2R93I

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I02
2JS4A 1SFOI 3FKII 2JR6A 3GTKI 3I4MI 2BJOA 1USPA 1RO4A 2R93I 1ML8A 1Y1VS 1X3ZA 3PO2I 3GTQI 3HOVI 1YUAA 3S1RI 2E2JI 3M4OI 3VMIA 4NBCA 2B63I 3GTGI 4BXXI 1Y1VI 1DL6A 2F4OA 3U50C 2R92I 2JA7I 3GCFA 4NBFA 2HF1A 3GTOI 3S14I 1K83I 4X6AI 4NBAA 2YU9I 3PO3S 3M3YI 1Y1WI 4A3LI 2P3YA 4A93I 3Q87A 4A3EI 1WW9A 1R9TI 3PO3I 4BBSI 1TWHI 4NB8A 3GTLI 2E2II 2AKLA 3HOWI 4A3II 4A3KI 5FLMI 4A3BI 3LUSA 1ZB9A 2DE7A 5C4JI 2JA6I 3S17I 4BBRI 3K7AI 3CQZI 2NVTI 4A3DI 1I50I 3EERA 4A3FI 1TWAI 3RZOI 3VMHA 1N2FA 3H3VJ 4NOZA 2R7ZI 3H0GI 1WCMI 3I07A 3GKQA 2NVYI 3GTMS 1TFIA 2PK7A 4XX2A 1PFTA 2NVQI 3I4NI 3S2HI 4QTTA 2JNYA 4BY7I 2E2HI 5IP7I 2NVXI 3GTMI 1TWGI 1ZB8A 2JA8I 4A3JI 3VMGA 4NBEA 2F4MA 1X3WA 2J6AA 3S2DI 2DE5A 2KPIA 1USPB 4A3GI 1TWCI 5CM2M 3GTJI 4Y52I 5C44I 1TWFI 4NBGA 3S15I 1VLAA 2VUMI 3D6WA 3RZDI 5IP9I 4BY1I 1I6HI 2DE6A 4NBBA 1LQLA 5C3EI 3S1NI 2RBLA 3S16I 4NB9A 3HOXI 3HOZI 1RLYA 2JA5I 4NBDA 4Y7NI 1QYPA 4MH4A 3GTPI 4NBHA 4QTUA 1I3QI 4A3CI 3HOYI 1NUIA 3ESWA 3HOUI 4A3MI 3VB9A 2K5RA 3S1MI 3S1QI 1L1OC 5C4XI
chains in the Genus database with same CATH superfamily
2JS4A 2JR6A 2W04A 2BJOA 1USPA 3J80b 1RO4A 1YIT1 1Y1VS 1X3ZA 3PO2I 3GTQI 3HOVI 1YUAA 1WJ2A 3QWUA 3M4OI 1VQK1 4BXXI 1QVFZ 5LL6f 2JUBA 2JA7I 4NBFA 4RVDA 1N8R2 4HH4A 2JIOA 4A3EI 1R9TI 3PO3I 2QREB 3MONA 1TWHI 3P5JB 2QLVB 3D9XA 2AKLA 3HOWI 1VQNZ 3BG1B 3LUSA 3J7A4 2QR1B 3S17I 1VQ8Z 2QRCB 4MRIA 3CCR1 2NVTI 2P28A 3EERA 2IZ3A 1KRLA 3VMHA 5FLXf 2YADA 3I551 2IV2X 3S2HI 4QTTA 5D1OA 5IT9f 2VPWA 1W2BY 3CCEZ 2OTJZ 3TE5B 1KC81 1TWGI 1ZB8A 1S72Z 1YJN1 4RVHA 4E2XA 2GU2A 3VMGA 5FLXb 4A3JI 1X3WA 3NH4A 2DE5A 3IFUA 1YJW1 1FDIA 1YJNZ 1VQL1 4E33A 2OOYB 3CCU1 1VLAA 4TNUA 2WAQA 1VQP1 4NBBA 3G71Z 1YJWZ 1VQLZ 2G2KA 3CCL1 1KQSY 1JJ2Y 4RV9A 1KC82 4DGLA 3HOZI 4NBDA 4Y7NI 1Q16A 3G6E1 2E7ZA 1QVFY 3GTPI 4NBHA 1VQ61 1VQ9Z 4A3CI 3CPWY 4EWCA 4RVFA 4A3MI 3VB9A 4DQYB 2V45A 3G6EZ 2EGTA 2AYDA 5C4XI 5T64A 1RQFA 3FKII 3I4MI 2Q51A 1M1K2 1ML8A 3CC7Z 1KD12 3S1RI 4RS4A 2E2JI 3VMIA 3GTGI 2VPZA 2R92I 1N8R1 3J80f 2HF1A 3S14I 4X6AI 4NBAA 3PO3S 3M3YI 2VPXA 4A3LI 1YHQZ 3CCV1 1Q7Y2 1VQ71 4E30A 3F3FC 1KQSZ 3CXCY 