2R93I

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I02
4NB9A 1ML8A 3PO2I 3GTPI 1WCMI 3GTQI 2YU9I 3I4NI 3I07A 3S15I 3GTLI 3FKII 2P3YA 4NB8A 4NBAA 4X6AI 3GTMS 5IP7I 1TWCI 4A3MI 3GTJI 1K83I 2JS4A 2JA7I 2R92I 2JA5I 4NBDA 3CQZI 2R93I 1ZB8A 2B63I 3HOWI 3HOUI 3S2HI 4A3LI 3S17I 3VB9A 5C44I 4A3JI 4A3DI 2E2II 4NBFA 4NBCA 2JA8I 5FLMI 3GTKI 1TWAI 1Y1VS 1Y1WI 2RBLA 3D6WA 3EERA 3S1NI 3RZDI 1USPB 2NVQI 2JNYA 2BJOA 4A3BI 1RLYA 2VUMI 4NBBA 4A3CI 4NOZA 2HF1A 5C3EI 4QTUA 1TWGI 3VMHA 3HOXI 1LQLA 4A3EI 4A3FI 1L1OC 4A3GI 3S1RI 5C4JI 3S1MI 2NVTI 3VMIA 1QYPA 2J6AA 4NBHA 4BBRI 1R9TI 3GCFA 1ZB9A 1PFTA 2NVYI 5C4XI 4A3II 1SFOI 3M4OI 3S2DI 2DE5A 3HOZI 1RO4A 4QTTA 4A93I 1DL6A 1I3QI 2AKLA 3HOYI 1TWHI 3ESWA 1YUAA 2JR6A 3PO3S 3S1QI 3GTGI 4NBGA 3GTOI 1TWFI 2F4MA 3PO3I 3K7AI 2E2JI 1VLAA 4NBEA 3VMGA 2DE7A 1NUIA 4BY7I 1I50I 3RZOI 4A3KI 5IP9I 2DE6A 3H3VJ 4BXXI 2KPIA 4Y7NI 3M3YI 2E2HI 4Y52I 1Y1VI 2R7ZI 2F4OA 3GTMI 1I6HI 1X3WA 2K5RA 3H0GI 5CM2M 1WW9A 4XX2A 3HOVI 1X3ZA 2PK7A 3LUSA 3U50C 4BBSI 3I4MI 4BY1I 4MH4A 1TFIA 1N2FA 3Q87A 2NVXI 2JA6I 3S16I 1USPA 3GKQA 3S14I
chains in the Genus database with same CATH superfamily
1YJN1 3GTPI 1WIIA 1NJI2 1WCMI 4AYBA 3I07A 3G6EZ 2E7ZA 2OTJZ 1S72Z 1TWCI 3NFZA 3CXCZ 3GTJI 3J81b 1K83I 1P9NA 2JS4A 2VF1A 2WB1A 3G4S1 1QVGY 2R92I 2JUBA 2VUGA 2JA5I 2ZAEB 4NBDA 2R93I 1FDIA 2VPWA 4E2XA 3HOUI 4DQYB 3G711 3J80b 2IZ3A 3S17I 3VB9A 5FLXf 1NJI1 2KI7B 4NBFA 2E9HA 2JA8I 3CCS1 1Y1VS 3EERA 3S1NI 2EGTA 2VPZA 3RZDI 1USPB 3D2LA 3CCM1 4E31A 2JMOA 2GTIA 1VQK1 1RLYA 2VUMI 4NBBA 4RVDA 2PMZA 2Q51A 5C3EI 3HOXI 1LQLA 3NDIA 4E2YA 2NVTI 4NBHA 1KC82 3IFUA 1R9TI 4MD8A 4A3II 1SFOI 1Z01A 3IF8A 3T4NB 3HOZI 4A93I 2JIOA 3HKZA 1TWHI 3ESWA 5A2Qb 2I3CA 4NBGA 2QEXZ 2F4MA 3CCMZ 1VLAA 4NBEA 1NUIA 3CC21 2HU9A 2KPIA 3CCL1 2NAPA 4Y52I 3GTMI 5D1OA 2R6MA 1K9M2 1KQSZ 1VQ71 1JJ2Y 1KRLA 3HOVI 3KIHA 3U50C 4HH4A 3I4MI 1VQ51 1M1K1 2AYDA 1YIJZ 1JWHC 2QRCB 2JIMA 3CCV1 3CCR1 3G6E1 1Z02A 3PO2I 4HGYA 3CCRZ 4S1TA 3JAMf 2QLVB 1YHQZ 3I4NI 1SIWA 1VQ4Z 2P3YA 4NB8A 4NBAA 3IX0A 3VTNA 4MONA 4X6AI 3GTMS 3CCEZ 2JA7I 3CCLZ 4A3LI 2M6NA 5T6BA 1VQ81 3CCJ1 2LFUA 5FLMI 3GTKI 1TWAI 2RBLA 3D6WA 2QA41 1YJW1 1Q822 