3OW2Z

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Z00
1YHQZ 3CCL1 3CCJZ 3CD6Z 1VQ51 3G6E1 1YIT1 2QA41 3CCVZ 3CCQ1 1VQ81 1VQMZ 1QVFZ 1VQNZ 1VQ71 1VQ61 1K8A2 1M1K1 1S72Z 1Q7Y2 1VQ91 3I551 1Q7Y1 1Q821 1VQOZ 1YJW1 3CCMZ 3G71Z 1VQLZ 1K9M1 3CC7Z 2OTJ1 3I561 1YJN1 3G4SZ 1VQ4Z 3CMA1 1VQK1 1YJ9Z 1M1K2 1VQPZ 1YHQ1 3CC4Z 3CCUZ 1YI2Z 3CCEZ 3CCJ1 1M901 3CD61 3OW2Y 1N8R1 3CCV1 1Q822 1VQM1 1YIJZ 1VQN1 3CMEZ 1Q862 2QEXZ 1W2BY 1S721 1K9M2 1JJ2Y 3CCSZ 3CC2Z 1Q861 1K732 1KD12 1KQSY 1K731 1KD11 3CCM1 3CXCY 3G711 2OTLZ 3CCRZ 1VQL1 1M902 3CC71 1N8R2 1VQ41 1YJ91 1NJI1 3CCLZ 1KQSZ 3CC41 3CCU1 1YI21 1VQ5Z 3G6EZ 3CCE1 1YITZ 2QA4Z 1KC82 1VQ8Z 3CCQZ 1VQ7Z 1VQ6Z 1YIJ1 1KC81 3CME1 3CPWY 3OW2Z 2QEX1 1VQ9Z 1VQO1 1QVGY 3CC21 3CCS1 3I55Z 1W2BZ 1NJI2 1YJWZ 3G4S1 1K8A1 1JJ2Z 1Q812 2OTL1 3CPWZ 3I56Z 3CCR1 1YJNZ 2OTJZ 1VQP1 1QVFY 1QVGZ 1Q811 3CMAZ 1VQKZ 3CXCZ
chains in the Genus database with same CATH superfamily
1YHQZ 4MONA 3CCL1 3GTJI 1RNIA 3M4OI 3G6E1 4BY7I 4DQYB 1VQNZ 2OOXB 3PO3S 2VPXA 3LUSA 3FQQA 2EGTA 4TNUA 1Q7Y2 5IT9b 2P28A 2JA5I 1VQOZ 3GTLI 1YJW1 3S14I 4RVGA 2HF1A 1VQLZ 1SFOI 3J80b 4BXXI 1YJN1 1VQ4Z 2HU9A 2DE7A 1VQK1 2V8KA 5AN9F 1VQPZ 4CL1A 4NBEA 5FLXb 3CC4Z 1K83I 2OZKA 3CD61 2Y0SA 3IR7A 1N2FA 2JS4A 2GTIA 1Y1VI 2WAQA 4DK1A 2B63I 5CM2M 1I6HI 3CCSZ 4HGYA 1USPB 3S2HI 1KRLA 2Q51A 2W04A 1K731 1TWHI 1KD11 2KI7B 1Y1VS 3CCRZ 3QWUA 4Y7NI 3NDJA 1PFTA 2LEXA 3U50C 2R7ZI 4A3FI 1YJ91 2E2II 3CCLZ 1JWHC 3P5JB 1WIIA 3F3PC 3CCU1 4NFRA 5IP9I 1YI21 2WB1A 3G6EZ 3S16I 1Z02A 3MZKB 3HKZA 2E2JI 1WW9A 3CPWY 1VQO1 3D2LA 1QVGY 1RO4A 2BJOA 2M6NA 2LFUA 1W2BZ 2JR6A 4NBAA 2NVXI 1YJWZ 4E2YA 3GKQA 2RBLA 4MH4A 4A3DI 1Y8CA 3M3YI 2E2HI 3CPWZ 1YJNZ 1FDOA 1VQP1 1QVGZ 3KIHA 2R6MA 1WCMI 1S7MA 1VQKZ 3CXCZ 3J81f 2JIPA 5A2Qf 3CD6Z 1VQ51 1YIT1 1VQ81 2VPYA 1RO2A 2QLVB 3GCFA 4BBSI 2LIYA 2W03A 4X6AI 4A3II 2ZAEB 2V8JA 5T64A 2RHBA 1Q7Y1 3GTGI 3S1RI 1RQFA 2R93I 2JNYA 3K7AI 3NFZA 3JAMf 1Q16A 3NH5A 2V45A 1RLYA 1I50I 5D1PA 4QTTA 1YJ9Z 3VB9A 4DGLA 4NBFA 2O53A 3CCUZ 1YI2Z 3CCJ1 1QF8A 1M901 4A3KI 4A3BI 3OW2Y 2YU9I 1I3QI 4QTUA 1USPA 4MRIA 1Q862 2KPIA 2F4OA 