL6 A;  3PO3 I;  4A3G I;  5C3E I;  4NB8 A;  4QTU A;  2JA8 I;  3S17 I;  3GTO I;  3HOY I;  3RZO I;  2JR6 A;  3RZD I;  2JS4 A;  3GKQ A;  3GTL I;  2J6A A;  2HF1 A;  1ZB8 A;  1VLA A;  1I6H I;  3PO2 I;  1Y1V S;  3CQZ I;  3LUS A;  1RLY A;  3EER A;  3I07 A;  4A3F I;  4NBF A;  4MH4 A;  4A3E I;  3S1Q I;  5C4X I;  4X6A I;  3FKI I;  1WCM I;  4NBB A;  2BJO A;  2RBL A;  4NBG A;  3GTP I;  3GCF A;  5IP9 I;  3H3V J;  5IP7 I;  3HOZ I;  4NB9 A;  2F4M A;  5C4J I;  1NUI A;  5C44 I;  3I4M I;  2F4O A;  1RO4 A;  1TWA I;  1SFO I;  4A3J I;  4A3I I;  3S1M I;  3GTM S;  1X3W A;  3VMH A;  3M3Y I;  2B63 I;  3S2D I;  4BBS I;  2DE6 A;  3H0G I;  4BY7 I;  2K5R A;  3M4O I;  2E2I I;  4A3D I;  2NVY I;  4NBE A;  1USP B;  4NBD A;  2DE7 A;  1QYP A;  4A3L I;  1Y1V I;  3S2H I;  2R93 I;  1Y1W I;  2JA7 I;  3HOV I;  3S16 I;  4A3K I;  1ZB9 A;  1X3Z A;  1N2F A;  1YUA A;  3GTQ I; 
#chains in the Genus database with same CATH topology
 3CME 1;  2R6M A;  2V8I A;  4BY1 I;  4Y7N I;  3HOW I;  3VMI A;  3IR7 A;  1WII A;  3CCU Z;  2PMZ A;  4NFR A;  3G6E 1;  1YHQ Z;  2RIQ A;  3D6W A;  3F3P C;  1K9M 2;  1M90 1;  1Q82 2;  1QXF A;  4A3M I;  1PFT A;  4DK1 A;  3VB9 A;  1QVF Z;  3I4N I;  1N8R 2;  2E9H A;  1VQ8 Z;  1YIT Z;  3Q87 A;  3HOX I;  3S1R I;  1FDO A;  1YUK A;  4NBH A;  1WW9 A;  3CCV 1;  3NDI A;  1TWF I;  1USP A;  3CXC Z;  3CCE Z;  2VUM I;  2V3V A;  2P3Y A;  4BBR I;  1I3Q I;  3G71 Z;  4A3G I;  2JUB A;  2AYD A;  4QTU A;  1JWH C;  3S17 I;  3GTO I;  1VQP 1;  1Z02 A;  2JR6 A;  2HF1 A;  1ZB8 A;  2JIO A;  1VQ5 Z;  5D1O A;  4TNU A;  3G4S Z;  4A3F I;  4DGL A;  1Q81 2;  4NBF A;  4A3E I;  5C4X I;  4MD9 A;  1VQ9 1;  2JIM A;  2E7Z A;  1KC8 1;  2W04 A;  2WAQ A;  4NB9 A;  1QVG Z;  3EED A;  5C4J I;  1YJ9 1;  3CMA 1;  1NUI A;  2VPZ A;  1P9N A;  2JIP A;  5T6B A;  3IF8 A;  3CCQ Z;  3S1M I;  2ZAE B;  2QRD B;  2K5R A;  3M4O I;  3CCJ 1;  4A3D I;  4NBE A;  2Q4Z A;  3S2H I;  1W2B Z;  1VQ6 1;  1Z01 A;  