3OW2Z

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Z00
1VQ61 1VQ91 1S721 1JJ2Y 3CC41 3CC7Z 1KQSY 1Q861 1VQ7Z 2QEXZ 3CCM1 1Q812 1M902 1QVGY 1NJI2 1VQK1 1YIJZ 3OW2Y 1YJ91 3CD61 1Q862 3CCEZ 1KC81 3CPWZ 1VQP1 3G711 1N8R1 1YI2Z 1VQ5Z 1YHQZ 1VQ6Z 2OTJ1 1W2BZ 1K731 1S72Z 1M901 1NJI1 3CC4Z 1KC82 3CCLZ 1VQO1 1N8R2 3CC21 3I55Z 3CCU1 3CXCY 1JJ2Z 1KQSZ 1K732 1VQKZ 1VQ8Z 1YJ9Z 1K8A1 3CD6Z 3CCQ1 3G6E1 3G71Z 1Q7Y2 1QVGZ 3OW2Z 2OTJZ 1K9M2 3CCV1 1YJW1 3CME1 3CCJZ 1VQN1 3CMA1 1K8A2 1VQ9Z 1QVFY 1VQM1 3G4S1 3CC2Z 1YIT1 1VQL1 3CCUZ 1VQ71 1Q7Y1 1M1K1 3CCMZ 3I561 3CCR1 1VQ41 1Q811 1K9M1 3CCQZ 1Q822 3CXCZ 3CCE1 1VQPZ 1KD12 1YI21 1M1K2 2QA41 1VQ51 1YJWZ 3CMEZ 3CCS1 1VQNZ 3CMAZ 2OTL1 1YJN1 1VQMZ 3G4SZ 1YITZ 1VQLZ 3CCL1 1Q821 1VQOZ 3CC71 3I551 1QVFZ 1KD11 3I56Z 2QEX1 3CCRZ 1VQ4Z 3CPWY 1VQ81 1YIJ1 3G6EZ 1W2BY 2QA4Z 3CCSZ 2OTLZ 1YJNZ 3CCVZ 1YHQ1 3CCJ1
chains in the Genus database with same CATH superfamily
1JWHC 4MD8A 2VF1A 3PO2I 3RZDI 1TWCI 4A3MI 2OOYB 1Q861 3ESWA 1VQ7Z 3J80f 2QEXZ 3IX0A 3J81f 3CCM1 5T64A 1RQFA 2LFUA 1QVGY 4EWCA 2HF1A 4BXXI 1YJ91 3I07A 1Y1VS 3VMHA 3VTNA 3CD61 1KC81 3CPWZ 1YI2Z 1NUIA 1P9NA 3HOYI 1WIIA 2GTIA 2JUBA 1W2BZ 5FLXf 1S72Z 1K731 1NJI1 1N2FA 2V8JA 3CC4Z 2G2KA 3NFZA 3S14I 2YADA 3GTKI 5A2Qf 3JAMb 1LQLA 3IFUA 1KQSZ 3HOZI 1VQ8Z 3HOUI 4E2XA 2NVYI 2KI7B 2JIQA 2QREB 4NBFA 3HOXI 1Q7Y2 3GTGI 2KPIA 4NFRA 2K3RA 4DGLA 1TWHI 2YU9I 5C3EI 1YUKA 1YJW1 4E33A 2DE6A 1K8A2 4HH4A 1QVFY 4NOZA 3G4S1 3S16I 3CCUZ 2RPRA 1ZH1A 2V8IA 3GTLI 3CCMZ 2O4HA 3I561 1VQ41 2JIOA 4MH4A 2NVXI 1K9M1 1RLYA 1RNIA 2VPWA 3CXCZ 1M1K2 2PMZA 3I4NI 2R7ZI 3CMAZ 4AYBA 2E2HI 4NBCA 3I4MI 2OOXB 1YITZ 2E2JI 1Q821 4DQYB 1USPA 2LIYA 3S1RI 2W04A 1KD11 2VPXA 2QEX1 2NVQI 5D1PA 5C4JI 3CPWY 3J7A4 4NBGA 1TWFI 1I50I 3MZLB 1USPB 1W2BY 4S1TA 2V45A 2QA4Z 3CCSZ 1YJNZ 1FDOA 1YUAA 1VQ91 3TE5B 2PK7A 1S721 4BY1I 5C44I 3CC41 3CC7Z 1KQSY 1WCMI 1Q16A 2RBLA 5FLMI 5IT9b 1Q812 2QLVB 1X0TA 2JNYA 2M6NA 1NJI2 4CL1A 1YIJZ 1ZB8A 1YHQZ 3BG1B 4A3FI 1I3QI 2QKDA 4BBSI 3NH5A 2NVTI 1N8R2 1WZNA 3H0GI 3CCU1 1QXFA 3CXCY 3GTQI 2GU2A 4A3KI 2M48A 3PO3I 3TDHB 4A3II 1K83I 3OW2Z 4Y7NI 