2NAPA 1X3ZA 1S721 3HOUI 3F3FC 2QRDB 4NH1C 2JIRA 3HOXI 1M902 1TFIA 3S2DI 2QR1B 4E2XA 2E9HA 2IV2X 4A93I 5C4JI 2J6AA 1NJI1 3TDHB 5IT9f 3VTNA 1VQ5Z 1YITZ 1FDIA 1KC82 1VQ8Z 4RVDA 5T67A 3NH8A 2K5RA 4NB8A 1YIJ1 3NDIA 3J80f 3J7A4 3IFUA 5C44I 2JA7I 2AKLA 3ESWA 3CC21 4HGZA 2JUBA 2RPRA 3S17I 5FLXf 1NJI2 1K8A1 5LL6f 3H3VJ 2OTL1 1QVFY 2JMOA 2F4MA 1SIWA 4A3LI 4AYBA 2PK7A 1YUAA 4RVHA 3RZOI 3CCJZ 2QA41 3I4NI 1Z03A 1QVFZ 1K8A2 2JIMA 1M1K1 3IX0A 1S72Z 2VUMI 3MZLB 5C3EI 3PO2I 3I551 2YADA 4NBDA 1Q821 4NBCA 4MD7A 4RVFA 5A2Qb 5FLMI 3I561 3FKII 3G4SZ 1M1K2 2O4HA 2NVYI 4E32A 3NH4A 2P3YA 2GTHA 4A3MI 1X0TA 1N8R1 3CCV1 1Q822 1WZNA 1VQM1 1YIJZ 4BY1I 2OOYB 1RO0A 2QRCB 1JJ2Y 3JAMb 3CC2Z 3D9XA 1Q861 4HH4A 3GTQI 5C4XI 2JA8I 1KQSY 2NVTI 3CCM1 3H0GI 2NVQI 1NP6A 3GTKI 3G711 2OTLZ 4RS4A 3CC71 1N8R2 2Q4ZA 3BG1B 1ZB9A 1Y1WI 1KQSZ 1X3WA 1TWCI 3CCE1 4A3CI 2QA4Z 4NBBA 2DE5A 1KC81 3CME1 2JA6I 4MD8A 3OW2Z 5D1OB 2QEX1 4E30A 3I55Z 1TWAI 1QYPA 4EWCA 3G4S1 1Q812 4RV9A 3I56Z 2R92I 3BG0B 2VPZA 1ZH1A 2JIOA 1L1OC 3D6WA 1P9NA 3I07A 2H85A 1QXFA 4XX2A 4Y52I 3S15I 3S1QI 3HOZI 3CCVZ 2VF1A 3CCQ1 1VQMZ 1VQ71 1VQ61 3HOVI 1AA6A 1LQLA 4BBRI 1VQ91 2G2KA 2RT9A 1VLAA 4A3EI 3CCMZ 3G71Z 2IZ3A 1WJ2A 2VUGA 3T4NB 1K9M1 3CC7Z 2OTJ1 4MXUA 3HOWI 3EERA 3CQZI 3CMA1 4S1TA 4NB9A 2PM9A 4NBHA 3EEDA 1R9TI 1YHQ1 4MD9A 4E2WA 3GTMI 3CCEZ 3VMIA 3HOYI 1YUKA 1VQN1 3GTOI 3CMEZ 1Z01A 2PMZA 3MONA 3J81b 2QEXZ 1W2BY 1K9M2 4NOZA 2JIQA 3VMHA 3GTMS 3S1MI 1K732 2E7ZA 1KD12 5IP7I 1ZB8A 3I4MI 3GTPI 2QREB 1TWGI 4E2ZA 3CXCY 1VQL1 2K3RA 2IZ4A 1VQ41 1DL6A 4E31A 1NUIA 4A3JI 3S1NI 3Q87A 1ML8A 3CC41 5D1OA 2QKDA 3IF8A 3RZDI 3CCQZ 2M48A 1VQ7Z 1VQ6Z 2I3CA 2V3VA 4E33A 2GU2A 3KIFA 1VQ9Z 3CCS1 4NBGA 1JJ2Z 2AYDA 2DE6A 2V8IA 2OTJZ 3CCR1 2VPWA 3PO3I 2RIQA 3TE5B 5T6BA 3VMGA 3CMAZ 1Q811 3FQMA 4A3GI 1TWFI
chains in the Genus database with same CATH topology