5LL6f 2O4HA 2Q4ZA 1QVGZ 2BJOA 3KIFA 2WAQA 1VQM1 5C4JI 3QWUA 3CCQ1 1VQO1 3NH8A 1QYPA 2M48A 3CCJZ 1PFTA 5IT9f 1Q821 3CCU1 5T67A 5AN9F 2GTHA 3TDHB 2AKLA 1VQKZ 1YIJ1 1KC81 2JR6A 3GTGI 1S721 1RO2A 3GTOI 1X0TA 3I55Z 3BG1B 2OTL1 3K7AI 1YIT1 3CC7Z 4E32A 1VQ61 3RZOI 4A3KI 5IP9I 1VQN1 3H3VJ 4BXXI 1W2BY 3J81f 2IZ4A 1Y1VI 2R7ZI 2F4OA 2V3VA 1X3WA 3H0GI 5CM2M 1YJ91 3CCVZ 1VQLZ 2K3RA 2PM9A 2OZKA 2QRDB 4MRIA 3Q87A 2JA6I 2NVXI 4RVGA 1YI21 3S16I 4MXUA 3FQQA 3GKQA 3CXCY 2VPXA 1K732 3CCUZ 5A2Qf 4NB9A 1ML8A 5T64A 1W2BZ 1KQSY 2YU9I 2GU2A 3S15I 5D1PA 3GTLI 3CCE1 2W03A 5IP7I 3MZKB 2V8IA 3MZLB 3I561 2Y0SA 3F3FC 1YJ9Z 1N8R1 1ZB8A 2B63I 3S2HI 1VQ41 1YUKA 4RS4A 1M901 3CD61 3J80f 1S7MA 4A3JI 4A3DI 3G71Z 1Y1WI 3CMA1 2JIQA 2JNYA 3I551 3NDJA 4A3BI 3CME1 4NOZA 2HF1A 4QTUA 1TWGI 1N8R2 3F3PC 1VQL1 3S1RI 3VMIA 2J6AA 4TNUA 3EEDA 1YHQ1 1M1K2 4MD9A 4BBRI 3GCFA 1ZB9A 3M4OI 3S2DI 2DE5A 3G4SZ 3BG0B 2OOYB 2W04A 1RO4A 1K8A1 1I3QI 3TE5B 2QEX1 3OW2Z 2O53A 1Q812 1M902 4RVFA 1JJ2Z 5D1OB 3P5JB 4RVHA 2IV2X 2E2JI 4BY7I 2DE7A 1I50I 3CPWZ 4DK1A 2RPRA 4NH1C 4Y7NI 1VQ8Z 2E2HI 1VQOZ 2H85A 3CC2Z 1VQPZ 1Q7Y2 3CD6Z 1FDOA 2K5RA 4XX2A 4EWCA 4MD7A 4RV9A 1Q811 3I56Z 4CL1A 2VPYA 4BBSI 3OW2Y 1QXFA 1RO0A 5IT9b 1N2FA 3FQMA 1YJWZ 1USPA 4E2ZA 1Q16A 1Q861 3S14I 3CPWY 3MONA 3GTQI 1K9M1 1WJ2A 3FKII 2YADA 3JAMb 2JIRA 1VQ5Z 4A3MI 2QKDA 3CC41 1AA6A 3CQZI 1VQ7Z 4DGLA 1Q862 1VQ91 3HOWI 2V45A 3NH5A 5C44I 1VQ6Z 2E2II 4E33A 4NBCA 1K731 1RNIA 3CC71 1YITZ 2NVQI 2OTLZ 4A3CI 2LIYA 2QR1B 2RHBA 1QVFY 2OTJ1 3CMEZ 3VMHA 4A3EI 1Z03A 4A3FI 1L1OC 4A3GI 3S1MI 1KD11 3CMAZ 4HGZA 2RT9A 1Q7Y1 1YJNZ 1VQNZ 2V8JA 2NVYI 5C4XI 3CC4Z 1NP6A 1VQ9Z 3CCQZ 4QTTA 2QREB 1DL6A 3HOYI 1YUAA 3PO3S 3S1QI 3NH4A 2JIPA 2RIQA 1TWFI 2QA4Z 4E2WA 3D9XA 1KD12 3PO3I 4NFRA 3VMGA 1WZNA 5FLXb 2G2KA 2LEXA 3CCSZ 2DE6A 1QVFZ 3IR7A 3M3YI 4E30A 1YI2Z 1VQMZ 1Y8CA 1I6HI 1QF8A 1WW9A 2V8KA 1X3ZA 2P28A 2PK7A 3LUSA 3J7A4 1RQFA 4BY1I 4MH4A 1K8A2 1TFIA 1ZH1A 1VQP1 2OOXB
chains in the Genus database with same CATH topology
