2R93I

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I02
3S2HI 1WW9A 2AKLA 3VMGA 2JNYA 5C4XI 4NB8A 4A3GI 2NVYI 2P3YA 2YU9I 1I3QI 1NUIA 4A3BI 4X6AI 1WCMI 4NBEA 3K7AI 4NBCA 4NBFA 2F4MA 2JR6A 4Y52I 4A3MI 1DL6A 1Y1VI 4BY7I 4A3JI 3M3YI 4QTUA 2R92I 1X3WA 1RLYA 3GTOI 4XX2A 1USPA 4A3II 3GTKI 3HOUI 1YUAA 3PO2I 3S1QI 4A3KI 4A3CI 1TWFI 3GTMS 2K5RA 2E2II 4NBDA 3H0GI 3RZDI 3ESWA 2PK7A 3Q87A 1Y1WI 2B63I 3S16I 1X3ZA 3PO3I 3S2DI 2NVXI 1TWGI 4Y7NI 2E2HI 5C4JI 3VB9A 2DE5A 3HOXI 1ZB8A 4NBGA 2DE6A 2VUMI 4NB9A 4A3FI 4BBSI 1K83I 2F4OA 2R93I 3VMHA 4A3LI 4NBAA 3S17I 1QYPA 4A3DI 3U50C 3CQZI 5CM2M 2E2JI 5FLMI 2JA8I 3H3VJ 1I6HI 1TWHI 1L1OC 1LQLA 4NBBA 1Y1VS 1ZB9A 3FKII 2JA7I 2NVQI 3HOWI 3GTPI 3S14I 3GKQA 3GTLI 1I50I 3HOZI 3HOYI 1N2FA 2JS4A 3GCFA 2R7ZI 1SFOI 2NVTI 2J6AA 2BJOA 3RZOI 3GTGI 4BXXI 1TFIA 2KPIA 3VMIA 4MH4A 4BBRI 3GTMI 4A93I 1PFTA 3GTJI 4NBHA 1ML8A 3S1NI 3I4MI 3PO3S 5IP7I 3GTQI 2DE7A 3LUSA 3D6WA 4A3EI 3M4OI 2JA6I 3I4NI 4BY1I 3HOVI 3I07A 1RO4A 2RBLA 3EERA 2HF1A 3S15I 3S1RI 4QTTA 4NOZA 5C44I 1TWAI 1TWCI 1USPB 5C3EI 1R9TI 2JA5I 3S1MI 1VLAA 5IP9I
chains in the Genus database with same CATH superfamily
3S2HI 1RNIA 3VMGA 3CC2Z 5C4XI 2NVYI 4HGZA 3CCU1 3CD61 5D1OB 2JIPA 1VQ91 3OW2Z 4A3BI 2R6MA 3KIFA 1VQOZ 4E31A 4NBFA 3QWUA 4DGLA 4Y52I 1YHQZ 1Y1VI 1VQ4Z 3M3YI 1YIJ1 3G4SZ 3CCQZ 2R92I 1X3WA 1M1K2 3CCL1 1ZH1A 4XX2A 4A3II 1Q821 3GTKI 3CCRZ 3S1QI 4A3KI 1Q811 3GTMS 2K5RA 4RVFA 3CC21 2V8JA 4E32A 1RQFA 2E2II 1Y1WI 3VTNA 4S1TA 3J80b 3S16I 1X3ZA 4DK1A 2E2HI 1WZNA 3VB9A 1Q812 1ZB8A 3G4S1 1FDIA 2OOXB 1Z01A 1Q16A 4NH1C 3CCR1 1YI2Z 4NBAA 3S17I 1QYPA 4A3DI 1Z03A 3NH8A 3MZLB 5CM2M 3CC4Z 2RIQA 3TDHB 1KQSY 1I6HI 4TNUA 2NVQI 1NP6A 1QVFY 1N2FA 2QA4Z 3CMEZ 2PMZA 2QLVB 2R7ZI 3D9XA 2GTIA 4RS4A 5A2Qb 1N8R2 2KPIA 4BBRI 4MH4A 2VUGA 3CCSZ 4A93I 1PFTA 1KC82 4NBHA 3F3FC 3G6E1 3CC41 2DE7A 1WJ2A 3D6WA 3TE5B 3I551 3I4NI 2JIMA 4BY1I 1RO4A 3EERA 2HF1A 1K731 3S15I 3S1RI 4QTTA 2QA41 3CME1 2K3RA 5C44I 1R9TI 2RHBA 1M902 3MONA 1X0TA 2IZ3A 4NB8A 1FDOA 1NJI1 1K8A1 3CD6Z 1I3QI 3CCUZ 1VQ9Z 3K7AI 4NBCA 5T6BA 3NH4A 2JR6A 4A3MI 3T4NB 4E2YA 4BY7I 4A3JI 3IR7A 3OW2Y 2V3VA 1RLYA 1YJNZ 4RV9A 1USPA 3HOUI 1KRLA 