4A3BI 2LFUA 2JIRA 3CCVZ 1JJ2Z 2DE7A 5C4JI 2JA6I 2LIYA 3CC4Z 1VQ7Z 3MZLB 3CPWZ 2M48A 3FQMA 2OZKA 1YUKA 3H0GI 1VQN1 1QF8A 3CC21 1TFIA 2JIMA 3NDJA 2I3CA 4BY7I 1K731 1VQ81 5IP7I 2NVXI 1K8A2 3J81b 1VQM1 1YJ9Z 3CC2Z 1Z01A 4NBEA 2F4MA 3TDHB 3S2DI 3CCQZ 1USPB 1RO0A 1VQMZ 3CCE1 2OTJ1 1TWCI 3NH5A 2RPRA 3G4SZ 3KIHA 1S721 2QKDA 4HGYA 4BY1I 1I6HI 2DE6A 3HKZA 1LQLA 5C3EI 3S1NI 1K732 2JIPA 2O4HA 3S16I 3CXCZ 4NB9A 3HOXI 3MZKB 3CMA1 1Z02A 2E9HA 5AN9F 1QVGZ 1QYPA 3CCMZ 1I3QI 2GTIA 1NJI1 4AYBA 3G711 3CMAZ 3S1MI 1NP6A 2Q4ZA 3GTKI 1M1K1 1KD11 2Y0SA 1VQ91 1VQ51 4NBCA 1DL6A 2F4OA 2PMZA 3U50C 2O53A 3NDIA 2QEX1 1VQ5Z 1K83I 3JAMb 2YU9I 1Q7Y1 2P3YA 4A93I 5A2Qb 3CC71 3NH8A 4NFRA 3T4NB 1NJI2 4BBSI 2OTL1 2E2II 5T6BA 2QEXZ 1SIWA 1QXFA 4A3II 2QA4Z 1ZB9A 1YHQ1 4BBRI 1I50I 3CME1 2OTLZ 4A3FI 2PM9A 1TWAI 3RZOI 3CCJ1 3H3VJ 2HU9A 4NOZA 1Q861 2R7ZI 1WCMI 1YIJ1 3I4NI 2NVQI 4XX2A 1PFTA 1S7MA 2JNYA 3CMEZ 3CC41 3CCJZ 1K8A1 3GTMI 4MD9A 2RIQA 1YIJZ 2V3VA 2V8IA 1RNIA 3IR7A 1YI21 2J6AA 2V8KA 1QVGY 1VQOZ 2KPIA 3J81f 4A3GI 2RHBA 3GTJI 2VF1A 4Y52I 5C44I 1TWFI 1Q862 1YI2Z 1YJ91 1P9NA 3D6WA 1JWHC 5IP9I 3VTNA 3CCQ1 2JIQA 1K9M2 1Q811 2R6MA 1RLYA 2JA5I 5D1PA 3G4S1 4QTUA 3HOYI 3ESWA 1FDOA 1YITZ 3KIFA 1VQKZ 3S1QI 1Y8CA 4S1TA 2K3RA 1SFOI 4MXUA 3CCM1 1RO2A 2WB1A 2R93I 3FQQA 2JMOA 4MONA 2B63I 1Q812 1Y1VI 3GCFA 3F3PC 4E2YA 3GTOI 4E2WA 1Y1WI 3Q87A 1WW9A 1ZH1A 4E32A 3CCRZ 1VQ41 3I561 1X0TA 4NB8A 3GTLI 3JAMf 5A2Qf 3I55Z 4A3KI 5FLMI 1VQ4Z 3CD61 3I56Z 4RVGA 3K7AI 3CQZI 4A3DI 5D1OB 5IT9b 1N2FA 3OW2Y 2ZAEB 3I07A 3GKQA 2QRDB 3CD6Z 2NVYI 3GTMS 2PK7A 2VPYA 2QA41 1Q821 3IF8A 2E2HI 4DK1A 1WIIA 2H85A 1M901 3D2LA 2JA8I 1Z03A 3CCUZ 2W03A 3CCS1 1VQPZ 2KI7B 4CL1A 4E2ZA 3CCLZ 3EEDA 5CM2M 3CCSZ 4NBGA 2VUGA 3S15I 2VUMI 1VQ6Z 3NFZA 1AA6A 2RT9A 3RZDI 4NH1C 1W2BZ 1K9M1 1VQO1 4HGZA 2LEXA 1Q822 2RBLA 2NAPA 3BG0B 2V8JA 1WZNA 1M902 4MH4A 1NUIA 5T67A 3OW2Z 2M6NA 3IX0A 2OOXB 4MD8A 3HOUI 4E31A 2K5RA 2IZ4A 4MD7A 1L1OC 2GTHA
chains in the Genus database with same CATH topology