2HU9 A;  3S16 I;  2O4H A;  1YUA A;  3GTQ I;  1VQM 1;  5IT9 b;  1QVG Y;  1M1K 2;  1Q86 2;  2H85 A;  2EGT A;  2QRE B;  3J80 b;  2R92 I;  1VQ7 Z;  3GTK I;  2JNY A;  2KPI A;  2JIR A;  1VQK Z;  2WB1 A;  1I50 I;  1LQL A;  4DQY B;  2LEX A;  4AYB A;  3GTJ I;  5FLM I;  1S72 1;  1Q7Y 2;  3GTG I;  1TWH I;  3S1N I;  3IX0 A;  4E2Y A;  2QR1 B;  2E2H I;  2OTL 1;  3CC4 Z;  3G6E Z;  2JIQ A;  2QA4 1;  2E2J I;  4BXX I;  1TWC I;  1S7M A;  1RO0 A;  3CCS 1;  2JMO A;  1RO2 A;  3CCM 1;  2NVQ I;  3P5J B;  2YU9 I;  1KRL A;  3VTN A;  2YAD A;  2PM9 A;  2KI7 B;  1VQ4 1;  1KD1 2;  1VQO 1;  3VMG A;  2NVT I;  3J81 b;  3PO3 I;  5A2Q b;  1WZN A;  5C3E I;  1YIJ Z;  1VQN 1;  3FQM A;  2VF1 A;  1NJI 1;  3RZO I;  4MD7 A;  3GKQ A;  3GTL I;  2J6A A;  2RHB A;  3KIF A;  3J80 f;  1VLA A;  1YJN 1;  3PO2 I;  1K73 2;  1K8A 2;  4E31 A;  1FDI A;  4S1T A;  3EER A;  3I07 A;  5AN9 F;  1VQP Z;  1NP6 A;  2OTJ 1;  4X6A I;  3I55 Z;  4NBB A;  1KQS Z;  2RBL A;  2VPX A;  3GCF A;  3CCU 1;  3F3F C;  3CCR 1;  4MD8 A;  4RV9 A;  1QVF Y;  3NFZ A;  1VQ9 Z;  2VPY A;  3I4M I;  2Q51 A;  4A3J I;  3CPW Z;  1X3W A;  3M3Y I;  1YI2 1;  4BBS I;  3MON A;  2E2I I;  2QEX Z;  1YJ9 Z;  1USP B;  4NBD A;  3CMA Z;  1QYP A;  2IZ3 A;  3CXC Y;  1KQS Y;  2JA7 I;  1M1K 1;  3CD6 Z;  4E33 A;  4A3K I;  1ZB9 A;  1N2F A;  3U50 C;  1SIW A;  3CCJ Z;  1M90 2;  2NVX I;  3G71 1;  1Q16 A;  1VQ6 Z;  4Y52 I;  4NBA A;  4NH1 C;  3CPW Y;  3PO3 S;  5D1O B;  1TWG I;  1VQM Z;  2AKL A;  1R9T I;  2LFU A;  2GTI A;  2JA6 I;  3GTM I;  1L1O C;  3G4S 1;  1JJ2 Z;  4A3B I;  1RQF A;  4NBC A;  3CC2 1;  3D9X A;  1K83 I;  3D2L A;  4HH4 A;  2JA5 I;  3K7A I;  2DE5 A;  3TDH B;  2P28 A;  1ML8 A;  4RS4 A;  3CCL 1;  3NDJ A;  4NOZ A;  2V8K A;  1K9M 1;  1Q82 1;  2OTL Z;  3JAM b;  4A93 I;  2QA4 Z;  3S15 I;  2GU2 A;  3CME Z;  1N8R 1;  1W2B Y;  2OOX B;  4NB8 A;  4E32 A;  2JA8 I;  3CCS Z;  2VPW A;  3HOY I;  4E30 A;  1JJ2 Y;  3RZD I;  2JS4 A;  1VQ4 Z;  2RT9 