1YUAA 2W03A 1TWFI 2PK7A 1RO0A 1QF8A 1M1K1 1QXFA 2LIYA 3S2DI 2QREB 1TWGI 1RO2A 4Y7NI 2NVXI 4MRIA 3HKZA 2DE5A 2RT9A 3FQMA 3CCJZ 2GU2A 3NH5A 3CXCY 2DE6A 2I3CA 1K83I 1YJN1 2F4OA 2KI7B 1Q7Y2 2O4HA 5T64A 3I561 2M6NA 2M48A 1VQN1 1TWHI 1LQLA 1L1OC 1Y1VS 3FKII 4RVHA 1JJ2Z 3GKQA 3CCJ1 2JS4A 3J7A4 3JAMf 4RVDA 3RZOI 3GTGI 1YJW1 3KIHA 1P9NA 3GTJI 3BG1B 2VF1A 1S7MA 4NFRA 3G6EZ 3LUSA 4DQYB 3I55Z 1N8R1 3IFUA 1KC81 1W2BY 4EWCA 3MZKB 1TWAI 2O53A 1VLAA 3RZDI 1WW9A 2JNYA 2Q4ZA 3BG0B 2Y0SA 3FQQA 2QR1B 1NUIA 2VPZA 1WCMI 4NBEA 2OTJ1 2F4MA 1M901 2OOYB 1Z02A 4MD7A 2W04A 2AYDA 4E2ZA 2QRDB 3CC7Z 1SIWA 3CCEZ 1YIT1 3NFZA 3PO2I 1VQ51 4HGYA 1VQMZ 3H0GI 3CCM1 2H85A 1VQ81 2RPRA 2B63I 3PO3I 2NAPA 4MD8A 3CMAZ 1JWHC 4CL1A 1VQ7Z 1Q862 2WB1A 4NBGA 1VQKZ 2VUMI 3CC71 4A3FI 4RVGA 4BBSI 1AA6A 1YJ91 3CCE1 2R93I 3VMHA 3P5JB 2HU9A 2LEXA 2QKDA 2G2KA 1VQM1 3U50C 1KD12 5T67A 3I56Z 5D1OA 2E2JI 1K9M2 3NDJA 2OTL1 5FLMI 1VQNZ 3H3VJ 1Q7Y1 3CMA1 4NBBA 1ZB9A 1VQ71 3GTPI 3GTLI 1I50I 4AYBA 3HOZI 3G711 1VQK1 5LL6f 2QEX1 1SFOI 2J6AA 2BJOA 1QVGZ 2VPXA 1JJ2Y 2ZAEB 2V8IA 4BXXI 1TFIA 1YJWZ 3CPWZ 3GTMI 2PM9A 1ML8A 3S1NI 1S721 3GTQI 4A3EI 2JA6I 1VQP1 3I07A 5A2Qf 2JIQA 2RBLA 2GTHA 2YADA 5IT9f 2IZ4A 4NOZA 1TWCI 2AKLA 4A3GI 2VPWA 2P3YA 2YU9I 4X6AI 3CXCZ 2JIRA 1VQO1 2OTJZ 2E7ZA 2JUBA 1Q822 1DL6A 1YHQ1 1VQ41 5FLXf 5AN9F 3CCQ1 4QTUA 3GTOI 4MXUA 1YITZ 1VQ5Z 4A3CI 2Q51A 3J81f 4NBDA 3ESWA 3IX0A 3Q87A 3CCMZ 1VQ8Z 1Y8CA 4HH4A 1VQLZ 5C4JI 1YUKA 2V8KA 3HOXI 1WIIA 4NB9A 2LFUA 1KQSZ 1YJ9Z 3F3PC 1YI21 2IV2X 4A3LI 1Q861 2JMOA 1QVFZ 5IT9b 4MD9A 1W2BZ 3CQZI 1VQ6Z 3JAMb 2WAQA 3NDIA 2OTLZ 2JA8I 3CCVZ 1VQL1 3S14I 2JA7I 3HOWI 2V45A 1KD11 3HOYI 2VPYA 1K9M1 5D1PA 3G71Z 3GCFA 3J80f 2P28A 2QEXZ 2NVTI 5FLXb 4E33A 2E9HA 3VMIA 3EEDA 3CCS1 3D2LA 2JIOA 4E2WA 1K732 2EGTA 3I4MI 1S72Z 3PO3S 5IP7I 1VQ61 4MONA 3M4OI 3CCV1 2OZKA 1QVGY 1VQPZ 3HOVI 3J81b 3CPWY 3IF8A 1YIJZ 1NJI2 1K8A2 2QRCB 3CCLZ 4E30A 5C3EI 3S1MI 1USPB 2JA5I 4E2XA 5IP9I
chains in the Genus database with same CATH topology