2JS4A 2JR6A 2W04A 2BJOA 1USPA 3J80b 1RO4A 1YIT1 1Y1VS 1X3ZA 3PO2I 3GTQI 3HOVI 1YUAA 3QWUA 3M4OI 1VQK1 4BXXI 1QVFZ 5LL6f 2JUBA 2JA7I 4NBFA 4RVDA 1N8R2 4HH4A 4A3EI 1R9TI 3PO3I 2QREB 3MONA 1TWHI 3P5JB 2QLVB 3D9XA 2AKLA 3HOWI 1VQNZ 3BG1B 3LUSA 3J7A4 2QR1B 3S17I 1VQ8Z 2QRCB 4MRIA 3CCR1 2NVTI 2P28A 3EERA 2IZ3A 1KRLA 3VMHA 5FLXf 2YADA 3I551 3S2HI 4QTTA 5D1OA 5IT9f 1W2BY 3CCEZ 2OTJZ 3TE5B 1KC81 1TWGI 1ZB8A 1S72Z 1YJN1 4RVHA 4E2XA 4A3JI 2GU2A 3VMGA 5FLXb 1X3WA 3NH4A 2DE5A 3IFUA 1YJW1 1YJNZ 1VQL1 4E33A 2OOYB 3CCU1 1VLAA 4TNUA 2WAQA 1VQP1 4NBBA 3G71Z 1YJWZ 1VQLZ 2G2KA 3CCL1 1KQSY 1JJ2Y 4RV9A 1KC82 4DGLA 3HOZI 4NBDA 4Y7NI 3G6E1 1QVFY 3GTPI 4NBHA 1VQ61 1VQ9Z 4A3CI 3CPWY 4EWCA 4RVFA 4A3MI 3VB9A 4DQYB 3G6EZ 2EGTA 5C4XI 5T64A 1RQFA 3FKII 3I4MI 2Q51A 1M1K2 1ML8A 3CC7Z 1KD12 3S1RI 4RS4A 2E2JI 3VMIA 3GTGI 2R92I 1N8R1 3J80f 2HF1A 3S14I 4X6AI 4NBAA 3PO3S 3M3YI 4A3LI 1YHQZ 3CCV1 1Q7Y2 1VQ71 4E30A 3F3FC 1KQSZ 3CXCY 4A3BI 2LFUA 3CCVZ 1JJ2Z 2DE7A 5C4JI 2JA6I 2LIYA 3CC4Z 1VQ7Z 3MZLB 3CPWZ 2M48A 3FQMA 2OZKA 1YUKA 3H0GI 1VQN1 1QF8A 3CC21 1TFIA 3NDJA 2I3CA 4BY7I 1K731 1VQ81 5IP7I 2NVXI 1K8A2 3J81b 1VQM1 1YJ9Z 3CC2Z 1Z01A 4NBEA 2F4MA 3TDHB 3S2DI 3CCQZ 1USPB 1RO0A 1VQMZ 3CCE1 2OTJ1 1TWCI 3NH5A 2RPRA 3G4SZ 3KIHA 1S721 2QKDA 4HGYA 4BY1I 1I6HI 2DE6A 3HKZA 1LQLA 5C3EI 3S1NI 1K732 2O4HA 3S16I 3CXCZ 4NB9A 3HOXI 3MZKB 3CMA1 1Z02A 2E9HA 5AN9F 1QVGZ 1QYPA 3CCMZ 1I3QI 2GTIA 1NJI1 4AYBA 3G711 3CMAZ 3S1MI 1NP6A 2Q4ZA 3GTKI 1M1K1 1KD11 2Y0SA 1VQ91 1VQ51 4NBCA 1DL6A 2F4OA 2PMZA 3U50C 2O53A 3NDIA 2QEX1 1VQ5Z 1K83I 3JAMb 2YU9I 1Q7Y1 2P3YA 4A93I 5A2Qb 3CC71 3NH8A 4NFRA 3T4NB 1NJI2 4BBSI 2OTL1 2E2II 5T6BA 2QEXZ 4A3II 2QA4Z 1ZB9A 1YHQ1 4BBRI 1I50I 3CME1 2OTLZ 4A3FI 2PM9A 1TWAI 3RZOI 3CCJ1 3H3VJ 2HU9A 4NOZA 1Q861 2R7ZI 1WCMI 1YIJ1 3I4NI 2NVQI 4XX2A 1PFTA 1S7MA 2JNYA 3CMEZ 3CC41 3CCJZ 1K8A1 3GTMI 4MD9A 2RIQA 1YIJZ 2V8IA 1RNIA 1YI21 2J6AA 2V8KA 1QVGY 1VQOZ 2KPIA 3J81f 4A3GI 2RHBA 3GTJI 2VF1A 4Y52I 5C44I 1TWFI 1Q862 1YI2Z 1YJ91 1P9NA 3D6WA 1JWHC 5IP9I 3VTNA 3CCQ1 1K9M2 1Q811 2R6MA 1RLYA 2JA5I 5D1PA 3G4S1 4QTUA 3HOYI 3ESWA 1YITZ 3KIFA 1VQKZ 3S1QI 4S1TA 2K3RA 1SFOI 4MXUA 3CCM1 1RO2A 2WB1A 2R93I 3FQQA 2JMOA 4MONA 2B63I 1Q812 1Y1VI 3GCFA 3F3PC 4E2YA 3GTOI 4E2WA 1Y1WI 3Q87A 1WW9A 1ZH1A 4E32A 3CCRZ 1VQ41 3I561 1X0TA 4NB8A 3GTLI 3JAMf 5A2Qf 3I55Z 4A3KI 5FLMI 