A;  1KC8 2;  5T64 A;  1VQO Z;  1I6H I;  3CQZ I;  3LUS A;  1VQN Z;  1Z03 A;  1VQL 1;  4MH4 A;  3S1Q I;  4RVF A;  1WCM I;  2VUG A;  4RVH A;  4E2X A;  2V45 A;  3GTP I;  4E2W A;  1YJN Z;  3I56 1;  5IP9 I;  2M48 A;  1ZH1 A;  3HOZ I;  3OW2 Z;  5IT9 f;  3CCV Z;  2OTJ Z;  3T4N B;  4RVG A;  2F4O A;  2RPR A;  1TWA I;  1Q81 1;  4E2Z A;  4MXU A;  3GTM S;  1YJW 1;  2LIY A;  2V8J A;  3VMH A;  2DE6 A;  3H0G I;  4HGZ A;  3CCR Z;  3FQQ A;  3CC7 1;  3CC4 1;  2QKD A;  3JAM f;  2NVY I;  2GTH A;  2DE7 A;  4A3L I;  1Y8C A;  1Y1V I;  3HOV I;  2NAP A;  1YI2 Z;  2M6N A;  3OW2 Y;  1YHQ 1;  2IV2 X;  1AA6 A;  3ESW A;  1YIJ 1;  4HGY A;  2PK7 A;  5CM2 M;  2OOY B;  3NH5 A;  3NH8 A;  5FLX b;  1VQ8 1;  1YIT 1;  3J81 f;  3S14 I;  1RNI A;  5A2Q f;  1Q86 1;  4MON A;  4QTT A;  3I55 1;  4XX2 A;  3HKZ A;  4A3C I;  4RVD A;  3CCE 1;  1TFI A;  2K3R A;  1NJI 2;  3HOU I;  2R7Z I;  1QF8 A;  4EWC A;  3IFU A;  3CC2 Z;  1Q7Y 1;  5T67 A;  1DL6 A;  1VQ5 1;  3CCL Z;  2QEX 1;  2O53 A;  3BG1 B;  3NH4 A;  2G2K A;  3CD6 1;  2OZK A;  1Y1V S;  1RLY A;  1KD1 1;  5FLX f;  1S72 Z;  3FKI I;  2BJO A;  3CCQ 1;  2I3C A;  4NBG A;  3KIH A;  3H3V J;  5IP7 I;  1K73 1;  1K8A 1;  3CCM Z;  2F4M A;  1X0T A;  3MZK B;  5C44 I;  1VQL Z;  2IZ4 A;  2W03 A;  3MZL B;  5D1P A;  1RO4 A;  1SFO I;  3QWU A;  4A3I I;  3J7A 4;  2B63 I;  3S2D I;  3I56 Z;  4BY7 I;  2Y0S A;  3TE5 B;  5LL6 f;  2QRC B;  2R93 I;  4CL1 A;  1Y1W I;  4MRI A;  1YJW Z;  1VQ7 1;  2QLV B;  1VQK 1;  1X3Z A;  1WJ2 A;  3CC7 Z;  3BG0 B; 
#chains in the Genus database with same CATH homology
 3CME 1;  2R6M A;  2V8I A;  4BY1 I;  4Y7N I;  3HOW I;  3VMI A;  1WII A;  3CCU Z;  2PMZ A;  4NFR A;  3G6E 1;  1YHQ Z;  2RIQ A;  3D6W A;  3F3P C;  1K9M 2;  1M90 1;  1Q82 2;  4A3M I;  1PFT A;  4DK1 A;  3VB9 A;  1QVF Z;  3I4N I;  1N8R 2;  2E9H A;  1VQ8 Z;  1YIT Z;  3Q87 A;  3HOX I;  3S1R I;  1YUK A;  4NBH A;  1WW9 A;  3CCV 1;  3NDI A;  1TWF I;  1USP A;  3CXC