1YJN1 3GTPI 1WIIA 1NJI2 1WCMI 4AYBA 3I07A 3G6EZ 2OTJZ 1S72Z 1TWCI 3NFZA 3CXCZ 3GTJI 3J81b 1K83I 1P9NA 2JS4A 2VF1A 2WB1A 3G4S1 1QVGY 2R92I 2JUBA 2VUGA 2JA5I 2ZAEB 4NBDA 2R93I 4E2XA 3HOUI 4DQYB 3G711 3J80b 2IZ3A 3S17I 3VB9A 5FLXf 1NJI1 2KI7B 4NBFA 2E9HA 2JA8I 3CCS1 1Y1VS 3EERA 3S1NI 2EGTA 3RZDI 1USPB 3CCM1 4E31A 2JMOA 2GTIA 1VQK1 1RLYA 2VUMI 4NBBA 4RVDA 2PMZA 2Q51A 5C3EI 3HOXI 1LQLA 3NDIA 4E2YA 2NVTI 4NBHA 1KC82 3IFUA 1R9TI 4MD8A 4A3II 1SFOI 1Z01A 3IF8A 3T4NB 3HOZI 4A93I 3HKZA 5A2Qb 1TWHI 3ESWA 2I3CA 4NBGA 2QEXZ 2F4MA 3CCMZ 1VLAA 4NBEA 1NUIA 3CC21 2HU9A 2KPIA 3CCL1 4Y52I 3GTMI 5D1OA 2R6MA 1K9M2 1KQSZ 1VQ71 1JJ2Y 1KRLA 3HOVI 3KIHA 3U50C 4HH4A 3I4MI 1VQ51 1M1K1 1YIJZ 1JWHC 2QRCB 3CCV1 3CCR1 3G6E1 1Z02A 3PO2I 4HGYA 3CCRZ 4S1TA 3JAMf 2QLVB 1YHQZ 3I4NI 1VQ4Z 2P3YA 4NB8A 4NBAA 3IX0A 3VTNA 4MONA 4X6AI 3GTMS 3CCEZ 2JA7I 3CCLZ 4A3LI 2M6NA 5T6BA 1VQ81 3CCJ1 2LFUA 5FLMI 3GTKI 1TWAI 2RBLA 3D6WA 2QA41 1YJW1 1Q822 5LL6f 2O4HA 2Q4ZA 1QVGZ 2BJOA 3KIFA 2WAQA 1VQM1 5C4JI 3QWUA 3CCQ1 1VQO1 3NH8A 1QYPA 2M48A 3CCJZ 1PFTA 5IT9f 1Q821 3CCU1 5T67A 5AN9F 2GTHA 3TDHB 2AKLA 1VQKZ 1YIJ1 1KC81 2JR6A 3GTGI 1S721 1RO2A 3GTOI 1X0TA 3I55Z 3BG1B 2OTL1 3K7AI 3CC7Z 1YIT1 4E32A 1VQ61 3RZOI 4A3KI 5IP9I 1VQN1 3H3VJ 4BXXI 1W2BY 3J81f 2IZ4A 1Y1VI 2R7ZI 2F4OA 1X3WA 3H0GI 5CM2M 1YJ91 3CCVZ 1VQLZ 2K3RA 2PM9A 2OZKA 2QRDB 4MRIA 3Q87A 2JA6I 2NVXI 4RVGA 1YI21 3S16I 4MXUA 3FQQA 3GKQA 3CXCY 1K732 3CCUZ 5A2Qf 4NB9A 1ML8A 5T64A 1W2BZ 1KQSY 2YU9I 2GU2A 3S15I 5D1PA 3GTLI 3CCE1 2W03A 5IP7I 3MZKB 2V8IA 3MZLB 3I561 2Y0SA 3F3FC 1YJ9Z 1N8R1 1ZB8A 2B63I 3S2HI 1VQ41 1YUKA 4RS4A 1M901 3CD61 3J80f 1S7MA 4A3JI 4A3DI 3G71Z 1Y1WI 3CMA1 2JNYA 3I551 3NDJA 4A3BI 3CME1 4NOZA 2HF1A 4QTUA 1TWGI 1N8R2 3F3PC 1VQL1 3S1RI 3VMIA 2J6AA 4TNUA 3EEDA 1YHQ1 1M1K2 4MD9A 4BBRI 3GCFA 1ZB9A 3M4OI 3S2DI 2DE5A 3G4SZ 3BG0B 2OOYB 2W04A 1RO4A 1K8A1 1I3QI 3TE5B 2QEX1 3OW2Z 2O53A 1Q812 1M902 4RVFA 1JJ2Z 5D1OB 3P5JB 4RVHA 2E2JI 4BY7I 2DE7A 1I50I 3CPWZ 4DK1A 2RPRA 4NH1C 4Y7NI 1VQ8Z 2E2HI 1VQOZ 2H85A 3CC2Z 1VQPZ 1Q7Y2 3CD6Z 2K5RA 4XX2A 4EWCA 4MD7A 1Q811 4RV9A 3I56Z 4CL1A 4BBSI 3OW2Y 1RO0A 5IT9b 1N2FA 3FQMA 1YJWZ 1USPA 4E2ZA 1Q861 3S14I 3CPWY 3MONA 3GTQI 1K9M1 3FKII 2YADA 3JAMb 1VQ5Z 4A3MI 2QKDA 3CC41 3CQZI 1VQ7Z 4DGLA 1Q862 1VQ91 3HOWI 3NH5A 5C44I 1VQ6Z 2E2II 4E33A 4NBCA 1K731 1RNIA 3CC71 1YITZ 