1YHQZ 4MONA 3CCL1 3GTJI 1RNIA 3M4OI 3G6E1 4BY7I 4DQYB 1VQNZ 2OOXB 3PO3S 3LUSA 3FQQA 2EGTA 4TNUA 1Q7Y2 5IT9b 2P28A 2JA5I 1VQOZ 3GTLI 1YJW1 3S14I 4RVGA 2HF1A 1VQLZ 1SFOI 3J80b 4BXXI 1YJN1 1VQ4Z 2HU9A 2DE7A 1VQK1 2V8KA 5AN9F 1VQPZ 4CL1A 4NBEA 5FLXb 3CC4Z 1K83I 2OZKA 3CD61 2Y0SA 1N2FA 2JS4A 2GTIA 1Y1VI 2WAQA 4DK1A 2B63I 5CM2M 1I6HI 3CCSZ 4HGYA 1USPB 3S2HI 1KRLA 2Q51A 2W04A 1K731 1TWHI 1KD11 2KI7B 1Y1VS 3CCRZ 3QWUA 4Y7NI 3NDJA 1PFTA 3U50C 2R7ZI 4A3FI 1YJ91 2E2II 3CCLZ 1JWHC 3P5JB 1WIIA 3F3PC 3CCU1 4NFRA 5IP9I 1YI21 2WB1A 3G6EZ 3S16I 1Z02A 3MZKB 3HKZA 2E2JI 1WW9A 3CPWY 1VQO1 1QVGY 1RO4A 2BJOA 2M6NA 2LFUA 1W2BZ 2JR6A 4NBAA 2NVXI 1YJWZ 4E2YA 3GKQA 2RBLA 4MH4A 4A3DI 3M3YI 2E2HI 3CPWZ 1YJNZ 1VQP1 1QVGZ 3KIHA 2R6MA 1WCMI 1S7MA 1VQKZ 3CXCZ 3J81f 5A2Qf 3CD6Z 1VQ51 1YIT1 1VQ81 1RO2A 2QLVB 3GCFA 4BBSI 2LIYA 2W03A 4X6AI 4A3II 2ZAEB 2V8JA 5T64A 2RHBA 1Q7Y1 3GTGI 3S1RI 1RQFA 2R93I 2JNYA 3K7AI 3NFZA 3JAMf 3NH5A 5D1PA 1RLYA 1I50I 1YJ9Z 4QTTA 3VB9A 4DGLA 4NBFA 2O53A 3CCUZ 1YI2Z 3CCJ1 1QF8A 1M901 4A3KI 4A3BI 3OW2Y 2YU9I 1I3QI 4QTUA 1USPA 4MRIA 1Q862 2KPIA 2F4OA 1X3ZA 1S721 3HOUI 3F3FC 2QRDB 4NH1C 3HOXI 1M902 1TFIA 3S2DI 2QR1B 4E2XA 2E9HA 4A93I 5C4JI 2J6AA 1NJI1 5IT9f 3TDHB 3VTNA 1VQ5Z 1YITZ 1KC82 1VQ8Z 4RVDA 5T67A 3NH8A 2K5RA 4NB8A 1YIJ1 3NDIA 3J80f 3J7A4 3IFUA 5C44I 2JA7I 2AKLA 3ESWA 3CC21 4HGZA 2JUBA 2RPRA 3S17I 5FLXf 1NJI2 1K8A1 5LL6f 3H3VJ 2OTL1 1QVFY 2JMOA 2F4MA 4A3LI 4AYBA 2PK7A 1YUAA 4RVHA 3RZOI 3CCJZ 2QA41 3I4NI 1Z03A 1QVFZ 1K8A2 1M1K1 3IX0A 1S72Z 2VUMI 3MZLB 5C3EI 3PO2I 3I551 2YADA 4NBDA 1Q821 4NBCA 4MD7A 4RVFA 5A2Qb 5FLMI 3I561 3FKII 3G4SZ 1M1K2 2O4HA 2NVYI 4E32A 3NH4A 2P3YA 2GTHA 4A3MI 1X0TA 1N8R1 3CCV1 1Q822 1VQM1 1YIJZ 4BY1I 2OOYB 1RO0A 2QRCB 1JJ2Y 3JAMb 3CC2Z 3D9XA 1Q861 4HH4A 3GTQI 5C4XI 2JA8I 1KQSY 2NVTI 3CCM1 3H0GI 2NVQI 1NP6A 3GTKI 3G711 2OTLZ 4RS4A 3CC71 1N8R2 2Q4ZA 3BG1B 1ZB9A 1Y1WI 1KQSZ 1X3WA 1TWCI 3CCE1 4A3CI 2QA4Z 4NBBA 2DE5A 1KC81 3CME1 2JA6I 4MD8A 3OW2Z 5D1OB 2QEX1 4E30A 3I55Z 1TWAI 1QYPA 4EWCA 3G4S1 1Q812 4RV9A 3I56Z 2R92I 3BG0B 1ZH1A 1L1OC 3D6WA 1P9NA 3I07A 2H85A 4Y52I 4XX2A 3S15I 3S1QI 3HOZI 3CCVZ 2VF1A 3CCQ1 1VQMZ 1VQ71 1VQ61 3HOVI 1LQLA 4BBRI 1VQ91 2G2KA 2RT9A 1VLAA 4A3EI 3CCMZ 3G71Z 2IZ3A 2VUGA 3T4NB 1K9M1 3CC7Z 2OTJ1 4MXUA 3HOWI 3EERA 3CQZI 3CMA1 4S1TA 4NB9A 2PM9A 4NBHA 3EEDA 1R9TI 1YHQ1 4MD9A 4E2WA 