Z;  3CCE Z;  2VUM I;  2P3Y A;  4BBR I;  1I3Q I;  3G71 Z;  4A3G I;  2JUB A;  4QTU A;  1JWH C;  3S17 I;  3GTO I;  1VQP 1;  1Z02 A;  2JR6 A;  2HF1 A;  1ZB8 A;  1VQ5 Z;  5D1O A;  4TNU A;  3G4S Z;  4A3F I;  4DGL A;  1Q81 2;  4NBF A;  4A3E I;  5C4X I;  4MD9 A;  1VQ9 1;  1KC8 1;  2W04 A;  2WAQ A;  4NB9 A;  1QVG Z;  3EED A;  5C4J I;  1YJ9 1;  3CMA 1;  1NUI A;  1P9N A;  5T6B A;  3IF8 A;  3CCQ Z;  3S1M I;  2ZAE B;  2QRD B;  2K5R A;  3M4O I;  3CCJ 1;  4A3D I;  4NBE A;  2Q4Z A;  3S2H I;  1W2B Z;  1VQ6 1;  1Z01 A;  2HU9 A;  3S16 I;  2O4H A;  1YUA A;  3GTQ I;  1VQM 1;  5IT9 b;  1QVG Y;  1M1K 2;  1Q86 2;  2H85 A;  2EGT A;  2QRE B;  3J80 b;  2R92 I;  1VQ7 Z;  3GTK I;  2JNY A;  2KPI A;  1VQK Z;  2WB1 A;  1I50 I;  1LQL A;  4DQY B;  4AYB A;  3GTJ I;  5FLM I;  1S72 1;  1Q7Y 2;  3GTG I;  1TWH I;  3S1N I;  3IX0 A;  4E2Y A;  2QR1 B;  2E2H I;  2OTL 1;  3CC4 Z;  3G6E Z;  2QA4 1;  2E2J I;  4BXX I;  1TWC I;  1S7M A;  1RO0 A;  3CCS 1;  2JMO A;  1RO2 A;  3CCM 1;  2NVQ I;  3P5J B;  2YU9 I;  1KRL A;  3VTN A;  2YAD A;  2PM9 A;  2KI7 B;  1VQ4 1;  1KD1 2;  1VQO 1;  3VMG A;  2NVT I;  3J81 b;  3PO3 I;  5A2Q b;  5C3E I;  1YIJ Z;  1VQN 1;  3FQM A;  2VF1 A;  1NJI 1;  3RZO I;  4MD7 A;  3GKQ A;  3GTL I;  2J6A A;  2RHB A;  3KIF A;  3J80 f;  1VLA A;  1YJN 1;  3PO2 I;  1K73 2;  1K8A 2;  4E31 A;  4S1T A;  3EER A;  3I07 A;  5AN9 F;  1VQP Z;  1NP6 A;  2OTJ 1;  4X6A I;  3I55 Z;  4NBB A;  1KQS Z;  2RBL A;  3GCF A;  3CCU 1;  3F3F C;  3CCR 1;  4MD8 A;  4RV9 A;  1QVF Y;  3NFZ A;  1VQ9 Z;  3I4M I;  4A3J I;  2Q51 A;  3CPW Z;  1X3W A;  3M3Y I;  1YI2 1;  4BBS I;  3MON A;  2E2I I;  2QEX Z;  1YJ9 Z;  1USP B;  4NBD A;  3CMA Z;  1QYP A;  2IZ3 A;  3CXC Y;  1KQS Y;  2JA7 I;  1M1K 1;  3CD6 Z;  4E33 A;  4A3K I;  1ZB9 A;  1N2F A;  3U50 C;  3CCJ Z;  1M90 2;  2NVX I;  3G71 1;  1VQ6 Z;  4Y52 I;  4NBA A;  4NH1 C;  3CPW Y;  3PO3 S;  5D1O B;  1TWG I;  1VQM Z;  2AKL A;  1R9T I;  2LFU A;  2GTI