2R93I

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r93I02
1WCMI 2RBLA 4A3LI 3EERA 1Y1WI 4NOZA 1K83I 3U50C 5IP9I 4NB9A 4Y7NI 2J6AA 4A3MI 3GTOI 3D6WA 2P3YA 4A3II 2DE7A 1X3ZA 5IP7I 2JS4A 1RO4A 3CQZI 3I4MI 5FLMI 3S1QI 3S14I 2F4MA 3PO3S 1PFTA 1VLAA 1TWGI 4NB8A 3RZDI 2JA6I 4BY7I 4BBSI 3I4NI 4X6AI 4A3EI 1TWAI 1L1OC 2PK7A 2JA8I 1DL6A 2R7ZI 4A3GI 4A3KI 1RLYA 3FKII 4NBAA 5C4JI 5CM2M 1Y1VI 2NVQI 2JR6A 3VB9A 2DE6A 3H0GI 1ZB8A 2E2JI 1Y1VS 3S1NI 2E2HI 3HOZI 4A3FI 4MH4A 2R92I 3Q87A 3GTQI 1NUIA 4A93I 3RZOI 3S17I 3HOYI 3S15I 4NBEA 4Y52I 4NBCA 1I3QI 5C3EI 3GTMI 3S1MI 1R9TI 2JA5I 2R93I 2AKLA 2B63I 1I50I 4NBBA 3I07A 3S16I 4QTUA 1LQLA 1TFIA 4BXXI 2BJOA 4XX2A 5C4XI 4NBFA 3M4OI 3S2HI 2JA7I 2JNYA 1TWHI 4BBRI 2NVXI 5C44I 2KPIA 2F4OA 3VMHA 2YU9I 1N2FA 1WW9A 3GCFA 2NVTI 3ESWA 1USPB 1ZB9A 2NVYI 1I6HI 3HOWI 3GTPI 3VMIA 4A3JI 4QTTA 1ML8A 4NBHA 3GTJI 3PO3I 3GTMS 3LUSA 3HOUI 2K5RA 3VMGA 3S2DI 4A3DI 3GTLI 1X3WA 2HF1A 3GTKI 3HOXI 2E2II 3HOVI 3PO2I 4A3BI 1YUAA 1TWFI 1USPA 1TWCI 4NBDA 1SFOI 3GKQA 2VUMI 4A3CI 3M3YI 1QYPA 3S1RI 3GTGI 3K7AI 3H3VJ 2DE5A 4NBGA 4BY1I
chains in the Genus database with same CATH superfamily
1QVGY 2RBLA 4A3LI 4NOZA 3U50C 5D1OB 4Y7NI 2GTIA 3GTOI 3HKZA 2P3YA 4A3II 2WB1A 1X3ZA 1YI2Z 2V3VA 2JS4A 2OTL1 1RO4A 4HGYA 2F4MA 3J81f 3PO3S 2QRCB 4RVGA 2W03A 1P9NA 3TDHB 1S72Z 2JA6I 3G4S1 5T64A 3CMEZ 5IT9f 2GU2A 1KQSZ 3CCR1 4DK1A 1Q861 2JA8I 3CCEZ 4A3KI 2O4HA 1VQOZ 5T67A 3VB9A 2Q51A 3FQMA 3VTNA 3J80b 1ZB8A 3G6EZ 4E30A 4E2XA 1M902 4A93I 3RZOI 1VQ9Z 1RNIA 2QA4Z 1S7MA 2V8IA 1KD12 4DQYB 2VPZA 5C3EI 1R9TI 2JA5I 1I50I 3S16I 1TFIA 2BJOA 4XX2A 1K8A2 1VQNZ 4RV9A 4E32A 3S2HI 2JA7I 3NH5A 3TE5B 3MZLB 1Q7Y2 3GCFA 2OOYB 1FDIA 2VPXA 2VPYA 2QREB 1ZB9A 2NVYI 3HOWI 3NFZA 3VMIA 4NH1C 3KIHA 1VQPZ 2E7ZA 3GTMS 3LUSA 3HOUI 1KQSY 2JIQA 3IR7A 2HF1A 3J81b 1Q821 4E31A 2JIMA 1TWFI 2OTJZ 3CC4Z 2PM9A 4NBDA 1N8R1 2VPWA 3M3YI 2M6NA 1Q811 3CCVZ 3H3VJ 2VUMI 4BY1I 1VQ6Z 4NB9A 3CC2Z 2J6AA 3CCM1 1M1K1 5IP7I 3S1QI 5FLMI 3S14I 3D9XA 1VQ81 1YJWZ 1YJ91 4E33A 3CCL1 5D1OA 3CD6Z 1NP6A 4BY7I 1YHQZ 3I4NI 3G711 2QR1B 5A2Qf 1L1OC 3P5JB 2V8KA 1RLYA 1YIJ1 5C4JI 2OTLZ 1JJ2Z 1Z01A 3CCQ1 1Y1VI 2NVQI 3H0GI 1Y1VS 