3GTMI 3CCEZ 3VMIA 3HOYI 1YUKA 1VQN1 3GTOI 3CMEZ 1Z01A 2PMZA 3MONA 3J81b 2QEXZ 1W2BY 1K9M2 4NOZA 3VMHA 3GTMS 3S1MI 1K732 1KD12 5IP7I 1ZB8A 3I4MI 3GTPI 2QREB 1TWGI 4E2ZA 3CXCY 1VQL1 2K3RA 2IZ4A 1VQ41 1DL6A 4E31A 1NUIA 4A3JI 3S1NI 3Q87A 1ML8A 3CC41 5D1OA 2QKDA 3IF8A 3RZDI 3CCQZ 2M48A 1VQ7Z 1VQ6Z 2I3CA 4E33A 2GU2A 3KIFA 1VQ9Z 3CCS1 4NBGA 1JJ2Z 2DE6A 2V8IA 2OTJZ 3CCR1 3PO3I 2RIQA 3TE5B 5T6BA 3VMGA 3CMAZ 1Q811 3FQMA 4A3GI 1TWFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ Z;  3CCL 1;  3CCJ Z;  3CD6 Z;  1VQ5 1;  3G6E 1;  1YIT 1;  2QA4 1;  3CCV Z;  3CCQ 1;  1VQ8 1;  1VQM Z;  1QVF Z;  1VQN Z;  1VQ7 1;  1VQ6 1;  1K8A 2;  1M1K 1;  1S72 Z;  1Q7Y 2;  1VQ9 1;  3I55 1;  1Q7Y 1;  1Q82 1;  1VQO Z;  1YJW 1;  3CCM Z;  3G71 Z;  1VQL Z;  1K9M 1;  3CC7 Z;  2OTJ 1;  3I56 1;  1YJN 1;  3G4S Z;  1VQ4 Z;  3CMA 1;  1VQK 1;  1YJ9 Z;  1M1K 2;  1VQP Z;  1YHQ 1;  3CC4 Z;  3CCU Z;  1YI2 Z;  3CCE Z;  3CCJ 1;  1M90 1;  3CD6 1;  3OW2 Y;  1N8R 1;  3CCV 1;  1Q82 2;  1VQM 1;  1YIJ Z;  1VQN 1;  3CME Z;  1Q86 2;  2QEX Z;  1W2B Y;  1S72 1;  1K9M 2;  1JJ2 Y;  3CCS Z;  3CC2 Z;  1Q86 1;  1K73 2;  1KD1 2;  1KQS Y;  1K73 1;  1KD1 1;  3CCM 1;  3CXC Y;  3G71 1;  2OTL Z;  3CCR Z;  1VQL 1;  1M90 2;  3CC7 1;  1N8R 2;  1VQ4 1;  1YJ9 1;  1NJI 1;  3CCL Z;  1KQS Z;  3CC4 1;  3CCU 1;  1YI2 1;  1VQ5 Z;  3G6E Z;  3CCE 1;  1YIT Z;  2QA4 Z;  1KC8 2;  1VQ8 Z;  3CCQ Z;  1VQ7 Z;  1VQ6 Z;  1YIJ 1;  1KC8 1;  3CME 1;  3CPW Y;  3OW2 Z;  2QEX 1;  1VQ9 Z;  1VQO 1;  1QVG Y;  3CC2 1;  3CCS 1;  3I55 Z;  1W2B Z;  1NJI 2;  1YJW Z;  3G4S 1;  1K8A 1;  1JJ2 Z;  1Q81 2;  2OTL 1;  3CPW Z;  3I56 Z;  3CCR 1;  1YJN Z;  2OTJ Z;  1VQP 1;  1QVF Y;  1QVG Z;  1Q81 1;  3CMA Z;  1VQK Z;  3CXC Z; 
#chains in the Genus database with same CATH topology
 1YHQ Z;  4MON A;  3CCL 1;  3GTJ I;  1RNI A;  3M4O I;  3G6E 1;  4BY7 I;  4DQY B;  1VQN Z;  2OOX B;  3PO3 S;  2VPX A;  3LUS A;  3FQQ A;  2EGT A;  4TNU A;  1Q7Y 2;  5IT9 b;  2P28 A;  2JA5 I;  1VQO Z;  3GTL I;  1YJW 1;  3S14 I;  4RVG A;  2HF1 A;  1VQL Z;  1SFO I;  3J80 b;  4BXX I;  1YJN 1;  1VQ4 Z;  2HU9 A;  2DE7 A;  1VQK 