3S2HI 1RNIA 3VMGA 3CC2Z 5C4XI 2NVYI 4HGZA 3CCU1 3CD61 5D1OB 4A3BI 1VQ91 3OW2Z 2R6MA 3KIFA 1VQOZ 4E31A 4NBFA 3QWUA 4DGLA 4Y52I 1YHQZ 1Y1VI 1VQ4Z 3M3YI 1YIJ1 3G4SZ 3CCQZ 2R92I 1X3WA 1M1K2 3CCL1 1ZH1A 4XX2A 4A3II 1Q821 3GTKI 3CCRZ 3S1QI 4A3KI 1Q811 3GTMS 2K5RA 4RVFA 4E32A 2V8JA 3CC21 1RQFA 2E2II 1Y1WI 3VTNA 4S1TA 3J80b 3S16I 1X3ZA 4DK1A 2E2HI 3VB9A 1Q812 1ZB8A 3G4S1 2OOXB 1Z01A 4NH1C 3CCR1 1YI2Z 4NBAA 3S17I 1QYPA 4A3DI 1Z03A 3NH8A 3MZLB 5CM2M 3CC4Z 2RIQA 3TDHB 1KQSY 1I6HI 4TNUA 2NVQI 1NP6A 1QVFY 1N2FA 2QA4Z 3CMEZ 2PMZA 2QLVB 2R7ZI 3D9XA 2GTIA 4RS4A 5A2Qb 1N8R2 2KPIA 4BBRI 4MH4A 2VUGA 3CCSZ 4A93I 1PFTA 1KC82 4NBHA 3F3FC 3G6E1 3CC41 2DE7A 3D6WA 3TE5B 3I551 3I4NI 4BY1I 1RO4A 3EERA 2HF1A 1K731 3S15I 3S1RI 4QTTA 2QA41 3CME1 2K3RA 5C44I 1R9TI 2RHBA 1M902 3MONA 1X0TA 2IZ3A 4NB8A 1NJI1 1K8A1 3CD6Z 1I3QI 3CCUZ 1VQ9Z 3K7AI 4NBCA 5T6BA 3NH4A 2JR6A 4A3MI 3T4NB 4E2YA 4BY7I 4A3JI 3OW2Y 1RLYA 1YJNZ 4RV9A 1USPA 3HOUI 1KRLA 1YUAA 2W03A 1TWFI 2PK7A 1RO0A 1QF8A 1M1K1 2LIYA 3S2DI 2QREB 1TWGI 1RO2A 4Y7NI 2NVXI 4MRIA 3HKZA 2DE5A 2RT9A 3FQMA 3CCJZ 2GU2A 3NH5A 3CXCY 2DE6A 2I3CA 1K83I 1YJN1 2F4OA 2KI7B 1Q7Y2 2O4HA 5T64A 3I561 2M6NA 2M48A 1VQN1 1TWHI 1LQLA 1L1OC 1Y1VS 3FKII 4RVHA 1JJ2Z 3GKQA 3CCJ1 2JS4A 3J7A4 3JAMf 4RVDA 3RZOI 3GTGI 1YJW1 3KIHA 1P9NA 3GTJI 3BG1B 2VF1A 1S7MA 4NFRA 3G6EZ 3LUSA 4DQYB 3I55Z 1N8R1 3IFUA 1KC81 1W2BY 4EWCA 3MZKB 1TWAI 2O53A 1VLAA 3RZDI 1WW9A 2JNYA 2Q4ZA 3BG0B 2Y0SA 3FQQA 2QR1B 1NUIA 1WCMI 4NBEA 2OTJ1 2F4MA 1M901 2OOYB 1Z02A 4MD7A 2W04A 4E2ZA 2QRDB 3CC7Z 3CCEZ 1YIT1 3NFZA 3PO2I 1VQ51 4HGYA 1VQMZ 3H0GI 3CCM1 2H85A 1VQ81 2RPRA 2B63I 3PO3I 4MD8A 3CMAZ 1JWHC 4CL1A 1VQ7Z 1Q862 2WB1A 4NBGA 1VQKZ 2VUMI 3CC71 4A3FI 4RVGA 4BBSI 1YJ91 3CCE1 2R93I 3VMHA 3P5JB 2HU9A 2QKDA 2G2KA 1VQM1 3U50C 1KD12 5T67A 3I56Z 5D1OA 2E2JI 1K9M2 3NDJA 2OTL1 5FLMI 1VQNZ 3H3VJ 1Q7Y1 3CMA1 4NBBA 1ZB9A 1VQ71 3GTPI 3GTLI 1I50I 4AYBA 3HOZI 3G711 1VQK1 5LL6f 2QEX1 1SFOI 2J6AA 2BJOA 1QVGZ 1JJ2Y 2ZAEB 2V8IA 4BXXI 1TFIA 1YJWZ 3CPWZ 3GTMI 2PM9A 1ML8A 3S1NI 1S721 3GTQI 4A3EI 2JA6I 1VQP1 3I07A 5A2Qf 2RBLA 2GTHA 2YADA 5IT9f 2IZ4A 4NOZA 1TWCI 2AKLA 4A3GI 2P3YA 2YU9I 4X6AI 3CXCZ 1VQO1 2OTJZ 2JUBA 1Q822 1DL6A 1YHQ1 1VQ41 5FLXf 5AN9F 3CCQ1 4QTUA 3GTOI 4MXUA 1YITZ 1VQ5Z 4A3CI 2Q51A 3J81f 4NBDA 3ESWA 3IX0A 3Q87A 3CCMZ 1VQ8Z 4HH4A 1VQLZ 5C4JI 1YUKA 2V8KA 