2NVQI 2OTLZ 4A3CI 2LIYA 2QR1B 2RHBA 1QVFY 2OTJ1 3CMEZ 3VMHA 4A3EI 1Z03A 4A3FI 1L1OC 4A3GI 3S1MI 1KD11 3CMAZ 4HGZA 2RT9A 1Q7Y1 1YJNZ 1VQNZ 2V8JA 2NVYI 5C4XI 3CC4Z 1NP6A 1VQ9Z 3CCQZ 4QTTA 2QREB 1DL6A 3HOYI 1YUAA 3PO3S 3S1QI 3NH4A 2RIQA 1TWFI 2QA4Z 4E2WA 3D9XA 1KD12 3PO3I 4NFRA 3VMGA 5FLXb 2G2KA 3CCSZ 2DE6A 1QVFZ 3M3YI 4E30A 1YI2Z 1VQMZ 1I6HI 1QF8A 1WW9A 2V8KA 1X3ZA 2P28A 2PK7A 3LUSA 3J7A4 1RQFA 4BY1I 4MH4A 1K8A2 1TFIA 1ZH1A 1VQP1 2OOXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB9 A;  1ML8 A;  3PO2 I;  3GTP I;  1WCM I;  3GTQ I;  2YU9 I;  3I4N I;  3I07 A;  3S15 I;  3GTL I;  3FKI I;  2P3Y A;  4NB8 A;  4NBA A;  4X6A I;  3GTM S;  5IP7 I;  1TWC I;  4A3M I;  3GTJ I;  1K83 I;  2JS4 A;  2JA7 I;  2R92 I;  2JA5 I;  4NBD A;  3CQZ I;  2R93 I;  1ZB8 A;  2B63 I;  3HOW I;  3HOU I;  3S2H I;  4A3L I;  3S17 I;  3VB9 A;  5C44 I;  4A3J I;  4A3D I;  2E2I I;  4NBF A;  4NBC A;  2JA8 I;  5FLM I;  3GTK I;  1TWA I;  1Y1V S;  1Y1W I;  2RBL A;  3D6W A;  3EER A;  3S1N I;  3RZD I;  1USP B;  2NVQ I;  2JNY A;  2BJO A;  4A3B I;  1RLY A;  2VUM I;  4NBB A;  4A3C I;  4NOZ A;  2HF1 A;  5C3E I;  4QTU A;  1TWG I;  3VMH A;  3HOX I;  1LQL A;  4A3E I;  4A3F I;  1L1O C;  4A3G I;  3S1R I;  5C4J I;  3S1M I;  2NVT I;  3VMI A;  1QYP A;  2J6A A;  4NBH A;  4BBR I;  1R9T I;  3GCF A;  1ZB9 A;  1PFT A;  2NVY I;  5C4X I;  4A3I I;  1SFO I;  3M4O I;  3S2D I;  2DE5 A;  3HOZ I;  1RO4 A;  4QTT A;  4A93 I;  1DL6 A;  1I3Q I;  2AKL A;  3HOY I;  1TWH I;  3ESW A;  1YUA A;  2JR6 A;  3PO3 S;  3S1Q I;  3GTG I;  4NBG A;  3GTO I;  1TWF I;  2F4M A;  3PO3 I;  3K7A I;  2E2J I;  1VLA A;  4NBE A;  3VMG A;  2DE7 A;  1NUI A;  4BY7 I;  1I50 I;  3RZO I;  4A3K I;  5IP9 I;  2DE6 A;  3H3V J;  4BXX I;  2KPI A;  4Y7N I;  3M3Y I;  2E2H I;  4Y52 I;  1Y1V I;  2R7Z I;  2F4O A;  3GTM I;  1I6H I;  1X3W A;  2K5R A;  3H0G I;  5CM2 M;  1WW9 A;  4XX2 A;  3HOV I;  1X3Z A;  2PK7 A;  3LUS A;  3U50 C;  4BBS I;  3I4M I;  4BY1 I;  4MH4 A;  1TFI A;  1N2F A;  3Q87 A;  2NVX I;  2JA6 I;  3S16 I;  1USP A;  3GKQ A;  3S14 I; 
#chains in the Genus database with same CATH topology