1;  2V8K A;  5AN9 F;  1VQP Z;  4CL1 A;  4NBE A;  5FLX b;  3CC4 Z;  1K83 I;  2OZK A;  3CD6 1;  2Y0S A;  3IR7 A;  1N2F A;  2JS4 A;  2GTI A;  1Y1V I;  2WAQ A;  4DK1 A;  2B63 I;  5CM2 M;  1I6H I;  3CCS Z;  4HGY A;  1USP B;  3S2H I;  1KRL A;  2Q51 A;  2W04 A;  1K73 1;  1TWH I;  1KD1 1;  2KI7 B;  1Y1V S;  3CCR Z;  3QWU A;  4Y7N I;  3NDJ A;  1PFT A;  2LEX A;  3U50 C;  2R7Z I;  4A3F I;  1YJ9 1;  2E2I I;  3CCL Z;  1JWH C;  3P5J B;  1WII A;  3F3P C;  3CCU 1;  4NFR A;  5IP9 I;  1YI2 1;  2WB1 A;  3G6E Z;  3S16 I;  1Z02 A;  3MZK B;  3HKZ A;  2E2J I;  1WW9 A;  3CPW Y;  1VQO 1;  3D2L A;  1QVG Y;  1RO4 A;  2BJO A;  2M6N A;  2LFU A;  1W2B Z;  2JR6 A;  4NBA A;  2NVX I;  1YJW Z;  4E2Y A;  3GKQ A;  2RBL A;  4MH4 A;  4A3D I;  1Y8C A;  3M3Y I;  2E2H I;  3CPW Z;  1YJN Z;  1FDO A;  1VQP 1;  1QVG Z;  3KIH A;  2R6M A;  1WCM I;  1S7M A;  1VQK Z;  3CXC Z;  3J81 f;  2JIP A;  5A2Q f;  3CD6 Z;  1VQ5 1;  1YIT 1;  1VQ8 1;  2VPY A;  1RO2 A;  2QLV B;  3GCF A;  4BBS I;  2LIY A;  2W03 A;  4X6A I;  4A3I I;  2ZAE B;  2V8J A;  5T64 A;  2RHB A;  1Q7Y 1;  3GTG I;  3S1R I;  1RQF A;  2R93 I;  2JNY A;  3K7A I;  3NFZ A;  3JAM f;  1Q16 A;  3NH5 A;  2V45 A;  1RLY A;  1I50 I;  5D1P A;  4QTT A;  1YJ9 Z;  3VB9 A;  4DGL A;  4NBF A;  2O53 A;  3CCU Z;  1YI2 Z;  3CCJ 1;  1QF8 A;  1M90 1;  4A3K I;  4A3B I;  3OW2 Y;  2YU9 I;  1I3Q I;  4QTU A;  1USP A;  4MRI A;  1Q86 2;  2KPI A;  2F4O A;  2NAP A;  1X3Z A;  1S72 1;  3HOU I;  3F3F C;  2QRD B;  4NH1 C;  2JIR A;  3HOX I;  1M90 2;  1TFI A;  3S2D I;  2QR1 B;  4E2X A;  2E9H A;  2IV2 X;  4A93 I;  5C4J I;  2J6A A;  1NJI 1;  3TDH B;  5IT9 f;  3VTN A;  1VQ5 Z;  1YIT Z;  1FDI A;  1KC8 2;  1VQ8 Z;  4RVD A;  5T67 A;  3NH8 A;  2K5R A;  4NB8 A;  1YIJ 1;  3NDI A;  3J80 f;  3J7A 4;  3IFU A;  5C44 I;  2JA7 I;  2AKL A;  3ESW A;  3CC2 1;  4HGZ A;  2JUB A;  2RPR A;  3S17 I;  5FLX f;  1NJI 2;  1K8A 1;  5LL6 f;  3H3V J;  2OTL 1;  1QVF Y;  2JMO A;  2F4M A;  1SIW A;  4A3L I;  4AYB A;  2PK7 A;  1YUA A;  4RVH A;  3RZO I;  3CCJ Z;  2QA4 1;  3I4N I;  1Z03 A;  1QVF Z;  1K8A 2;  2JIM A;  1M1K 1;  3IX0 A;  1S72 Z;  