3HOXI 1WIIA 4NB9A 2LFUA 1KQSZ 1YJ9Z 3F3PC 1YI21 4A3LI 1Q861 2JMOA 1QVFZ 5IT9b 4MD9A 1W2BZ 3CQZI 1VQ6Z 3JAMb 2WAQA 3NDIA 2OTLZ 2JA8I 3CCVZ 1VQL1 3S14I 2JA7I 3HOWI 1KD11 3HOYI 1K9M1 5D1PA 3G71Z 3GCFA 3J80f 2P28A 2QEXZ 2NVTI 5FLXb 4E33A 2E9HA 3VMIA 3EEDA 3CCS1 4E2WA 1K732 2EGTA 3I4MI 1S72Z 3PO3S 5IP7I 1VQ61 4MONA 3M4OI 3CCV1 2OZKA 1QVGY 1VQPZ 3HOVI 3J81b 3CPWY 3IF8A 1YIJZ 1NJI2 1K8A2 2QRCB 3CCLZ 4E30A 5C3EI 3S1MI 1USPB 2JA5I 4E2XA 5IP9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H I;  1WW9 A;  2AKL A;  3VMG A;  2JNY A;  5C4X I;  4NB8 A;  4A3G I;  2NVY I;  2P3Y A;  2YU9 I;  1I3Q I;  1NUI A;  4A3B I;  4X6A I;  1WCM I;  4NBE A;  3K7A I;  4NBC A;  4NBF A;  2F4M A;  2JR6 A;  4Y52 I;  4A3M I;  1DL6 A;  1Y1V I;  4BY7 I;  4A3J I;  3M3Y I;  4QTU A;  2R92 I;  1X3W A;  1RLY A;  3GTO I;  4XX2 A;  1USP A;  4A3I I;  3GTK I;  3HOU I;  1YUA A;  3PO2 I;  3S1Q I;  4A3K I;  4A3C I;  1TWF I;  3GTM S;  2K5R A;  2E2I I;  4NBD A;  3H0G I;  3RZD I;  3ESW A;  2PK7 A;  3Q87 A;  1Y1W I;  2B63 I;  3S16 I;  1X3Z A;  3PO3 I;  3S2D I;  2NVX I;  1TWG I;  4Y7N I;  2E2H I;  5C4J I;  3VB9 A;  2DE5 A;  3HOX I;  1ZB8 A;  4NBG A;  2DE6 A;  2VUM I;  4NB9 A;  4A3F I;  4BBS I;  1K83 I;  2F4O A;  2R93 I;  3VMH A;  4A3L I;  4NBA A;  3S17 I;  1QYP A;  4A3D I;  3U50 C;  3CQZ I;  5CM2 M;  2E2J I;  5FLM I;  2JA8 I;  3H3V J;  1I6H I;  1TWH I;  1L1O C;  1LQL A;  4NBB A;  1Y1V S;  1ZB9 A;  3FKI I;  2JA7 I;  2NVQ I;  3HOW I;  3GTP I;  3S14 I;  3GKQ A;  3GTL I;  1I50 I;  3HOZ I;  3HOY I;  1N2F A;  2JS4 A;  3GCF A;  2R7Z I;  1SFO I;  2NVT I;  2J6A A;  2BJO A;  3RZO I;  3GTG I;  4BXX I;  1TFI A;  2KPI A;  3VMI A;  4MH4 A;  4BBR I;  3GTM I;  4A93 I;  1PFT A;  3GTJ I;  4NBH A;  1ML8 A;  3S1N I;  3I4M I;  3PO3 S;  5IP7 I;  3GTQ I;  2DE7 A;  3LUS A;  3D6W A;  4A3E I;  3M4O I;  2JA6 I;  3I4N I;  4BY1 I;  3HOV I;  3I07 A;  1RO4 A;  2RBL A;  3EER A;  2HF1 A;  3S15 I;  3S1R I;  4QTT A;  4NOZ A;  5C44 I;  1TWA I;  1TWC I;  1USP B;  5C3E I;  1R9T I;  2JA5 I;  3S1M I;  1VLA A;  5IP9 I; 
#chains in the Genus database with same CATH topology