 1YJN 1;  3GTP I;  1WII A;  1NJI 2;  1WCM I;  4AYB A;  3I07 A;  3G6E Z;  2E7Z A;  2OTJ Z;  1S72 Z;  1TWC I;  3NFZ A;  3CXC Z;  3GTJ I;  3J81 b;  1K83 I;  1P9N A;  2JS4 A;  2VF1 A;  2WB1 A;  3G4S 1;  1QVG Y;  2R92 I;  2JUB A;  2VUG A;  2JA5 I;  2ZAE B;  4NBD A;  2R93 I;  1FDI A;  2VPW A;  4E2X A;  3HOU I;  4DQY B;  3G71 1;  3J80 b;  2IZ3 A;  3S17 I;  3VB9 A;  5FLX f;  1NJI 1;  2KI7 B;  4NBF A;  2E9H A;  2JA8 I;  3CCS 1;  1Y1V S;  3EER A;  3S1N I;  2EGT A;  2VPZ A;  3RZD I;  1USP B;  3D2L A;  3CCM 1;  4E31 A;  2JMO A;  2GTI A;  1VQK 1;  1RLY A;  2VUM I;  4NBB A;  4RVD A;  2PMZ A;  2Q51 A;  5C3E I;  3HOX I;  1LQL A;  3NDI A;  4E2Y A;  2NVT I;  4NBH A;  1KC8 2;  3IFU A;  1R9T I;  4MD8 A;  4A3I I;  1SFO I;  1Z01 A;  3IF8 A;  3T4N B;  3HOZ I;  4A93 I;  2JIO A;  3HKZ A;  1TWH I;  3ESW A;  5A2Q b;  2I3C A;  4NBG A;  2QEX Z;  2F4M A;  3CCM Z;  1VLA A;  4NBE A;  1NUI A;  3CC2 1;  2HU9 A;  2KPI A;  3CCL 1;  2NAP A;  4Y52 I;  3GTM I;  5D1O A;  2R6M A;  1K9M 2;  1KQS Z;  1VQ7 1;  1JJ2 Y;  1KRL A;  3HOV I;  3KIH A;  3U50 C;  4HH4 A;  3I4M I;  1VQ5 1;  1M1K 1;  2AYD A;  1YIJ Z;  1JWH C;  2QRC B;  2JIM A;  3CCV 1;  3CCR 1;  3G6E 1;  1Z02 A;  3PO2 I;  4HGY A;  3CCR Z;  4S1T A;  3JAM f;  2QLV B;  1YHQ Z;  3I4N I;  1SIW A;  1VQ4 Z;  2P3Y A;  4NB8 A;  4NBA A;  3IX0 A;  3VTN A;  4MON A;  4X6A I;  3GTM S;  3CCE Z;  2JA7 I;  3CCL Z;  4A3L I;  2M6N A;  5T6B A;  1VQ8 1;  3CCJ 1;  2LFU A;  5FLM I;  3GTK I;  1TWA I;  2RBL A;  3D6W A;  2QA4 1;  1YJW 1;  1Q82 2;  5LL6 f;  2O4H A;  2Q4Z A;  1QVG Z;  2BJO A;  3KIF A;  2WAQ A;  1VQM 1;  5C4J I;  3QWU A;  3CCQ 1;  1VQO 1;  3NH8 A;  1QYP A;  2M48 A;  3CCJ Z;  1PFT A;  5IT9 f;  1Q82 1;  3CCU 1;  5T67 A;  5AN9 F;  2GTH A;  3TDH B;  2AKL A;  1VQK Z;  1YIJ 1;  1KC8 1;  2JR6 A;  3GTG I;  1S72 1;  1RO2 A;  3GTO I;  1X0T A;  3I55 Z;  3BG1 B;  2OTL 1;  3K7A I;  1YIT 1;  3CC7 Z;  4E32 A;  1VQ6 1;  3RZO I;  4A3K I;  5IP9 I;  1VQN 1;  3H3V J;  4BXX I;  1W2B Y;  3J81 f;  2IZ4 A;  1Y1V I;  2R7Z I;  2F4O A;  2V3V A;  1X3W A;  3H0G I;  5CM2 M;  1YJ9 1;  3CCV Z;  1VQL Z;  2K3R A;  2PM9 A;  2OZK A;  2QRD B;  4MRI A;  3Q87 A;  2JA6 I;  2NVX I;  4RVG A;  1YI2 1;  3S16 I;  4MXU A;  3FQQ A;  3GKQ A;  3CXC Y;  