2VUGA 4MD9A 2R92I 2Q4ZA 2P28A 1NJI1 4AYBA 3G4SZ 3HOYI 2RIQA 4NBCA 1I3QI 3CCRZ 1M901 5D1PA 1YI21 2AKLA 4NBBA 1VQ4Z 5C4XI 1Z02A 3IFUA 2IZ4A 5C44I 1S721 2KPIA 2QKDA 1K8A1 2JMOA 1N2FA 1WW9A 2NVTI 4MD7A 3ESWA 2WAQA 1AA6A 1RO0A 3MONA 4A3JI 4QTTA 3GTJI 3VMGA 1X3WA 1VQ51 3GTKI 3T4NB 3HOXI 3PO2I 2JIPA 3OW2Z 1SFOI 1YJN1 2V8JA 2QA41 1VQ71 1JJ2Y 4E2YA 1SIWA 2DE5A 3KIFA 2G2KA 1WCMI 3I551 2EGTA 1KRLA 5IP9I 4NFRA 5A2Qb 4A3MI 1YIT1 1QVFZ 2KI7B 1VQL1 2DE7A 1KC81 1K9M1 3CQZI 3I4MI 5AN9F 4MD8A 1Z03A 1VLAA 3IX0A 4NB8A 3D2LA 4EWCA 3CCJZ 3CMA1 3I561 4BBSI 4X6AI 4A3EI 1K731 1VQP1 3CC7Z 2PK7A 3CCS1 3CCMZ 2R7ZI 4A3GI 3FKII 5CM2M 3BG1B 4RVHA 2DE6A 2QEX1 2JUBA 2E2JI 2LIYA 1Y8CA 3HOZI 1QXFA 3CCV1 1NUIA 3CCLZ 1VQM1 1VQK1 3CC21 3S15I 3OW2Y 3CCU1 4Y52I 3S1MI 2R93I 4MRIA 3I07A 4QTUA 1YJW1 1YIJZ 1Q812 1QVFY 3CCQZ 2JNYA 2OOXB 2NVXI 3F3PC 1WJ2A 4RVFA 2K3RA 3VMHA 1YHQ1 2YU9I 2O53A 1WZNA 1M1K2 3JAMf 1USPB 1Q16A 2JIOA 3J7A4 2QLVB 1ML8A 2NAPA 4NBHA 3PO3I 3S2DI 2GTHA 2K5RA 2ZAEB 1KD11 4RS4A 2E2II 4A3BI 1YUAA 3EEDA 1TWCI 3GKQA 4A3CI 3S1RI 3GTGI 3K7AI 3CME1 3CPWY 5FLXb 4BBRI 1TWHI 2V45A 3EERA 1Y1WI 1K83I 1YUKA 2LFUA 4RVDA 5T6BA 1QF8A 1Q7Y1 3CCE1 3D6WA 2IV2X 1VQ41 2M48A 4S1TA 2OZKA 1X0TA 1VQO1 1PFTA 3G6E1 1TWGI 2VF1A 1NJI2 1VQ5Z 3RZDI 4MONA 1YJNZ 1Q862 1VQ91 3NH8A 1VQ7Z 3F3FC 3I55Z 2RT9A 1TWAI 1W2BZ 1YITZ 2JIRA 1VQLZ 1JWHC 1DL6A 1ZH1A 2Y0SA 3CXCZ 4NBAA 1VQN1 2JR6A 1QVGZ 2LEXA 3S1NI 2E2HI 2R6MA 4E2ZA 4A3FI 4MH4A 3CMAZ 2PMZA 3NDIA 3Q87A 3I56Z 3GTQI 3S17I 3JAMb 5FLXf 4NBEA 2RPRA 2E9HA 3NDJA 1RQFA 4TNUA 3GTMI 2YADA 3CCSZ 2B63I 1FDOA 2AYDA 1LQLA 2I3CA 3IF8A 3MZKB 4BXXI 4NBFA 4E2WA 3M4OI 3CPWZ 3CCJ1 4DGLA 2HU9A 3J80f 2W04A 2OTJ1 4HH4A 3CC41 1VQ8Z 2F4OA 2QEXZ 1YJ9Z 5IT9b 2H85A 1WIIA 1KC82 1VQMZ 1VQKZ 1VQ61 3CC71 1K9M2 1I6HI 3G71Z 3CCUZ 3GTPI 5LL6f 1Q822 4CL1A 3BG0B 2IZ3A 4A3DI 3GTLI 1N8R2 4HGZA 4MXUA 2RHBA 1W2BY 3HOVI 3QWUA 3FQQA 2QRDB 1RO2A 1USPA 1K732 3CD61 3CXCY 1QYPA 4NBGA 3NH4A
chains in the Genus database with same CATH topology