2VUM I;  3MZL B;  5C3E I;  3PO2 I;  3I55 1;  2YAD A;  4NBD A;  1Q82 1;  4NBC A;  4MD7 A;  4RVF A;  5A2Q b;  5FLM I;  3I56 1;  3FKI I;  3G4S Z;  1M1K 2;  2O4H A;  2NVY I;  4E32 A;  3NH4 A;  2P3Y A;  2GTH A;  4A3M I;  1X0T A;  1N8R 1;  3CCV 1;  1Q82 2;  1WZN A;  1VQM 1;  1YIJ Z;  4BY1 I;  2OOY B;  1RO0 A;  2QRC B;  1JJ2 Y;  3JAM b;  3CC2 Z;  3D9X A;  1Q86 1;  4HH4 A;  3GTQ I;  5C4X I;  2JA8 I;  1KQS Y;  2NVT I;  3CCM 1;  3H0G I;  2NVQ I;  1NP6 A;  3GTK I;  3G71 1;  2OTL Z;  4RS4 A;  3CC7 1;  1N8R 2;  2Q4Z A;  3BG1 B;  1ZB9 A;  1Y1W I;  1KQS Z;  1X3W A;  1TWC I;  3CCE 1;  4A3C I;  2QA4 Z;  4NBB A;  2DE5 A;  1KC8 1;  3CME 1;  2JA6 I;  4MD8 A;  3OW2 Z;  5D1O B;  2QEX 1;  4E30 A;  3I55 Z;  1TWA I;  1QYP A;  4EWC A;  3G4S 1;  1Q81 2;  4RV9 A;  3I56 Z;  2R92 I;  3BG0 B;  2VPZ A;  1ZH1 A;  2JIO A;  1L1O C;  3D6W A;  1P9N A;  3I07 A;  2H85 A;  1QXF A;  4XX2 A;  4Y52 I;  3S15 I;  3S1Q I;  3HOZ I;  3CCV Z;  2VF1 A;  3CCQ 1;  1VQM Z;  1VQ7 1;  1VQ6 1;  3HOV I;  1AA6 A;  1LQL A;  4BBR I;  1VQ9 1;  2G2K A;  2RT9 A;  1VLA A;  4A3E I;  3CCM Z;  3G71 Z;  2IZ3 A;  1WJ2 A;  2VUG A;  3T4N B;  1K9M 1;  3CC7 Z;  2OTJ 1;  4MXU A;  3HOW I;  3EER A;  3CQZ I;  3CMA 1;  4S1T A;  4NB9 A;  2PM9 A;  4NBH A;  3EED A;  1R9T I;  1YHQ 1;  4MD9 A;  4E2W A;  3GTM I;  3CCE Z;  3VMI A;  3HOY I;  1YUK A;  1VQN 1;  3GTO I;  3CME Z;  1Z01 A;  2PMZ A;  3MON A;  3J81 b;  2QEX Z;  1W2B Y;  1K9M 2;  4NOZ A;  2JIQ A;  3VMH A;  3GTM S;  3S1M I;  1K73 2;  2E7Z A;  1KD1 2;  5IP7 I;  1ZB8 A;  3I4M I;  3GTP I;  2QRE B;  1TWG I;  4E2Z A;  3CXC Y;  1VQL 1;  2K3R A;  2IZ4 A;  1VQ4 1;  1DL6 A;  4E31 A;  1NUI A;  4A3J I;  3S1N I;  3Q87 A;  1ML8 A;  3CC4 1;  5D1O A;  2QKD A;  3IF8 A;  3RZD I;  3CCQ Z;  2M48 A;  1VQ7 Z;  1VQ6 Z;  2I3C A;  2V3V A;  4E33 A;  2GU2 A;  3KIF A;  1VQ9 Z;  3CCS 1;  4NBG A;  1JJ2 Z;  2AYD A;  2DE6 A;  2V8I A;  2OTJ Z;  3CCR 1;  2VPW A;  3PO3 I;  2RIQ A;  3TE5 B;  5T6B A;  3VMG A;  3CMA Z;  1Q81 1;  3FQM A;  4A3G I;  1TWF I; 
#chains in the Genus database with same CATH homology