 3S2H I;  1RNI A;  3VMG A;  3CC2 Z;  5C4X I;  2NVY I;  4HGZ A;  3CCU 1;  3CD6 1;  5D1O B;  2JIP A;  1VQ9 1;  3OW2 Z;  4A3B I;  2R6M A;  3KIF A;  1VQO Z;  4E31 A;  4NBF A;  3QWU A;  4DGL A;  4Y52 I;  1YHQ Z;  1Y1V I;  1VQ4 Z;  3M3Y I;  1YIJ 1;  3G4S Z;  3CCQ Z;  2R92 I;  1X3W A;  1M1K 2;  3CCL 1;  1ZH1 A;  4XX2 A;  4A3I I;  1Q82 1;  3GTK I;  3CCR Z;  3S1Q I;  4A3K I;  1Q81 1;  3GTM S;  2K5R A;  4RVF A;  3CC2 1;  2V8J A;  4E32 A;  1RQF A;  2E2I I;  1Y1W I;  3VTN A;  4S1T A;  3J80 b;  3S16 I;  1X3Z A;  4DK1 A;  2E2H I;  1WZN A;  3VB9 A;  1Q81 2;  1ZB8 A;  3G4S 1;  1FDI A;  2OOX B;  1Z01 A;  1Q16 A;  4NH1 C;  3CCR 1;  1YI2 Z;  4NBA A;  3S17 I;  1QYP A;  4A3D I;  1Z03 A;  3NH8 A;  3MZL B;  5CM2 M;  3CC4 Z;  2RIQ A;  3TDH B;  1KQS Y;  1I6H I;  4TNU A;  2NVQ I;  1NP6 A;  1QVF Y;  1N2F A;  2QA4 Z;  3CME Z;  2PMZ A;  2QLV B;  2R7Z I;  3D9X A;  2GTI A;  4RS4 A;  5A2Q b;  1N8R 2;  2KPI A;  4BBR I;  4MH4 A;  2VUG A;  3CCS Z;  4A93 I;  1PFT A;  1KC8 2;  4NBH A;  3F3F C;  3G6E 1;  3CC4 1;  2DE7 A;  1WJ2 A;  3D6W A;  3TE5 B;  3I55 1;  3I4N I;  2JIM A;  4BY1 I;  1RO4 A;  3EER A;  2HF1 A;  1K73 1;  3S15 I;  3S1R I;  4QTT A;  2QA4 1;  3CME 1;  2K3R A;  5C44 I;  1R9T I;  2RHB A;  1M90 2;  3MON A;  1X0T A;  2IZ3 A;  4NB8 A;  1FDO A;  1NJI 1;  1K8A 1;  3CD6 Z;  1I3Q I;  3CCU Z;  1VQ9 Z;  3K7A I;  4NBC A;  5T6B A;  3NH4 A;  2JR6 A;  4A3M I;  3T4N B;  4E2Y A;  4BY7 I;  4A3J I;  3IR7 A;  3OW2 Y;  2V3V A;  1RLY A;  1YJN Z;  4RV9 A;  1USP A;  3HOU I;  1KRL A;  1YUA A;  2W03 A;  1TWF I;  2PK7 A;  1RO0 A;  1QF8 A;  1M1K 1;  1QXF A;  2LIY A;  3S2D I;  2QRE B;  1TWG I;  1RO2 A;  4Y7N I;  2NVX I;  4MRI A;  3HKZ A;  2DE5 A;  2RT9 A;  3FQM A;  3CCJ Z;  2GU2 A;  3NH5 A;  3CXC Y;  2DE6 A;  2I3C A;  1K83 I;  1YJN 1;  2F4O A;  2KI7 B;  1Q7Y 2;  2O4H A;  5T64 A;  3I56 1;  2M6N A;  2M48 A;  1VQN 1;  1TWH I;  1LQL A;  1L1O C;  1Y1V S;  3FKI I;  4RVH A;  1JJ2 Z;  3GKQ A;  3CCJ 1;  2JS4 A;  3J7A 4;  3JAM f;  4RVD A;  3RZO I;  3GTG I;  1YJW 1;  3KIH A;  1P9N A;  3GTJ I;  3BG1 B;  2VF1 A;  1S7M A;  4NFR A;  3G6E Z;  3LUS A;  4DQY B;  3I55 Z;  1N8R 1;  3IFU A;  1KC8 1;  1W2B Y;  4EWC A;  3MZK B;  1TWA I;  2O53 A;  1VLA A;  3RZD I;  1WW9 A;  2JNY A;  