1VQ4Z 3CD61 3I56Z 4RVGA 3K7AI 3CQZI 4A3DI 5D1OB 5IT9b 1N2FA 3OW2Y 2ZAEB 3I07A 3GKQA 2QRDB 3CD6Z 2NVYI 3GTMS 2PK7A 2QA41 1Q821 3IF8A 2E2HI 4DK1A 1WIIA 2H85A 1M901 2JA8I 1Z03A 3CCUZ 2W03A 3CCS1 1VQPZ 2KI7B 4CL1A 4E2ZA 3CCLZ 3EEDA 5CM2M 3CCSZ 4NBGA 2VUGA 3S15I 2VUMI 1VQ6Z 3NFZA 2RT9A 3RZDI 4NH1C 1W2BZ 1K9M1 1VQO1 4HGZA 1Q822 2RBLA 3BG0B 2V8JA 1M902 4MH4A 1NUIA 5T67A 3OW2Z 2M6NA 3IX0A 2OOXB 4MD8A 3HOUI 4E31A 2K5RA 2IZ4A 4MD7A 1L1OC 2GTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS4 A;  1SFO I;  3FKI I;  2JR6 A;  3GTK I;  3I4M I;  2BJO A;  1USP A;  1RO4 A;  2R93 I;  1ML8 A;  1Y1V S;  1X3Z A;  3PO2 I;  3GTQ I;  3HOV I;  1YUA A;  3S1R I;  2E2J I;  3M4O I;  3VMI A;  4NBC A;  2B63 I;  3GTG I;  4BXX I;  1Y1V I;  1DL6 A;  2F4O A;  3U50 C;  2R92 I;  2JA7 I;  3GCF A;  4NBF A;  2HF1 A;  3GTO I;  3S14 I;  1K83 I;  4X6A I;  4NBA A;  2YU9 I;  3PO3 S;  3M3Y I;  1Y1W I;  4A3L I;  2P3Y A;  4A93 I;  3Q87 A;  4A3E I;  1WW9 A;  1R9T I;  3PO3 I;  4BBS I;  1TWH I;  4NB8 A;  3GTL I;  2E2I I;  2AKL A;  3HOW I;  4A3I I;  4A3K I;  5FLM I;  4A3B I;  3LUS A;  1ZB9 A;  2DE7 A;  5C4J I;  2JA6 I;  3S17 I;  4BBR I;  3K7A I;  3CQZ I;  2NVT I;  4A3D I;  1I50 I;  3EER A;  4A3F I;  1TWA I;  3RZO I;  3VMH A;  1N2F A;  3H3V J;  4NOZ A;  2R7Z I;  3H0G I;  1WCM I;  3I07 A;  3GKQ A;  2NVY I;  3GTM S;  1TFI A;  2PK7 A;  4XX2 A;  1PFT A;  2NVQ I;  3I4N I;  3S2H I;  4QTT A;  2JNY A;  4BY7 I;  2E2H I;  5IP7 I;  2NVX I;  3GTM I;  1TWG I;  1ZB8 A;  2JA8 I;  4A3J I;  3VMG A;  4NBE A;  2F4M A;  1X3W A;  2J6A A;  3S2D I;  2DE5 A;  2KPI A;  1USP B;  4A3G I;  1TWC I;  5CM2 M;  3GTJ I;  4Y52 I;  5C44 I;  1TWF I;  4NBG A;  3S15 I;  1VLA A;  2VUM I;  3D6W A;  3RZD I;  5IP9 I;  4BY1 I;  1I6H I;  2DE6 A;  4NBB A;  1LQL A;  5C3E I;  3S1N I;  2RBL A;  3S16 I;  4NB9 A;  3HOX I;  3HOZ I;  1RLY A;  2JA5 I;  4NBD A;  4Y7N I;  1QYP A;  4MH4 A;  3GTP I;  4NBH A;  4QTU A;  1I3Q I;  4A3C I;  3HOY I;  1NUI A;  3ESW A;  3HOU I;  4A3M I;  3VB9 A;  2K5R A;  3S1M I;  3S1Q I;  1L1O C;  5C4X I; 
#chains in the Genus database with same CATH topology