1QVGY 2RBLA 4A3LI 4NOZA 3U50C 5D1OB 4Y7NI 2GTIA 3GTOI 3HKZA 2P3YA 4A3II 2WB1A 1X3ZA 1YI2Z 2JS4A 2OTL1 1RO4A 4HGYA 2F4MA 3J81f 3PO3S 2QRCB 4RVGA 2W03A 1P9NA 3TDHB 1S72Z 2JA6I 3G4S1 5T64A 3CMEZ 5IT9f 2GU2A 1KQSZ 3CCR1 4DK1A 1Q861 2JA8I 3CCEZ 4A3KI 2O4HA 1VQOZ 5T67A 3VB9A 2Q51A 3FQMA 3VTNA 3J80b 1ZB8A 3G6EZ 4E30A 4E2XA 1M902 4A93I 3RZOI 1VQ9Z 1RNIA 2QA4Z 1S7MA 2V8IA 1KD12 4DQYB 5C3EI 1R9TI 2JA5I 1I50I 3S16I 1TFIA 2BJOA 4XX2A 1K8A2 1VQNZ 4RV9A 4E32A 3S2HI 2JA7I 3NH5A 3TE5B 3MZLB 1Q7Y2 3GCFA 2OOYB 2QREB 1ZB9A 2NVYI 3HOWI 3NFZA 3VMIA 4NH1C 3KIHA 1VQPZ 3GTMS 3LUSA 3HOUI 1KQSY 2HF1A 3J81b 1Q821 4E31A 1TWFI 2OTJZ 3CC4Z 2PM9A 4NBDA 1N8R1 3M3YI 2M6NA 1Q811 3CCVZ 3H3VJ 2VUMI 4BY1I 1VQ6Z 4NB9A 3CC2Z 2J6AA 3CCM1 1M1K1 5IP7I 3S1QI 5FLMI 3S14I 3D9XA 1VQ81 1YJWZ 1YJ91 4E33A 3CCL1 5D1OA 3CD6Z 1NP6A 4BY7I 1YHQZ 3I4NI 3G711 2QR1B 5A2Qf 1L1OC 3P5JB 2V8KA 1RLYA 1YIJ1 5C4JI 2OTLZ 1JJ2Z 1Z01A 3CCQ1 1Y1VI 2NVQI 3H0GI 1Y1VS 2VUGA 4MD9A 2R92I 2Q4ZA 2P28A 1NJI1 4AYBA 3G4SZ 3HOYI 2RIQA 4NBCA 1I3QI 3CCRZ 1M901 5D1PA 1YI21 2AKLA 4NBBA 1VQ4Z 5C4XI 1Z02A 3IFUA 2IZ4A 5C44I 1S721 2KPIA 2QKDA 1K8A1 2JMOA 1N2FA 1WW9A 2NVTI 4MD7A 3ESWA 2WAQA 1RO0A 3MONA 4A3JI 4QTTA 3GTJI 3VMGA 1X3WA 1VQ51 3GTKI 3T4NB 3HOXI 3PO2I 3OW2Z 1SFOI 1YJN1 2V8JA 2QA41 1VQ71 1JJ2Y 4E2YA 2DE5A 3KIFA 2G2KA 1WCMI 3I551 2EGTA 1KRLA 5IP9I 4NFRA 5A2Qb 4A3MI 1YIT1 1QVFZ 2KI7B 1VQL1 2DE7A 1KC81 1K9M1 3CQZI 3I4MI 5AN9F 4MD8A 1Z03A 1VLAA 3IX0A 4NB8A 4EWCA 3CCJZ 3CMA1 3I561 4BBSI 4X6AI 4A3EI 1K731 1VQP1 3CC7Z 2PK7A 3CCS1 3CCMZ 2R7ZI 4A3GI 3FKII 5CM2M 3BG1B 4RVHA 2DE6A 2QEX1 2JUBA 2E2JI 2LIYA 3HOZI 3CCV1 1NUIA 3CCLZ 1VQM1 1VQK1 3CC21 3S15I 3OW2Y 3CCU1 4Y52I 3S1MI 2R93I 4MRIA 3I07A 4QTUA 1YJW1 1YIJZ 1Q812 1QVFY 3CCQZ 2JNYA 2OOXB 2NVXI 3F3PC 4RVFA 2K3RA 3VMHA 1YHQ1 2YU9I 2O53A 1M1K2 3JAMf 1USPB 3J7A4 2QLVB 1ML8A 4NBHA 3PO3I 3S2DI 2GTHA 2K5RA 2ZAEB 1KD11 4RS4A 2E2II 4A3BI 1YUAA 3EEDA 1TWCI 3GKQA 4A3CI 3S1RI 3GTGI 3K7AI 3CME1 3CPWY 5FLXb 4BBRI 1TWHI 3EERA 1Y1WI 1K83I 1YUKA 2LFUA 4RVDA 5T6BA 1QF8A 1Q7Y1 3CCE1 3D6WA 1VQ41 2M48A 4S1TA 2OZKA 1X0TA 1VQO1 1PFTA 3G6E1 1TWGI 2VF1A 1NJI2 1VQ5Z 3RZDI 4MONA 1YJNZ 1Q862 1VQ91 3NH8A 1VQ7Z 3F3FC 3I55Z 2RT9A 1TWAI 1W2BZ 1YITZ 1VQLZ 1DL6A 1JWHC 1ZH1A 2Y0SA 3CXCZ 4NBAA 1VQN1 2JR6A 1QVGZ 3S1NI 2E2HI 2R6MA 4E2ZA 4A3FI 4MH4A 3CMAZ 2PMZA 3NDIA 3Q87A 