2VPX A;  1K73 2;  3CCU Z;  5A2Q f;  4NB9 A;  1ML8 A;  5T64 A;  1W2B Z;  1KQS Y;  2YU9 I;  2GU2 A;  3S15 I;  5D1P A;  3GTL I;  3CCE 1;  2W03 A;  5IP7 I;  3MZK B;  2V8I A;  3MZL B;  3I56 1;  2Y0S A;  3F3F C;  1YJ9 Z;  1N8R 1;  1ZB8 A;  2B63 I;  3S2H I;  1VQ4 1;  1YUK A;  4RS4 A;  1M90 1;  3CD6 1;  3J80 f;  1S7M A;  4A3J I;  4A3D I;  3G71 Z;  1Y1W I;  3CMA 1;  2JIQ A;  2JNY A;  3I55 1;  3NDJ A;  4A3B I;  3CME 1;  4NOZ A;  2HF1 A;  4QTU A;  1TWG I;  1N8R 2;  3F3P C;  1VQL 1;  3S1R I;  3VMI A;  2J6A A;  4TNU A;  3EED A;  1YHQ 1;  1M1K 2;  4MD9 A;  4BBR I;  3GCF A;  1ZB9 A;  3M4O I;  3S2D I;  2DE5 A;  3G4S Z;  3BG0 B;  2OOY B;  2W04 A;  1RO4 A;  1K8A 1;  1I3Q I;  3TE5 B;  2QEX 1;  3OW2 Z;  2O53 A;  1Q81 2;  1M90 2;  4RVF A;  1JJ2 Z;  5D1O B;  3P5J B;  4RVH A;  2IV2 X;  2E2J I;  4BY7 I;  2DE7 A;  1I50 I;  3CPW Z;  4DK1 A;  2RPR A;  4NH1 C;  4Y7N I;  1VQ8 Z;  2E2H I;  1VQO Z;  2H85 A;  3CC2 Z;  1VQP Z;  1Q7Y 2;  3CD6 Z;  1FDO A;  2K5R A;  4XX2 A;  4EWC A;  4MD7 A;  4RV9 A;  1Q81 1;  3I56 Z;  4CL1 A;  2VPY A;  4BBS I;  3OW2 Y;  1QXF A;  1RO0 A;  5IT9 b;  1N2F A;  3FQM A;  1YJW Z;  1USP A;  4E2Z A;  1Q16 A;  1Q86 1;  3S14 I;  3CPW Y;  3MON A;  3GTQ I;  1K9M 1;  1WJ2 A;  3FKI I;  2YAD A;  3JAM b;  2JIR A;  1VQ5 Z;  4A3M I;  2QKD A;  3CC4 1;  1AA6 A;  3CQZ I;  1VQ7 Z;  4DGL A;  1Q86 2;  1VQ9 1;  3HOW I;  2V45 A;  3NH5 A;  5C44 I;  1VQ6 Z;  2E2I I;  4E33 A;  4NBC A;  1K73 1;  1RNI A;  3CC7 1;  1YIT Z;  2NVQ I;  2OTL Z;  4A3C I;  2LIY A;  2QR1 B;  2RHB A;  1QVF Y;  2OTJ 1;  3CME Z;  3VMH A;  4A3E I;  1Z03 A;  4A3F I;  1L1O C;  4A3G I;  3S1M I;  1KD1 1;  3CMA Z;  4HGZ A;  2RT9 A;  1Q7Y 1;  1YJN Z;  1VQN Z;  2V8J A;  2NVY I;  5C4X I;  3CC4 Z;  1NP6 A;  1VQ9 Z;  3CCQ Z;  4QTT A;  2QRE B;  1DL6 A;  3HOY I;  1YUA A;  3PO3 S;  3S1Q I;  3NH4 A;  2JIP A;  2RIQ A;  1TWF I;  2QA4 Z;  4E2W A;  3D9X A;  1KD1 2;  3PO3 I;  4NFR A;  3VMG A;  1WZN A;  5FLX b;  2G2K A;  2LEX A;  3CCS Z;  2DE6 A;  1QVF Z;  3IR7 A;  3M3Y I;  4E30 A;  1YI2 Z;  1VQM Z;  1Y8C A;  1I6H I;  1QF8 A;  1WW9 A;  2V8K A;  1X3Z A;  2P28 A;  2PK7 A;  3LUS A;  3J7A 4;  1RQF A;  4BY1 I;  4MH4 A;  1K8A 2;  1TFI A;  1ZH1 A;  1VQP 1;  2OOX B; 