 1YHQ Z;  4MON A;  3CCL 1;  3GTJ I;  1RNI A;  3M4O I;  3G6E 1;  4BY7 I;  4DQY B;  1VQN Z;  2OOX B;  3PO3 S;  3LUS A;  3FQQ A;  2EGT A;  4TNU A;  1Q7Y 2;  5IT9 b;  2P28 A;  2JA5 I;  1VQO Z;  3GTL I;  1YJW 1;  3S14 I;  4RVG A;  2HF1 A;  1VQL Z;  1SFO I;  3J80 b;  4BXX I;  1YJN 1;  1VQ4 Z;  2HU9 A;  2DE7 A;  1VQK 1;  2V8K A;  5AN9 F;  1VQP Z;  4CL1 A;  4NBE A;  5FLX b;  3CC4 Z;  1K83 I;  2OZK A;  3CD6 1;  2Y0S A;  1N2F A;  2JS4 A;  2GTI A;  1Y1V I;  2WAQ A;  4DK1 A;  2B63 I;  5CM2 M;  1I6H I;  3CCS Z;  4HGY A;  1USP B;  3S2H I;  1KRL A;  2Q51 A;  2W04 A;  1K73 1;  1TWH I;  1KD1 1;  2KI7 B;  1Y1V S;  3CCR Z;  3QWU A;  4Y7N I;  3NDJ A;  1PFT A;  3U50 C;  2R7Z I;  4A3F I;  1YJ9 1;  2E2I I;  3CCL Z;  1JWH C;  3P5J B;  1WII A;  3F3P C;  3CCU 1;  4NFR A;  5IP9 I;  1YI2 1;  2WB1 A;  3G6E Z;  3S16 I;  1Z02 A;  3MZK B;  3HKZ A;  2E2J I;  1WW9 A;  3CPW Y;  1VQO 1;  1QVG Y;  1RO4 A;  2BJO A;  2M6N A;  2LFU A;  1W2B Z;  2JR6 A;  4NBA A;  2NVX I;  1YJW Z;  4E2Y A;  3GKQ A;  2RBL A;  4MH4 A;  4A3D I;  3M3Y I;  2E2H I;  3CPW Z;  1YJN Z;  1VQP 1;  1QVG Z;  3KIH A;  2R6M A;  1WCM I;  1S7M A;  1VQK Z;  3CXC Z;  3J81 f;  5A2Q f;  3CD6 Z;  1VQ5 1;  1YIT 1;  1VQ8 1;  1RO2 A;  2QLV B;  3GCF A;  4BBS I;  2LIY A;  2W03 A;  4X6A I;  4A3I I;  2ZAE B;  2V8J A;  5T64 A;  2RHB A;  1Q7Y 1;  3GTG I;  3S1R I;  1RQF A;  2R93 I;  2JNY A;  3K7A I;  3NFZ A;  3JAM f;  3NH5 A;  5D1P A;  1RLY A;  1I50 I;  1YJ9 Z;  4QTT A;  3VB9 A;  4DGL A;  4NBF A;  2O53 A;  3CCU Z;  1YI2 Z;  3CCJ 1;  1QF8 A;  1M90 1;  4A3K I;  4A3B I;  3OW2 Y;  2YU9 I;  1I3Q I;  4QTU A;  1USP A;  4MRI A;  1Q86 2;  2KPI A;  2F4O A;  1X3Z A;  1S72 1;  3HOU I;  3F3F C;  2QRD B;  4NH1 C;  3HOX I;  1M90 2;  1TFI A;  3S2D I;  2QR1 B;  4E2X A;  2E9H A;  4A93 I;  5C4J I;  2J6A A;  1NJI 1;  5IT9 f;  3TDH B;  3VTN A;  1VQ5 Z;  1YIT Z;  1KC8 2;  1VQ8 Z;  4RVD A;  5T67 A;  3NH8 A;  2K5R A;  4NB8 A;  1YIJ 1;  3NDI A;  3J80 f;  3J7A 4;  3IFU A;  5C44 I;  2JA7 I;  2AKL A;  3ESW A;  3CC2 1;  4HGZ A;  2JUB A;  2RPR A;  3S17 I;  5FLX f;  1NJI 2;  1K8A 1;  5LL6 f;  3H3V J;  2OTL 1;  1QVF Y;  2JMO A;  2F4M A;  