3I56Z 3GTQI 3S17I 3JAMb 5FLXf 4NBEA 2RPRA 2E9HA 3NDJA 1RQFA 4TNUA 3GTMI 2YADA 3CCSZ 2B63I 1LQLA 2I3CA 3IF8A 3MZKB 4BXXI 4NBFA 4E2WA 3M4OI 3CPWZ 3CCJ1 4DGLA 2HU9A 3J80f 2W04A 2OTJ1 4HH4A 3CC41 1VQ8Z 2F4OA 2QEXZ 1YJ9Z 5IT9b 2H85A 1WIIA 1KC82 1VQMZ 1VQKZ 1VQ61 3CC71 1K9M2 1I6HI 3G71Z 3CCUZ 3GTPI 5LL6f 1Q822 4CL1A 3BG0B 2IZ3A 4A3DI 3GTLI 1N8R2 4HGZA 4MXUA 2RHBA 1W2BY 3HOVI 3QWUA 3FQQA 2QRDB 1RO2A 1USPA 1K732 3CD61 3CXCY 1QYPA 4NBGA 3NH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM I;  2RBL A;  4A3L I;  3EER A;  1Y1W I;  4NOZ A;  1K83 I;  3U50 C;  5IP9 I;  4NB9 A;  4Y7N I;  2J6A A;  4A3M I;  3GTO I;  3D6W A;  2P3Y A;  4A3I I;  2DE7 A;  1X3Z A;  5IP7 I;  2JS4 A;  1RO4 A;  3CQZ I;  3I4M I;  5FLM I;  3S1Q I;  3S14 I;  2F4M A;  3PO3 S;  1PFT A;  1VLA A;  1TWG I;  4NB8 A;  3RZD I;  2JA6 I;  4BY7 I;  4BBS I;  3I4N I;  4X6A I;  4A3E I;  1TWA I;  1L1O C;  2PK7 A;  2JA8 I;  1DL6 A;  2R7Z I;  4A3G I;  4A3K I;  1RLY A;  3FKI I;  4NBA A;  5C4J I;  5CM2 M;  1Y1V I;  2NVQ I;  2JR6 A;  3VB9 A;  2DE6 A;  3H0G I;  1ZB8 A;  2E2J I;  1Y1V S;  3S1N I;  2E2H I;  3HOZ I;  4A3F I;  4MH4 A;  2R92 I;  3Q87 A;  3GTQ I;  1NUI A;  4A93 I;  3RZO I;  3S17 I;  3HOY I;  3S15 I;  4NBE A;  4Y52 I;  4NBC A;  1I3Q I;  5C3E I;  3GTM I;  3S1M I;  1R9T I;  2JA5 I;  2R93 I;  2AKL A;  2B63 I;  1I50 I;  4NBB A;  3I07 A;  3S16 I;  4QTU A;  1LQL A;  1TFI A;  4BXX I;  2BJO A;  4XX2 A;  5C4X I;  4NBF A;  3M4O I;  3S2H I;  2JA7 I;  2JNY A;  1TWH I;  4BBR I;  2NVX I;  5C44 I;  2KPI A;  2F4O A;  3VMH A;  2YU9 I;  1N2F A;  1WW9 A;  3GCF A;  2NVT I;  3ESW A;  1USP B;  1ZB9 A;  2NVY I;  1I6H I;  3HOW I;  3GTP I;  3VMI A;  4A3J I;  4QTT A;  1ML8 A;  4NBH A;  3GTJ I;  3PO3 I;  3GTM S;  3LUS A;  3HOU I;  2K5R A;  3VMG A;  3S2D I;  4A3D I;  3GTL I;  1X3W A;  2HF1 A;  3GTK I;  3HOX I;  2E2I I;  3HOV I;  3PO2 I;  4A3B I;  1YUA A;  1TWF I;  1USP A;  1TWC I;  4NBD A;  1SFO I;  3GKQ A;  2VUM I;  4A3C I;  3M3Y I;  1QYP A;  3S1R I;  3GTG I;  3K7A I;  3H3V J;  2DE5 A;  4NBG A;  4BY1 I; 
#chains in the Genus database with same CATH topology