#chains in the Genus database with same CATH homology
 1YJN 1;  3GTP I;  1WII A;  1NJI 2;  1WCM I;  4AYB A;  3I07 A;  3G6E Z;  2OTJ Z;  1S72 Z;  1TWC I;  3NFZ A;  3CXC Z;  3GTJ I;  3J81 b;  1K83 I;  1P9N A;  2JS4 A;  2VF1 A;  2WB1 A;  3G4S 1;  1QVG Y;  2R92 I;  2JUB A;  2VUG A;  2JA5 I;  2ZAE B;  4NBD A;  2R93 I;  4E2X A;  3HOU I;  4DQY B;  3G71 1;  3J80 b;  2IZ3 A;  3S17 I;  3VB9 A;  5FLX f;  1NJI 1;  2KI7 B;  4NBF A;  2E9H A;  2JA8 I;  3CCS 1;  1Y1V S;  3EER A;  3S1N I;  2EGT A;  3RZD I;  1USP B;  3CCM 1;  4E31 A;  2JMO A;  2GTI A;  1VQK 1;  1RLY A;  2VUM I;  4NBB A;  4RVD A;  2PMZ A;  2Q51 A;  5C3E I;  3HOX I;  1LQL A;  3NDI A;  4E2Y A;  2NVT I;  4NBH A;  1KC8 2;  3IFU A;  1R9T I;  4MD8 A;  4A3I I;  1SFO I;  1Z01 A;  3IF8 A;  3T4N B;  3HOZ I;  4A93 I;  3HKZ A;  5A2Q b;  1TWH I;  3ESW A;  2I3C A;  4NBG A;  2QEX Z;  2F4M A;  3CCM Z;  1VLA A;  4NBE A;  1NUI A;  3CC2 1;  2HU9 A;  2KPI A;  3CCL 1;  4Y52 I;  3GTM I;  5D1O A;  2R6M A;  1K9M 2;  1KQS Z;  1VQ7 1;  1JJ2 Y;  1KRL A;  3HOV I;  3KIH A;  3U50 C;  4HH4 A;  3I4M I;  1VQ5 1;  1M1K 1;  1YIJ Z;  1JWH C;  2QRC B;  3CCV 1;  3CCR 1;  3G6E 1;  1Z02 A;  3PO2 I;  4HGY A;  3CCR Z;  4S1T A;  3JAM f;  2QLV B;  1YHQ Z;  3I4N I;  1VQ4 Z;  2P3Y A;  4NB8 A;  4NBA A;  3IX0 A;  3VTN A;  4MON A;  4X6A I;  3GTM S;  3CCE Z;  2JA7 I;  3CCL Z;  4A3L I;  2M6N A;  5T6B A;  1VQ8 1;  3CCJ 1;  2LFU A;  5FLM I;  3GTK I;  1TWA I;  2RBL A;  3D6W A;  2QA4 1;  1YJW 1;  1Q82 2;  5LL6 f;  2O4H A;  2Q4Z A;  1QVG Z;  2BJO A;  3KIF A;  2WAQ A;  1VQM 1;  5C4J I;  3QWU A;  3CCQ 1;  1VQO 1;  3NH8 A;  1QYP A;  2M48 A;  3CCJ Z;  1PFT A;  5IT9 f;  1Q82 1;  3CCU 1;  5T67 A;  5AN9 F;  2GTH A;  3TDH B;  2AKL A;  1VQK Z;  1YIJ 1;  1KC8 1;  2JR6 A;  3GTG I;  1S72 1;  1RO2 A;  3GTO I;  1X0T A;  3I55 Z;  3BG1 B;  2OTL 1;  3K7A I;  3CC7 Z;  1YIT 1;  4E32 A;  1VQ6 1;  3RZO I;  4A3K I;  5IP9 I;  1VQN 1;  3H3V J;  4BXX I;  1W2B Y;  3J81 f;  2IZ4 A;  1Y1V I;  2R7Z I;  2F4O A;  1X3W A;  3H0G I;  5CM2 M;  1YJ9 1;  3CCV Z;  1VQL Z;  2K3R A;  2PM9 A;  2OZK A;  2QRD B;  4MRI A;  3Q87 A;  2JA6 I;  2NVX I;  4RVG