2Q4Z A;  3BG0 B;  2Y0S A;  3FQQ A;  2QR1 B;  1NUI A;  2VPZ A;  1WCM I;  4NBE A;  2OTJ 1;  2F4M A;  1M90 1;  2OOY B;  1Z02 A;  4MD7 A;  2W04 A;  2AYD A;  4E2Z A;  2QRD B;  3CC7 Z;  1SIW A;  3CCE Z;  1YIT 1;  3NFZ A;  3PO2 I;  1VQ5 1;  4HGY A;  1VQM Z;  3H0G I;  3CCM 1;  2H85 A;  1VQ8 1;  2RPR A;  2B63 I;  3PO3 I;  2NAP A;  4MD8 A;  3CMA Z;  1JWH C;  4CL1 A;  1VQ7 Z;  1Q86 2;  2WB1 A;  4NBG A;  1VQK Z;  2VUM I;  3CC7 1;  4A3F I;  4RVG A;  4BBS I;  1AA6 A;  1YJ9 1;  3CCE 1;  2R93 I;  3VMH A;  3P5J B;  2HU9 A;  2LEX A;  2QKD A;  2G2K A;  1VQM 1;  3U50 C;  1KD1 2;  5T67 A;  3I56 Z;  5D1O A;  2E2J I;  1K9M 2;  3NDJ A;  2OTL 1;  5FLM I;  1VQN Z;  3H3V J;  1Q7Y 1;  3CMA 1;  4NBB A;  1ZB9 A;  1VQ7 1;  3GTP I;  3GTL I;  1I50 I;  4AYB A;  3HOZ I;  3G71 1;  1VQK 1;  5LL6 f;  2QEX 1;  1SFO I;  2J6A A;  2BJO A;  1QVG Z;  2VPX A;  1JJ2 Y;  2ZAE B;  2V8I A;  4BXX I;  1TFI A;  1YJW Z;  3CPW Z;  3GTM I;  2PM9 A;  1ML8 A;  3S1N I;  1S72 1;  3GTQ I;  4A3E I;  2JA6 I;  1VQP 1;  3I07 A;  5A2Q f;  2JIQ A;  2RBL A;  2GTH A;  2YAD A;  5IT9 f;  2IZ4 A;  4NOZ A;  1TWC I;  2AKL A;  4A3G I;  2VPW A;  2P3Y A;  2YU9 I;  4X6A I;  3CXC Z;  2JIR A;  1VQO 1;  2OTJ Z;  2E7Z A;  2JUB A;  1Q82 2;  1DL6 A;  1YHQ 1;  1VQ4 1;  5FLX f;  5AN9 F;  3CCQ 1;  4QTU A;  3GTO I;  4MXU A;  1YIT Z;  1VQ5 Z;  4A3C I;  2Q51 A;  3J81 f;  4NBD A;  3ESW A;  3IX0 A;  3Q87 A;  3CCM Z;  1VQ8 Z;  1Y8C A;  4HH4 A;  1VQL Z;  5C4J I;  1YUK A;  2V8K A;  3HOX I;  1WII A;  4NB9 A;  2LFU A;  1KQS Z;  1YJ9 Z;  3F3P C;  1YI2 1;  2IV2 X;  4A3L I;  1Q86 1;  2JMO A;  1QVF Z;  5IT9 b;  4MD9 A;  1W2B Z;  3CQZ I;  1VQ6 Z;  3JAM b;  2WAQ A;  3NDI A;  2OTL Z;  2JA8 I;  3CCV Z;  1VQL 1;  3S14 I;  2JA7 I;  3HOW I;  2V45 A;  1KD1 1;  3HOY I;  2VPY A;  1K9M 1;  5D1P A;  3G71 Z;  3GCF A;  3J80 f;  2P28 A;  2QEX Z;  2NVT I;  5FLX b;  4E33 A;  2E9H A;  3VMI A;  3EED A;  3CCS 1;  3D2L A;  2JIO A;  4E2W A;  1K73 2;  2EGT A;  3I4M I;  1S72 Z;  3PO3 S;  5IP7 I;  1VQ6 1;  4MON A;  3M4O I;  3CCV 1;  2OZK A;  1QVG Y;  1VQP Z;  3HOV I;  3J81 b;  3CPW Y;  3IF8 A;  1YIJ Z;  1NJI 2;  1K8A 2;  2QRC B;  3CCL Z;  4E30 A;  5C3E I;  3S1M I;  1USP B;  2JA5 I;  4E2X A;  5IP9 I; 