 2JS4 A;  2JR6 A;  2W04 A;  2BJO A;  1USP A;  3J80 b;  1RO4 A;  1YIT 1;  1Y1V S;  1X3Z A;  3PO2 I;  3GTQ I;  3HOV I;  1YUA A;  1WJ2 A;  3QWU A;  3M4O I;  1VQK 1;  4BXX I;  1QVF Z;  5LL6 f;  2JUB A;  2JA7 I;  4NBF A;  4RVD A;  1N8R 2;  4HH4 A;  2JIO A;  4A3E I;  1R9T I;  3PO3 I;  2QRE B;  3MON A;  1TWH I;  3P5J B;  2QLV B;  3D9X A;  2AKL A;  3HOW I;  1VQN Z;  3BG1 B;  3LUS A;  3J7A 4;  2QR1 B;  3S17 I;  1VQ8 Z;  2QRC B;  4MRI A;  3CCR 1;  2NVT I;  2P28 A;  3EER A;  2IZ3 A;  1KRL A;  3VMH A;  5FLX f;  2YAD A;  3I55 1;  2IV2 X;  3S2H I;  4QTT A;  5D1O A;  5IT9 f;  2VPW A;  1W2B Y;  3CCE Z;  2OTJ Z;  3TE5 B;  1KC8 1;  1TWG I;  1ZB8 A;  1S72 Z;  1YJN 1;  4RVH A;  4E2X A;  2GU2 A;  3VMG A;  5FLX b;  4A3J I;  1X3W A;  3NH4 A;  2DE5 A;  3IFU A;  1YJW 1;  1FDI A;  1YJN Z;  1VQL 1;  4E33 A;  2OOY B;  3CCU 1;  1VLA A;  4TNU A;  2WAQ A;  1VQP 1;  4NBB A;  3G71 Z;  1YJW Z;  1VQL Z;  2G2K A;  3CCL 1;  1KQS Y;  1JJ2 Y;  4RV9 A;  1KC8 2;  4DGL A;  3HOZ I;  4NBD A;  4Y7N I;  1Q16 A;  3G6E 1;  2E7Z A;  1QVF Y;  3GTP I;  4NBH A;  1VQ6 1;  1VQ9 Z;  4A3C I;  3CPW Y;  4EWC A;  4RVF A;  4A3M I;  3VB9 A;  4DQY B;  2V45 A;  3G6E Z;  2EGT A;  2AYD A;  5C4X I;  5T64 A;  1RQF A;  3FKI I;  3I4M I;  2Q51 A;  1M1K 2;  1ML8 A;  3CC7 Z;  1KD1 2;  3S1R I;  4RS4 A;  2E2J I;  3VMI A;  3GTG I;  2VPZ A;  2R92 I;  1N8R 1;  3J80 f;  2HF1 A;  3S14 I;  4X6A I;  4NBA A;  3PO3 S;  3M3Y I;  2VPX A;  4A3L I;  1YHQ Z;  3CCV 1;  1Q7Y 2;  1VQ7 1;  4E30 A;  3F3F C;  1KQS Z;  3CXC Y;  4A3B I;  2LFU A;  2JIR A;  3CCV Z;  1JJ2 Z;  2DE7 A;  5C4J I;  2JA6 I;  2LIY A;  3CC4 Z;  1VQ7 Z;  3MZL B;  3CPW Z;  2M48 A;  3FQM A;  2OZK A;  1YUK A;  3H0G I;  1VQN 1;  1QF8 A;  3CC2 1;  1TFI A;  2JIM A;  3NDJ A;  2I3C A;  4BY7 I;  1K73 1;  1VQ8 1;  5IP7 I;  2NVX I;  1K8A 2;  3J81 b;  1VQM 1;  1YJ9 Z;  3CC2 Z;  1Z01 A;  4NBE A;  2F4M A;  3TDH B;  3S2D I;  3CCQ Z;  1USP B;  1RO0 A;  1VQM Z;  3CCE 1;  2OTJ 1;  1TWC I;  3NH5 A;  2RPR A;  3G4S Z;  3KIH A;  1S72 1;  2QKD A;  4HGY A;  4BY1 I;  1I6H I;  2DE6 A;  3HKZ A;  1LQL A;  5C3E I;  3S1N I;  1K73 2;  2JIP A;  2O4H A;  3S16 I;  3CXC Z;  4NB9 A;  3HOX I;  3MZK B;  3CMA 1;  1Z02 A;  2E9H A;  5AN9 F;  1QVG Z;  1QYP A;  3CCM Z;  