 1QVG Y;  2RBL A;  4A3L I;  4NOZ A;  3U50 C;  5D1O B;  4Y7N I;  2GTI A;  3GTO I;  3HKZ A;  2P3Y A;  4A3I I;  2WB1 A;  1X3Z A;  1YI2 Z;  2V3V A;  2JS4 A;  2OTL 1;  1RO4 A;  4HGY A;  2F4M A;  3J81 f;  3PO3 S;  2QRC B;  4RVG A;  2W03 A;  1P9N A;  3TDH B;  1S72 Z;  2JA6 I;  3G4S 1;  5T64 A;  3CME Z;  5IT9 f;  2GU2 A;  1KQS Z;  3CCR 1;  4DK1 A;  1Q86 1;  2JA8 I;  3CCE Z;  4A3K I;  2O4H A;  1VQO Z;  5T67 A;  3VB9 A;  2Q51 A;  3FQM A;  3VTN A;  3J80 b;  1ZB8 A;  3G6E Z;  4E30 A;  4E2X A;  1M90 2;  4A93 I;  3RZO I;  1VQ9 Z;  1RNI A;  2QA4 Z;  1S7M A;  2V8I A;  1KD1 2;  4DQY B;  2VPZ A;  5C3E I;  1R9T I;  2JA5 I;  1I50 I;  3S16 I;  1TFI A;  2BJO A;  4XX2 A;  1K8A 2;  1VQN Z;  4RV9 A;  4E32 A;  3S2H I;  2JA7 I;  3NH5 A;  3TE5 B;  3MZL B;  1Q7Y 2;  3GCF A;  2OOY B;  1FDI A;  2VPX A;  2VPY A;  2QRE B;  1ZB9 A;  2NVY I;  3HOW I;  3NFZ A;  3VMI A;  4NH1 C;  3KIH A;  1VQP Z;  2E7Z A;  3GTM S;  3LUS A;  3HOU I;  1KQS Y;  2JIQ A;  3IR7 A;  2HF1 A;  3J81 b;  1Q82 1;  4E31 A;  2JIM A;  1TWF I;  2OTJ Z;  3CC4 Z;  2PM9 A;  4NBD A;  1N8R 1;  2VPW A;  3M3Y I;  2M6N A;  1Q81 1;  3CCV Z;  3H3V J;  2VUM I;  4BY1 I;  1VQ6 Z;  4NB9 A;  3CC2 Z;  2J6A A;  3CCM 1;  1M1K 1;  5IP7 I;  3S1Q I;  5FLM I;  3S14 I;  3D9X A;  1VQ8 1;  1YJW Z;  1YJ9 1;  4E33 A;  3CCL 1;  5D1O A;  3CD6 Z;  1NP6 A;  4BY7 I;  1YHQ Z;  3I4N I;  3G71 1;  2QR1 B;  5A2Q f;  1L1O C;  3P5J B;  2V8K A;  1RLY A;  1YIJ 1;  5C4J I;  2OTL Z;  1JJ2 Z;  1Z01 A;  3CCQ 1;  1Y1V I;  2NVQ I;  3H0G I;  1Y1V S;  2VUG A;  4MD9 A;  2R92 I;  2Q4Z A;  2P28 A;  1NJI 1;  4AYB A;  3G4S Z;  3HOY I;  2RIQ A;  4NBC A;  1I3Q I;  3CCR Z;  1M90 1;  5D1P A;  1YI2 1;  2AKL A;  4NBB A;  1VQ4 Z;  5C4X I;  1Z02 A;  3IFU A;  2IZ4 A;  5C44 I;  1S72 1;  2KPI A;  2QKD A;  1K8A 1;  2JMO A;  1N2F A;  1WW9 A;  2NVT I;  4MD7 A;  3ESW A;  2WAQ A;  1AA6 A;  1RO0 A;  3MON A;  4A3J I;  4QTT A;  3GTJ I;  3VMG A;  1X3W A;  1VQ5 1;  3GTK I;  3T4N B;  3HOX I;  3PO2 I;  2JIP A;  3OW2 Z;  1SFO I;  1YJN 1;  2V8J A;  2QA4 1;  1VQ7 1;  1JJ2 Y;  4E2Y A;  1SIW A;  2DE5 A;  3KIF A;  2G2K A;  1WCM I;  3I55 1;  2EGT A;  1KRL A;  5IP9 I;  4NFR A;  5A2Q b;  4A3M I;  1YIT 1;  1QVF Z;  2KI7 B;  1VQL 1;  2DE7 A;  1KC8 1;  1K9M 1;  