A;  1YI2 1;  3S16 I;  4MXU A;  3FQQ A;  3GKQ A;  3CXC Y;  1K73 2;  3CCU Z;  5A2Q f;  4NB9 A;  1ML8 A;  5T64 A;  1W2B Z;  1KQS Y;  2YU9 I;  2GU2 A;  3S15 I;  5D1P A;  3GTL I;  3CCE 1;  2W03 A;  5IP7 I;  3MZK B;  2V8I A;  3MZL B;  3I56 1;  2Y0S A;  3F3F C;  1YJ9 Z;  1N8R 1;  1ZB8 A;  2B63 I;  3S2H I;  1VQ4 1;  1YUK A;  4RS4 A;  1M90 1;  3CD6 1;  3J80 f;  1S7M A;  4A3J I;  4A3D I;  3G71 Z;  1Y1W I;  3CMA 1;  2JNY A;  3I55 1;  3NDJ A;  4A3B I;  3CME 1;  4NOZ A;  2HF1 A;  4QTU A;  1TWG I;  1N8R 2;  3F3P C;  1VQL 1;  3S1R I;  3VMI A;  2J6A A;  4TNU A;  3EED A;  1YHQ 1;  1M1K 2;  4MD9 A;  4BBR I;  3GCF A;  1ZB9 A;  3M4O I;  3S2D I;  2DE5 A;  3G4S Z;  3BG0 B;  2OOY B;  2W04 A;  1RO4 A;  1K8A 1;  1I3Q I;  3TE5 B;  2QEX 1;  3OW2 Z;  2O53 A;  1Q81 2;  1M90 2;  4RVF A;  1JJ2 Z;  5D1O B;  3P5J B;  4RVH A;  2E2J I;  4BY7 I;  2DE7 A;  1I50 I;  3CPW Z;  4DK1 A;  2RPR A;  4NH1 C;  4Y7N I;  1VQ8 Z;  2E2H I;  1VQO Z;  2H85 A;  3CC2 Z;  1VQP Z;  1Q7Y 2;  3CD6 Z;  2K5R A;  4XX2 A;  4EWC A;  4MD7 A;  1Q81 1;  4RV9 A;  3I56 Z;  4CL1 A;  4BBS I;  3OW2 Y;  1RO0 A;  5IT9 b;  1N2F A;  3FQM A;  1YJW Z;  1USP A;  4E2Z A;  1Q86 1;  3S14 I;  3CPW Y;  3MON A;  3GTQ I;  1K9M 1;  3FKI I;  2YAD A;  3JAM b;  1VQ5 Z;  4A3M I;  2QKD A;  3CC4 1;  3CQZ I;  1VQ7 Z;  4DGL A;  1Q86 2;  1VQ9 1;  3HOW I;  3NH5 A;  5C44 I;  1VQ6 Z;  2E2I I;  4E33 A;  4NBC A;  1K73 1;  1RNI A;  3CC7 1;  1YIT Z;  2NVQ I;  2OTL Z;  4A3C I;  2LIY A;  2QR1 B;  2RHB A;  1QVF Y;  2OTJ 1;  3CME Z;  3VMH A;  4A3E I;  1Z03 A;  4A3F I;  1L1O C;  4A3G I;  3S1M I;  1KD1 1;  3CMA Z;  4HGZ A;  2RT9 A;  1Q7Y 1;  1YJN Z;  1VQN Z;  2V8J A;  2NVY I;  5C4X I;  3CC4 Z;  1NP6 A;  1VQ9 Z;  3CCQ Z;  4QTT A;  2QRE B;  1DL6 A;  3HOY I;  1YUA A;  3PO3 S;  3S1Q I;  3NH4 A;  2RIQ A;  1TWF I;  2QA4 Z;  4E2W A;  3D9X A;  1KD1 2;  3PO3 I;  4NFR A;  3VMG A;  5FLX b;  2G2K A;  3CCS Z;  2DE6 A;  1QVF Z;  3M3Y I;  4E30 A;  1YI2 Z;  1VQM Z;  1I6H I;  1QF8 A;  1WW9 A;  2V8K A;  1X3Z A;  2P28 A;  2PK7 A;  3LUS A;  3J7A 4;  1RQF A;  4BY1 I;  4MH4 A;  1K8A 2;  1TFI A;  1ZH1 A;  1VQP 1;  2OOX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...