#chains in the Genus database with same CATH homology
 3S2H I;  1RNI A;  3VMG A;  3CC2 Z;  5C4X I;  2NVY I;  4HGZ A;  3CCU 1;  3CD6 1;  5D1O B;  4A3B I;  1VQ9 1;  3OW2 Z;  2R6M A;  3KIF A;  1VQO Z;  4E31 A;  4NBF A;  3QWU A;  4DGL A;  4Y52 I;  1YHQ Z;  1Y1V I;  1VQ4 Z;  3M3Y I;  1YIJ 1;  3G4S Z;  3CCQ Z;  2R92 I;  1X3W A;  1M1K 2;  3CCL 1;  1ZH1 A;  4XX2 A;  4A3I I;  1Q82 1;  3GTK I;  3CCR Z;  3S1Q I;  4A3K I;  1Q81 1;  3GTM S;  2K5R A;  4RVF A;  4E32 A;  2V8J A;  3CC2 1;  1RQF A;  2E2I I;  1Y1W I;  3VTN A;  4S1T A;  3J80 b;  3S16 I;  1X3Z A;  4DK1 A;  2E2H I;  3VB9 A;  1Q81 2;  1ZB8 A;  3G4S 1;  2OOX B;  1Z01 A;  4NH1 C;  3CCR 1;  1YI2 Z;  4NBA A;  3S17 I;  1QYP A;  4A3D I;  1Z03 A;  3NH8 A;  3MZL B;  5CM2 M;  3CC4 Z;  2RIQ A;  3TDH B;  1KQS Y;  1I6H I;  4TNU A;  2NVQ I;  1NP6 A;  1QVF Y;  1N2F A;  2QA4 Z;  3CME Z;  2PMZ A;  2QLV B;  2R7Z I;  3D9X A;  2GTI A;  4RS4 A;  5A2Q b;  1N8R 2;  2KPI A;  4BBR I;  4MH4 A;  2VUG A;  3CCS Z;  4A93 I;  1PFT A;  1KC8 2;  4NBH A;  3F3F C;  3G6E 1;  3CC4 1;  2DE7 A;  3D6W A;  3TE5 B;  3I55 1;  3I4N I;  4BY1 I;  1RO4 A;  3EER A;  2HF1 A;  1K73 1;  3S15 I;  3S1R I;  4QTT A;  2QA4 1;  3CME 1;  2K3R A;  5C44 I;  1R9T I;  2RHB A;  1M90 2;  3MON A;  1X0T A;  2IZ3 A;  4NB8 A;  1NJI 1;  1K8A 1;  3CD6 Z;  1I3Q I;  3CCU Z;  1VQ9 Z;  3K7A I;  4NBC A;  5T6B A;  3NH4 A;  2JR6 A;  4A3M I;  3T4N B;  4E2Y A;  4BY7 I;  4A3J I;  3OW2 Y;  1RLY A;  1YJN Z;  4RV9 A;  1USP A;  3HOU I;  1KRL A;  1YUA A;  2W03 A;  1TWF I;  2PK7 A;  1RO0 A;  1QF8 A;  1M1K 1;  2LIY A;  3S2D I;  2QRE B;  1TWG I;  1RO2 A;  4Y7N I;  2NVX I;  4MRI A;  3HKZ A;  2DE5 A;  2RT9 A;  3FQM A;  3CCJ Z;  2GU2 A;  3NH5 A;  3CXC Y;  2DE6 A;  2I3C A;  1K83 I;  1YJN 1;  2F4O A;  2KI7 B;  1Q7Y 2;  2O4H A;  5T64 A;  3I56 1;  2M6N A;  2M48 A;  1VQN 1;  1TWH I;  1LQL A;  1L1O C;  1Y1V S;  3FKI I;  4RVH A;  1JJ2 Z;  3GKQ A;  3CCJ 1;  2JS4 A;  3J7A 4;  3JAM f;  4RVD A;  3RZO I;  3GTG I;  1YJW 1;  3KIH A;  1P9N A;  3GTJ I;  3BG1 B;  2VF1 A;  1S7M A;  4NFR A;  3G6E Z;  3LUS A;  4DQY B;  3I55 Z;  1N8R 1;  3IFU A;  1KC8 1;  1W2B Y;  4EWC