1I3Q I;  2GTI A;  1NJI 1;  4AYB A;  3G71 1;  3CMA Z;  3S1M I;  1NP6 A;  2Q4Z A;  3GTK I;  1M1K 1;  1KD1 1;  2Y0S A;  1VQ9 1;  1VQ5 1;  4NBC A;  1DL6 A;  2F4O A;  2PMZ A;  3U50 C;  2O53 A;  3NDI A;  2QEX 1;  1VQ5 Z;  1K83 I;  3JAM b;  2YU9 I;  1Q7Y 1;  2P3Y A;  4A93 I;  5A2Q b;  3CC7 1;  3NH8 A;  4NFR A;  3T4N B;  1NJI 2;  4BBS I;  2OTL 1;  2E2I I;  5T6B A;  2QEX Z;  1SIW A;  1QXF A;  4A3I I;  2QA4 Z;  1ZB9 A;  1YHQ 1;  4BBR I;  1I50 I;  3CME 1;  2OTL Z;  4A3F I;  2PM9 A;  1TWA I;  3RZO I;  3CCJ 1;  3H3V J;  2HU9 A;  4NOZ A;  1Q86 1;  2R7Z I;  1WCM I;  1YIJ 1;  3I4N I;  2NVQ I;  4XX2 A;  1PFT A;  1S7M A;  2JNY A;  3CME Z;  3CC4 1;  3CCJ Z;  1K8A 1;  3GTM I;  4MD9 A;  2RIQ A;  1YIJ Z;  2V3V A;  2V8I A;  1RNI A;  3IR7 A;  1YI2 1;  2J6A A;  2V8K A;  1QVG Y;  1VQO Z;  2KPI A;  3J81 f;  4A3G I;  2RHB A;  3GTJ I;  2VF1 A;  4Y52 I;  5C44 I;  1TWF I;  1Q86 2;  1YI2 Z;  1YJ9 1;  1P9N A;  3D6W A;  1JWH C;  5IP9 I;  3VTN A;  3CCQ 1;  2JIQ A;  1K9M 2;  1Q81 1;  2R6M A;  1RLY A;  2JA5 I;  5D1P A;  3G4S 1;  4QTU A;  3HOY I;  3ESW A;  1FDO A;  1YIT Z;  3KIF A;  1VQK Z;  3S1Q I;  1Y8C A;  4S1T A;  2K3R A;  1SFO I;  4MXU A;  3CCM 1;  1RO2 A;  2WB1 A;  2R93 I;  3FQQ A;  2JMO A;  4MON A;  2B63 I;  1Q81 2;  1Y1V I;  3GCF A;  3F3P C;  4E2Y A;  3GTO I;  4E2W A;  1Y1W I;  3Q87 A;  1WW9 A;  1ZH1 A;  4E32 A;  3CCR Z;  1VQ4 1;  3I56 1;  1X0T A;  4NB8 A;  3GTL I;  3JAM f;  5A2Q f;  3I55 Z;  4A3K I;  5FLM I;  1VQ4 Z;  3CD6 1;  3I56 Z;  4RVG A;  3K7A I;  3CQZ I;  4A3D I;  5D1O B;  5IT9 b;  1N2F A;  3OW2 Y;  2ZAE B;  3I07 A;  3GKQ A;  2QRD B;  3CD6 Z;  2NVY I;  3GTM S;  2PK7 A;  2VPY A;  2QA4 1;  1Q82 1;  3IF8 A;  2E2H I;  4DK1 A;  1WII A;  2H85 A;  1M90 1;  3D2L A;  2JA8 I;  1Z03 A;  3CCU Z;  2W03 A;  3CCS 1;  1VQP Z;  2KI7 B;  4CL1 A;  4E2Z A;  3CCL Z;  3EED A;  5CM2 M;  3CCS Z;  4NBG A;  2VUG A;  3S15 I;  2VUM I;  1VQ6 Z;  3NFZ A;  1AA6 A;  2RT9 A;  3RZD I;  4NH1 C;  1W2B Z;  1K9M 1;  1VQO 1;  4HGZ A;  2LEX A;  1Q82 2;  2RBL A;  2NAP A;  3BG0 B;  2V8J A;  1WZN A;  1M90 2;  4MH4 A;  1NUI A;  5T67 A;  3OW2 Z;  2M6N A;  3IX0 A;  2OOX B;  4MD8 A;  3HOU I;  4E31 A;  2K5R A;  2IZ4 A;  4MD7 A;  1L1O C;  2GTH A; 