3CQZ I;  3I4M I;  5AN9 F;  4MD8 A;  1Z03 A;  1VLA A;  3IX0 A;  4NB8 A;  3D2L A;  4EWC A;  3CCJ Z;  3CMA 1;  3I56 1;  4BBS I;  4X6A I;  4A3E I;  1K73 1;  1VQP 1;  3CC7 Z;  2PK7 A;  3CCS 1;  3CCM Z;  2R7Z I;  4A3G I;  3FKI I;  5CM2 M;  3BG1 B;  4RVH A;  2DE6 A;  2QEX 1;  2JUB A;  2E2J I;  2LIY A;  1Y8C A;  3HOZ I;  1QXF A;  3CCV 1;  1NUI A;  3CCL Z;  1VQM 1;  1VQK 1;  3CC2 1;  3S15 I;  3OW2 Y;  3CCU 1;  4Y52 I;  3S1M I;  2R93 I;  4MRI A;  3I07 A;  4QTU A;  1YJW 1;  1YIJ Z;  1Q81 2;  1QVF Y;  3CCQ Z;  2JNY A;  2OOX B;  2NVX I;  3F3P C;  1WJ2 A;  4RVF A;  2K3R A;  3VMH A;  1YHQ 1;  2YU9 I;  2O53 A;  1WZN A;  1M1K 2;  3JAM f;  1USP B;  1Q16 A;  2JIO A;  3J7A 4;  2QLV B;  1ML8 A;  2NAP A;  4NBH A;  3PO3 I;  3S2D I;  2GTH A;  2K5R A;  2ZAE B;  1KD1 1;  4RS4 A;  2E2I I;  4A3B I;  1YUA A;  3EED A;  1TWC I;  3GKQ A;  4A3C I;  3S1R I;  3GTG I;  3K7A I;  3CME 1;  3CPW Y;  5FLX b;  4BBR I;  1TWH I;  2V45 A;  3EER A;  1Y1W I;  1K83 I;  1YUK A;  2LFU A;  4RVD A;  5T6B A;  1QF8 A;  1Q7Y 1;  3CCE 1;  3D6W A;  2IV2 X;  1VQ4 1;  2M48 A;  4S1T A;  2OZK A;  1X0T A;  1VQO 1;  1PFT A;  3G6E 1;  1TWG I;  2VF1 A;  1NJI 2;  1VQ5 Z;  3RZD I;  4MON A;  1YJN Z;  1Q86 2;  1VQ9 1;  3NH8 A;  1VQ7 Z;  3F3F C;  3I55 Z;  2RT9 A;  1TWA I;  1W2B Z;  1YIT Z;  2JIR A;  1VQL Z;  1JWH C;  1DL6 A;  1ZH1 A;  2Y0S A;  3CXC Z;  4NBA A;  1VQN 1;  2JR6 A;  1QVG Z;  2LEX A;  3S1N I;  2E2H I;  2R6M A;  4E2Z A;  4A3F I;  4MH4 A;  3CMA Z;  2PMZ A;  3NDI A;  3Q87 A;  3I56 Z;  3GTQ I;  3S17 I;  3JAM b;  5FLX f;  4NBE A;  2RPR A;  2E9H A;  3NDJ A;  1RQF A;  4TNU A;  3GTM I;  2YAD A;  3CCS Z;  2B63 I;  1FDO A;  2AYD A;  1LQL A;  2I3C A;  3IF8 A;  3MZK B;  4BXX I;  4NBF A;  4E2W A;  3M4O I;  3CPW Z;  3CCJ 1;  4DGL A;  2HU9 A;  3J80 f;  2W04 A;  2OTJ 1;  4HH4 A;  3CC4 1;  1VQ8 Z;  2F4O A;  2QEX Z;  1YJ9 Z;  5IT9 b;  2H85 A;  1WII A;  1KC8 2;  1VQM Z;  1VQK Z;  1VQ6 1;  3CC7 1;  1K9M 2;  1I6H I;  3G71 Z;  3CCU Z;  3GTP I;  5LL6 f;  1Q82 2;  4CL1 A;  3BG0 B;  2IZ3 A;  4A3D I;  3GTL I;  1N8R 2;  4HGZ A;  4MXU A;  2RHB A;  1W2B Y;  3HOV I;  3QWU A;  3FQQ A;  2QRD B;  1RO2 A;  1USP A;  1K73 2;  3CD6 1;  3CXC Y;  1QYP A;  4NBG A;  3NH4 A; 