A;  3MZK B;  1TWA I;  2O53 A;  1VLA A;  3RZD I;  1WW9 A;  2JNY A;  2Q4Z A;  3BG0 B;  2Y0S A;  3FQQ A;  2QR1 B;  1NUI A;  1WCM I;  4NBE A;  2OTJ 1;  2F4M A;  1M90 1;  2OOY B;  1Z02 A;  4MD7 A;  2W04 A;  4E2Z A;  2QRD B;  3CC7 Z;  3CCE Z;  1YIT 1;  3NFZ A;  3PO2 I;  1VQ5 1;  4HGY A;  1VQM Z;  3H0G I;  3CCM 1;  2H85 A;  1VQ8 1;  2RPR A;  2B63 I;  3PO3 I;  4MD8 A;  3CMA Z;  1JWH C;  4CL1 A;  1VQ7 Z;  1Q86 2;  2WB1 A;  4NBG A;  1VQK Z;  2VUM I;  3CC7 1;  4A3F I;  4RVG A;  4BBS I;  1YJ9 1;  3CCE 1;  2R93 I;  3VMH A;  3P5J B;  2HU9 A;  2QKD A;  2G2K A;  1VQM 1;  3U50 C;  1KD1 2;  5T67 A;  3I56 Z;  5D1O A;  2E2J I;  1K9M 2;  3NDJ A;  2OTL 1;  5FLM I;  1VQN Z;  3H3V J;  1Q7Y 1;  3CMA 1;  4NBB A;  1ZB9 A;  1VQ7 1;  3GTP I;  3GTL I;  1I50 I;  4AYB A;  3HOZ I;  3G71 1;  1VQK 1;  5LL6 f;  2QEX 1;  1SFO I;  2J6A A;  2BJO A;  1QVG Z;  1JJ2 Y;  2ZAE B;  2V8I A;  4BXX I;  1TFI A;  1YJW Z;  3CPW Z;  3GTM I;  2PM9 A;  1ML8 A;  3S1N I;  1S72 1;  3GTQ I;  4A3E I;  2JA6 I;  1VQP 1;  3I07 A;  5A2Q f;  2RBL A;  2GTH A;  2YAD A;  5IT9 f;  2IZ4 A;  4NOZ A;  1TWC I;  2AKL A;  4A3G I;  2P3Y A;  2YU9 I;  4X6A I;  3CXC Z;  1VQO 1;  2OTJ Z;  2JUB A;  1Q82 2;  1DL6 A;  1YHQ 1;  1VQ4 1;  5FLX f;  5AN9 F;  3CCQ 1;  4QTU A;  3GTO I;  4MXU A;  1YIT Z;  1VQ5 Z;  4A3C I;  2Q51 A;  3J81 f;  4NBD A;  3ESW A;  3IX0 A;  3Q87 A;  3CCM Z;  1VQ8 Z;  4HH4 A;  1VQL Z;  5C4J I;  1YUK A;  2V8K A;  3HOX I;  1WII A;  4NB9 A;  2LFU A;  1KQS Z;  1YJ9 Z;  3F3P C;  1YI2 1;  4A3L I;  1Q86 1;  2JMO A;  1QVF Z;  5IT9 b;  4MD9 A;  1W2B Z;  3CQZ I;  1VQ6 Z;  3JAM b;  2WAQ A;  3NDI A;  2OTL Z;  2JA8 I;  3CCV Z;  1VQL 1;  3S14 I;  2JA7 I;  3HOW I;  1KD1 1;  3HOY I;  1K9M 1;  5D1P A;  3G71 Z;  3GCF A;  3J80 f;  2P28 A;  2QEX Z;  2NVT I;  5FLX b;  4E33 A;  2E9H A;  3VMI A;  3EED A;  3CCS 1;  4E2W A;  1K73 2;  2EGT A;  3I4M I;  1S72 Z;  3PO3 S;  5IP7 I;  1VQ6 1;  4MON A;  3M4O I;  3CCV 1;  2OZK A;  1QVG Y;  1VQP Z;  3HOV I;  3J81 b;  3CPW Y;  3IF8 A;  1YIJ Z;  1NJI 2;  1K8A 2;  2QRC B;  3CCL Z;  4E30 A;  5C3E I;  3S1M I;  1USP B;  2JA5 I;  4E2X A;  5IP9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...