A;  2JA6 I;  3GTM I;  1L1O C;  3G4S 1;  1JJ2 Z;  4A3B I;  1RQF A;  4NBC A;  3CC2 1;  3D9X A;  1K83 I;  4HH4 A;  2JA5 I;  3K7A I;  2DE5 A;  3TDH B;  2P28 A;  1ML8 A;  4RS4 A;  3CCL 1;  3NDJ A;  4NOZ A;  2V8K A;  1K9M 1;  1Q82 1;  2OTL Z;  3JAM b;  4A93 I;  2QA4 Z;  3S15 I;  2GU2 A;  3CME Z;  1N8R 1;  1W2B Y;  2OOX B;  4NB8 A;  4E32 A;  2JA8 I;  3CCS Z;  3HOY I;  4E30 A;  1JJ2 Y;  3RZD I;  2JS4 A;  1VQ4 Z;  2RT9 A;  1KC8 2;  5T64 A;  1VQO Z;  1I6H I;  3CQZ I;  3LUS A;  1VQN Z;  1Z03 A;  1VQL 1;  4MH4 A;  3S1Q I;  4RVF A;  1WCM I;  2VUG A;  4RVH A;  4E2X A;  3GTP I;  4E2W A;  1YJN Z;  3I56 1;  5IP9 I;  2M48 A;  1ZH1 A;  3HOZ I;  3OW2 Z;  5IT9 f;  3CCV Z;  2OTJ Z;  3T4N B;  4RVG A;  2F4O A;  2RPR A;  1TWA I;  1Q81 1;  4E2Z A;  4MXU A;  3GTM S;  1YJW 1;  2LIY A;  2V8J A;  3VMH A;  2DE6 A;  3H0G I;  4HGZ A;  3CCR Z;  3FQQ A;  3CC7 1;  3CC4 1;  2QKD A;  3JAM f;  2NVY I;  2GTH A;  2DE7 A;  4A3L I;  1Y1V I;  3HOV I;  1YI2 Z;  2M6N A;  3OW2 Y;  1YHQ 1;  3ESW A;  1YIJ 1;  4HGY A;  2PK7 A;  5CM2 M;  2OOY B;  3NH5 A;  3NH8 A;  5FLX b;  1VQ8 1;  1YIT 1;  3J81 f;  3S14 I;  1RNI A;  5A2Q f;  1Q86 1;  4MON A;  4QTT A;  3I55 1;  4XX2 A;  3HKZ A;  4A3C I;  4RVD A;  3CCE 1;  1TFI A;  2K3R A;  1NJI 2;  3HOU I;  2R7Z I;  1QF8 A;  4EWC A;  3IFU A;  3CC2 Z;  1Q7Y 1;  5T67 A;  1DL6 A;  1VQ5 1;  3CCL Z;  2QEX 1;  2O53 A;  3BG1 B;  3NH4 A;  2G2K A;  3CD6 1;  2OZK A;  1Y1V S;  1RLY A;  1KD1 1;  5FLX f;  1S72 Z;  3FKI I;  2BJO A;  3CCQ 1;  2I3C A;  4NBG A;  3KIH A;  3H3V J;  5IP7 I;  1K73 1;  1K8A 1;  3CCM Z;  2F4M A;  1X0T A;  3MZK B;  5C44 I;  1VQL Z;  2IZ4 A;  2W03 A;  3MZL B;  5D1P A;  1RO4 A;  1SFO I;  3QWU A;  4A3I I;  3J7A 4;  2B63 I;  3S2D I;  3I56 Z;  4BY7 I;  2Y0S A;  3TE5 B;  5LL6 f;  2QRC B;  2R93 I;  4CL1 A;  1Y1W I;  4MRI A;  1YJW Z;  1VQ7 1;  2QLV B;  1VQK 1;  1X3Z A;  3CC7 Z;  3BG0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...