#chains in the Genus database with same CATH homology
 1QVG Y;  2RBL A;  4A3L I;  4NOZ A;  3U50 C;  5D1O B;  4Y7N I;  2GTI A;  3GTO I;  3HKZ A;  2P3Y A;  4A3I I;  2WB1 A;  1X3Z A;  1YI2 Z;  2JS4 A;  2OTL 1;  1RO4 A;  4HGY A;  2F4M A;  3J81 f;  3PO3 S;  2QRC B;  4RVG A;  2W03 A;  1P9N A;  3TDH B;  1S72 Z;  2JA6 I;  3G4S 1;  5T64 A;  3CME Z;  5IT9 f;  2GU2 A;  1KQS Z;  3CCR 1;  4DK1 A;  1Q86 1;  2JA8 I;  3CCE Z;  4A3K I;  2O4H A;  1VQO Z;  5T67 A;  3VB9 A;  2Q51 A;  3FQM A;  3VTN A;  3J80 b;  1ZB8 A;  3G6E Z;  4E30 A;  4E2X A;  1M90 2;  4A93 I;  3RZO I;  1VQ9 Z;  1RNI A;  2QA4 Z;  1S7M A;  2V8I A;  1KD1 2;  4DQY B;  5C3E I;  1R9T I;  2JA5 I;  1I50 I;  3S16 I;  1TFI A;  2BJO A;  4XX2 A;  1K8A 2;  1VQN Z;  4RV9 A;  4E32 A;  3S2H I;  2JA7 I;  3NH5 A;  3TE5 B;  3MZL B;  1Q7Y 2;  3GCF A;  2OOY B;  2QRE B;  1ZB9 A;  2NVY I;  3HOW I;  3NFZ A;  3VMI A;  4NH1 C;  3KIH A;  1VQP Z;  3GTM S;  3LUS A;  3HOU I;  1KQS Y;  2HF1 A;  3J81 b;  1Q82 1;  4E31 A;  1TWF I;  2OTJ Z;  3CC4 Z;  2PM9 A;  4NBD A;  1N8R 1;  3M3Y I;  2M6N A;  1Q81 1;  3CCV Z;  3H3V J;  2VUM I;  4BY1 I;  1VQ6 Z;  4NB9 A;  3CC2 Z;  2J6A A;  3CCM 1;  1M1K 1;  5IP7 I;  3S1Q I;  5FLM I;  3S14 I;  3D9X A;  1VQ8 1;  1YJW Z;  1YJ9 1;  4E33 A;  3CCL 1;  5D1O A;  3CD6 Z;  1NP6 A;  4BY7 I;  1YHQ Z;  3I4N I;  3G71 1;  2QR1 B;  5A2Q f;  1L1O C;  3P5J B;  2V8K A;  1RLY A;  1YIJ 1;  5C4J I;  2OTL Z;  1JJ2 Z;  1Z01 A;  3CCQ 1;  1Y1V I;  2NVQ I;  3H0G I;  1Y1V S;  2VUG A;  4MD9 A;  2R92 I;  2Q4Z A;  2P28 A;  1NJI 1;  4AYB A;  3G4S Z;  3HOY I;  2RIQ A;  4NBC A;  1I3Q I;  3CCR Z;  1M90 1;  5D1P A;  1YI2 1;  2AKL A;  4NBB A;  1VQ4 Z;  5C4X I;  1Z02 A;  3IFU A;  2IZ4 A;  5C44 I;  1S72 1;  2KPI A;  2QKD A;  1K8A 1;  2JMO A;  1N2F A;  1WW9 A;  2NVT I;  4MD7 A;  3ESW A;  2WAQ A;  1RO0 A;  3MON A;  4A3J I;  4QTT A;  3GTJ I;  3VMG A;  1X3W A;  1VQ5 1;  3GTK I;  3T4N B;  3HOX I;  3PO2 I;  3OW2 Z;  1SFO I;  1YJN 1;  2V8J A;  2QA4 1;  1VQ7 1;  1JJ2 Y;  4E2Y A;  2DE5 A;  3KIF A;  2G2K A;  1WCM I;  3I55 1;  2EGT A;  1KRL A;  5IP9 I;  4NFR A;  5A2Q b;  4A3M I;  1YIT 1;  1QVF Z;  2KI7 