#chains in the Genus database with same CATH homology
 2JS4 A;  2JR6 A;  2W04 A;  2BJO A;  1USP A;  3J80 b;  1RO4 A;  1YIT 1;  1Y1V S;  1X3Z A;  3PO2 I;  3GTQ I;  3HOV I;  1YUA A;  3QWU A;  3M4O I;  1VQK 1;  4BXX I;  1QVF Z;  5LL6 f;  2JUB A;  2JA7 I;  4NBF A;  4RVD A;  1N8R 2;  4HH4 A;  4A3E I;  1R9T I;  3PO3 I;  2QRE B;  3MON A;  1TWH I;  3P5J B;  2QLV B;  3D9X A;  2AKL A;  3HOW I;  1VQN Z;  3BG1 B;  3LUS A;  3J7A 4;  2QR1 B;  3S17 I;  1VQ8 Z;  2QRC B;  4MRI A;  3CCR 1;  2NVT I;  2P28 A;  3EER A;  2IZ3 A;  1KRL A;  3VMH A;  5FLX f;  2YAD A;  3I55 1;  3S2H I;  4QTT A;  5D1O A;  5IT9 f;  1W2B Y;  3CCE Z;  2OTJ Z;  3TE5 B;  1KC8 1;  1TWG I;  1ZB8 A;  1S72 Z;  1YJN 1;  4RVH A;  4E2X A;  4A3J I;  2GU2 A;  3VMG A;  5FLX b;  1X3W A;  3NH4 A;  2DE5 A;  3IFU A;  1YJW 1;  1YJN Z;  1VQL 1;  4E33 A;  2OOY B;  3CCU 1;  1VLA A;  4TNU A;  2WAQ A;  1VQP 1;  4NBB A;  3G71 Z;  1YJW Z;  1VQL Z;  2G2K A;  3CCL 1;  1KQS Y;  1JJ2 Y;  4RV9 A;  1KC8 2;  4DGL A;  3HOZ I;  4NBD A;  4Y7N I;  3G6E 1;  1QVF Y;  3GTP I;  4NBH A;  1VQ6 1;  1VQ9 Z;  4A3C I;  3CPW Y;  4EWC A;  4RVF A;  4A3M I;  3VB9 A;  4DQY B;  3G6E Z;  2EGT A;  5C4X I;  5T64 A;  1RQF A;  3FKI I;  3I4M I;  2Q51 A;  1M1K 2;  1ML8 A;  3CC7 Z;  1KD1 2;  3S1R I;  4RS4 A;  2E2J I;  3VMI A;  3GTG I;  2R92 I;  1N8R 1;  3J80 f;  2HF1 A;  3S14 I;  4X6A I;  4NBA A;  3PO3 S;  3M3Y I;  4A3L I;  1YHQ Z;  3CCV 1;  1Q7Y 2;  1VQ7 1;  4E30 A;  3F3F C;  1KQS Z;  3CXC Y;  4A3B I;  2LFU A;  3CCV Z;  1JJ2 Z;  2DE7 A;  5C4J I;  2JA6 I;  2LIY A;  3CC4 Z;  1VQ7 Z;  3MZL B;  3CPW Z;  2M48 A;  3FQM A;  2OZK A;  1YUK A;  3H0G I;  1VQN 1;  1QF8 A;  3CC2 1;  1TFI A;  3NDJ A;  2I3C A;  4BY7 I;  1K73 1;  1VQ8 1;  5IP7 I;  2NVX I;  1K8A 2;  3J81 b;  1VQM 1;  1YJ9 Z;  3CC2 Z;  1Z01 A;  4NBE A;  2F4M A;  3TDH B;  3S2D I;  3CCQ Z;  1USP B;  1RO0 A;  1VQM Z;  3CCE 1;  2OTJ 1;  1TWC I;  3NH5 A;  2RPR A;  3G4S Z;  3KIH A;  1S72 1;  2QKD A;  4HGY A;  4BY1 I;  1I6H I;  2DE6 A;  3HKZ A;  1LQL A;  5C3E I;  3S1N I;  1K73 2;  2O4H A;  3S16 I;  3CXC Z;  4NB9 A;  3HOX I;  3MZK B;  3CMA 1;  1Z02 A;  2E9H A;  5AN9 