4A3L I;  4AYB A;  2PK7 A;  1YUA A;  4RVH A;  3RZO I;  3CCJ Z;  2QA4 1;  3I4N I;  1Z03 A;  1QVF Z;  1K8A 2;  1M1K 1;  3IX0 A;  1S72 Z;  2VUM I;  3MZL B;  5C3E I;  3PO2 I;  3I55 1;  2YAD A;  4NBD A;  1Q82 1;  4NBC A;  4MD7 A;  4RVF A;  5A2Q b;  5FLM I;  3I56 1;  3FKI I;  3G4S Z;  1M1K 2;  2O4H A;  2NVY I;  4E32 A;  3NH4 A;  2P3Y A;  2GTH A;  4A3M I;  1X0T A;  1N8R 1;  3CCV 1;  1Q82 2;  1VQM 1;  1YIJ Z;  4BY1 I;  2OOY B;  1RO0 A;  2QRC B;  1JJ2 Y;  3JAM b;  3CC2 Z;  3D9X A;  1Q86 1;  4HH4 A;  3GTQ I;  5C4X I;  2JA8 I;  1KQS Y;  2NVT I;  3CCM 1;  3H0G I;  2NVQ I;  1NP6 A;  3GTK I;  3G71 1;  2OTL Z;  4RS4 A;  3CC7 1;  1N8R 2;  2Q4Z A;  3BG1 B;  1ZB9 A;  1Y1W I;  1KQS Z;  1X3W A;  1TWC I;  3CCE 1;  4A3C I;  2QA4 Z;  4NBB A;  2DE5 A;  1KC8 1;  3CME 1;  2JA6 I;  4MD8 A;  3OW2 Z;  5D1O B;  2QEX 1;  4E30 A;  3I55 Z;  1TWA I;  1QYP A;  4EWC A;  3G4S 1;  1Q81 2;  4RV9 A;  3I56 Z;  2R92 I;  3BG0 B;  1ZH1 A;  1L1O C;  3D6W A;  1P9N A;  3I07 A;  2H85 A;  4Y52 I;  4XX2 A;  3S15 I;  3S1Q I;  3HOZ I;  3CCV Z;  2VF1 A;  3CCQ 1;  1VQM Z;  1VQ7 1;  1VQ6 1;  3HOV I;  1LQL A;  4BBR I;  1VQ9 1;  2G2K A;  2RT9 A;  1VLA A;  4A3E I;  3CCM Z;  3G71 Z;  2IZ3 A;  2VUG A;  3T4N B;  1K9M 1;  3CC7 Z;  2OTJ 1;  4MXU A;  3HOW I;  3EER A;  3CQZ I;  3CMA 1;  4S1T A;  4NB9 A;  2PM9 A;  4NBH A;  3EED A;  1R9T I;  1YHQ 1;  4MD9 A;  4E2W A;  3GTM I;  3CCE Z;  3VMI A;  3HOY I;  1YUK A;  1VQN 1;  3GTO I;  3CME Z;  1Z01 A;  2PMZ A;  3MON A;  3J81 b;  2QEX Z;  1W2B Y;  1K9M 2;  4NOZ A;  3VMH A;  3GTM S;  3S1M I;  1K73 2;  1KD1 2;  5IP7 I;  1ZB8 A;  3I4M I;  3GTP I;  2QRE B;  1TWG I;  4E2Z A;  3CXC Y;  1VQL 1;  2K3R A;  2IZ4 A;  1VQ4 1;  1DL6 A;  4E31 A;  1NUI A;  4A3J I;  3S1N I;  3Q87 A;  1ML8 A;  3CC4 1;  5D1O A;  2QKD A;  3IF8 A;  3RZD I;  3CCQ Z;  2M48 A;  1VQ7 Z;  1VQ6 Z;  2I3C A;  4E33 A;  2GU2 A;  3KIF A;  1VQ9 Z;  3CCS 1;  4NBG A;  1JJ2 Z;  2DE6 A;  2V8I A;  2OTJ Z;  3CCR 1;  3PO3 I;  2RIQ A;  3TE5 B;  5T6B A;  3VMG A;  3CMA Z;  1Q81 1;  3FQM A;  4A3G I;  1TWF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...