B;  1VQL 1;  2DE7 A;  1KC8 1;  1K9M 1;  3CQZ I;  3I4M I;  5AN9 F;  4MD8 A;  1Z03 A;  1VLA A;  3IX0 A;  4NB8 A;  4EWC A;  3CCJ Z;  3CMA 1;  3I56 1;  4BBS I;  4X6A I;  4A3E I;  1K73 1;  1VQP 1;  3CC7 Z;  2PK7 A;  3CCS 1;  3CCM Z;  2R7Z I;  4A3G I;  3FKI I;  5CM2 M;  3BG1 B;  4RVH A;  2DE6 A;  2QEX 1;  2JUB A;  2E2J I;  2LIY A;  3HOZ I;  3CCV 1;  1NUI A;  3CCL Z;  1VQM 1;  1VQK 1;  3CC2 1;  3S15 I;  3OW2 Y;  3CCU 1;  4Y52 I;  3S1M I;  2R93 I;  4MRI A;  3I07 A;  4QTU A;  1YJW 1;  1YIJ Z;  1Q81 2;  1QVF Y;  3CCQ Z;  2JNY A;  2OOX B;  2NVX I;  3F3P C;  4RVF A;  2K3R A;  3VMH A;  1YHQ 1;  2YU9 I;  2O53 A;  1M1K 2;  3JAM f;  1USP B;  3J7A 4;  2QLV B;  1ML8 A;  4NBH A;  3PO3 I;  3S2D I;  2GTH A;  2K5R A;  2ZAE B;  1KD1 1;  4RS4 A;  2E2I I;  4A3B I;  1YUA A;  3EED A;  1TWC I;  3GKQ A;  4A3C I;  3S1R I;  3GTG I;  3K7A I;  3CME 1;  3CPW Y;  5FLX b;  4BBR I;  1TWH I;  3EER A;  1Y1W I;  1K83 I;  1YUK A;  2LFU A;  4RVD A;  5T6B A;  1QF8 A;  1Q7Y 1;  3CCE 1;  3D6W A;  1VQ4 1;  2M48 A;  4S1T A;  2OZK A;  1X0T A;  1VQO 1;  1PFT A;  3G6E 1;  1TWG I;  2VF1 A;  1NJI 2;  1VQ5 Z;  3RZD I;  4MON A;  1YJN Z;  1Q86 2;  1VQ9 1;  3NH8 A;  1VQ7 Z;  3F3F C;  3I55 Z;  2RT9 A;  1TWA I;  1W2B Z;  1YIT Z;  1VQL Z;  1DL6 A;  1JWH C;  1ZH1 A;  2Y0S A;  3CXC Z;  4NBA A;  1VQN 1;  2JR6 A;  1QVG Z;  3S1N I;  2E2H I;  2R6M A;  4E2Z A;  4A3F I;  4MH4 A;  3CMA Z;  2PMZ A;  3NDI A;  3Q87 A;  3I56 Z;  3GTQ I;  3S17 I;  3JAM b;  5FLX f;  4NBE A;  2RPR A;  2E9H A;  3NDJ A;  1RQF A;  4TNU A;  3GTM I;  2YAD A;  3CCS Z;  2B63 I;  1LQL A;  2I3C A;  3IF8 A;  3MZK B;  4BXX I;  4NBF A;  4E2W A;  3M4O I;  3CPW Z;  3CCJ 1;  4DGL A;  2HU9 A;  3J80 f;  2W04 A;  2OTJ 1;  4HH4 A;  3CC4 1;  1VQ8 Z;  2F4O A;  2QEX Z;  1YJ9 Z;  5IT9 b;  2H85 A;  1WII A;  1KC8 2;  1VQM Z;  1VQK Z;  1VQ6 1;  3CC7 1;  1K9M 2;  1I6H I;  3G71 Z;  3CCU Z;  3GTP I;  5LL6 f;  1Q82 2;  4CL1 A;  3BG0 B;  2IZ3 A;  4A3D I;  3GTL I;  1N8R 2;  4HGZ A;  4MXU A;  2RHB A;  1W2B Y;  3HOV I;  3QWU A;  3FQQ A;  2QRD B;  1RO2 A;  1USP A;  1K73 2;  3CD6 1;  3CXC Y;  1QYP A;  4NBG A;  3NH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...