F;  1QVG Z;  1QYP A;  3CCM Z;  1I3Q I;  2GTI A;  1NJI 1;  4AYB A;  3G71 1;  3CMA Z;  3S1M I;  1NP6 A;  2Q4Z A;  3GTK I;  1M1K 1;  1KD1 1;  2Y0S A;  1VQ9 1;  1VQ5 1;  4NBC A;  1DL6 A;  2F4O A;  2PMZ A;  3U50 C;  2O53 A;  3NDI A;  2QEX 1;  1VQ5 Z;  1K83 I;  3JAM b;  2YU9 I;  1Q7Y 1;  2P3Y A;  4A93 I;  5A2Q b;  3CC7 1;  3NH8 A;  4NFR A;  3T4N B;  1NJI 2;  4BBS I;  2OTL 1;  2E2I I;  5T6B A;  2QEX Z;  4A3I I;  2QA4 Z;  1ZB9 A;  1YHQ 1;  4BBR I;  1I50 I;  3CME 1;  2OTL Z;  4A3F I;  2PM9 A;  1TWA I;  3RZO I;  3CCJ 1;  3H3V J;  2HU9 A;  4NOZ A;  1Q86 1;  2R7Z I;  1WCM I;  1YIJ 1;  3I4N I;  2NVQ I;  4XX2 A;  1PFT A;  1S7M A;  2JNY A;  3CME Z;  3CC4 1;  3CCJ Z;  1K8A 1;  3GTM I;  4MD9 A;  2RIQ A;  1YIJ Z;  2V8I A;  1RNI A;  1YI2 1;  2J6A A;  2V8K A;  1QVG Y;  1VQO Z;  2KPI A;  3J81 f;  4A3G I;  2RHB A;  3GTJ I;  2VF1 A;  4Y52 I;  5C44 I;  1TWF I;  1Q86 2;  1YI2 Z;  1YJ9 1;  1P9N A;  3D6W A;  1JWH C;  5IP9 I;  3VTN A;  3CCQ 1;  1K9M 2;  1Q81 1;  2R6M A;  1RLY A;  2JA5 I;  5D1P A;  3G4S 1;  4QTU A;  3HOY I;  3ESW A;  1YIT Z;  3KIF A;  1VQK Z;  3S1Q I;  4S1T A;  2K3R A;  1SFO I;  4MXU A;  3CCM 1;  1RO2 A;  2WB1 A;  2R93 I;  3FQQ A;  2JMO A;  4MON A;  2B63 I;  1Q81 2;  1Y1V I;  3GCF A;  3F3P C;  4E2Y A;  3GTO I;  4E2W A;  1Y1W I;  3Q87 A;  1WW9 A;  1ZH1 A;  4E32 A;  3CCR Z;  1VQ4 1;  3I56 1;  1X0T A;  4NB8 A;  3GTL I;  3JAM f;  5A2Q f;  3I55 Z;  4A3K I;  5FLM I;  1VQ4 Z;  3CD6 1;  3I56 Z;  4RVG A;  3K7A I;  3CQZ I;  4A3D I;  5D1O B;  5IT9 b;  1N2F A;  3OW2 Y;  2ZAE B;  3I07 A;  3GKQ A;  2QRD B;  3CD6 Z;  2NVY I;  3GTM S;  2PK7 A;  2QA4 1;  1Q82 1;  3IF8 A;  2E2H I;  4DK1 A;  1WII A;  2H85 A;  1M90 1;  2JA8 I;  1Z03 A;  3CCU Z;  2W03 A;  3CCS 1;  1VQP Z;  2KI7 B;  4CL1 A;  4E2Z A;  3CCL Z;  3EED A;  5CM2 M;  3CCS Z;  4NBG A;  2VUG A;  3S15 I;  2VUM I;  1VQ6 Z;  3NFZ A;  2RT9 A;  3RZD I;  4NH1 C;  1W2B Z;  1K9M 1;  1VQO 1;  4HGZ A;  1Q82 2;  2RBL A;  3BG0 B;  2V8J A;  1M90 2;  4MH4 A;  1NUI A;  5T67 A;  3OW2 Z;  2M6N A;  3IX0 A;  2OOX B;  4MD8 A;  3HOU I;  4E31 A;  2K5R A;  2IZ4 A;  4MD7 A;  1L1O C;  2GTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...