2OTJZ 1R9TI 1K9M2 3CMA1 1Z02A 2HU9A 1VQ9Z 2VUMI 1YIT1 3MONA 2WB1A 3F3PC 2QRDB 1KRLA 3M3YI 1X3ZA 4A3EI 3IF8A 1Q822 2B63I 1KD12 4A3GI 2QA41 3MZKB 2K5RA 1VQ51 2IZ4A 3CMEZ 3CCS1 1WJ2A 1RO2A 2RHBA 1YJN1 4BY7I 1VQMZ 3D6WA 2JMOA 1VQLZ 3CCL1 5IT9f 3CC71 1QF8A 3FQQA 1I6HI 3S2HI 1YIJ1 3HKZA 5IP9I 2P3YA 1YHQ1 2VUGA 2RT9A 1DL6A 4A3JI 3PO3S 2VPYA 2Q51A 2VPZA 3KIFA 1L1OC 2JIRA 2W03A 4A93I 3J80b 5D1OA 3D9XA 3J81b 3D2LA 3OW2Y 3GTOI 2WAQA 3GCFA 1Q862 1VQP1 3IR7A 2AYDA 2F4OA 2JA8I 1VQ5Z 5D1OB 2H85A 4E31A 2V8KA 1VQ6Z 2OTJ1 1M901 3NH8A 1KC82 3CCLZ 2DE7A 3S17I 3JAMf 2O53A 1JJ2Z 3F3FC 4MRIA 1K732 1VQKZ 2JR6A 1K8A1 4Y52I 3G6E1 2OZKA 2DE5A 2E7ZA 3G71Z 4NBAA 1ZB9A 4BBRI 4RVFA 3H3VJ 3HOVI 4HGYA 1X3WA 3CME1 3LUSA 4NB9A 1VQM1 1WW9A 3CC2Z 1VQL1 1Y1WI 3EEDA 4RVHA 1M1K1 2AKLA 4NBHA 5LL6f 2V3VA 2GTHA 4NBBA 2JIPA 4MXUA 3CCQZ 1VLAA 3CCE1 1VQPZ 2NAPA 3S1NI 1VQNZ 4X6AI 4QTTA 1NP6A 3CQZI 4RVGA 2P28A 4A3BI 3I551 3Q87A 3CCRZ 4E32A 3BG0B 2LEXA 1AA6A 1Z03A 3GTJI 3HOWI 3S1QI 2Q4ZA 4HGZA 4XX2A 3G6EZ 1Z01A 2IV2X 3T4NB 2F4MA 2QR1B 2OTLZ 1Q811 2R6MA 3CCJ1 1VQ61 3FKII 3EERA 1JJ2Y 5AN9F 2JA5I 2Y0SA 3M4OI 2JA7I 1M902 1VQK1 3GTMI 3VMGA 3GKQA 4NBDA 3CCEZ 3G711 1N8R1 3FQMA 2PM9A 5T6BA 4E2WA 1FDIA 2RIQA 4A3DI 3P5JB 2ZAEB 4QTUA 2E9HA 5C4XI 1VQO1 4DK1A 3CC21 3I55Z 2JA6I 2E2II 4E2ZA 2J6AA 5IP7I 1TFIA 1YJ9Z 3S15I 5CM2M 3CD6Z 4RV9A 3CCQ1 2R92I 3GTPI 4RVDA 2BJOA 4MONA 4A3CI 1QVGZ 3S2DI 5T67A 4E2YA 2R93I 3NH4A 3CCV1 1VQN1 3CCJZ 3RZOI 1SIWA 1TWGI 1TWAI 5FLXb 2QRCB 1Y1VI 1VQ71 1Q7Y1 1S7MA 3NDIA 3CCR1 5A2Qb 2EGTA 1RO4A 3U50C 1YI21 4TNUA 1Y8CA 4RS4A 1YJWZ 2OTL1 1RO0A 4E30A 3GTMS 2JS4A 3G4SZ 2I3CA 1VQOZ 3QWUA 1QVFZ 3I56Z 1VQ4Z 4MD9A 2IZ3A 1QYPA 3NDJA 3KIHA 3VB9A 1VQ81 4MD7A 2JIMA 3S1MI 1PFTA 4NH1C 1ML8A 1SFOI 3VMIA 3CCVZ 3K7AI 4A3LI 4NBEA 4NB8A
chains in the Genus database with same CATH topology
1JWHC 4MD8A 2VF1A 3PO2I 3RZDI 1TWCI 4A3MI 2OOYB 1Q861 3ESWA 1VQ7Z 3J80f 2QEXZ 3IX0A 3J81f 3CCM1 5T64A 1RQFA 2LFUA 1QVGY 4EWCA 2HF1A 4BXXI 1YJ91 3I07A 1Y1VS 3VMHA 3VTNA 3CD61 1KC81 3CPWZ 1YI2Z 1NUIA 1P9NA 3HOYI 1WIIA 2GTIA 2JUBA 1W2BZ 5FLXf 1S72Z 1K731 1NJI1 1N2FA 2V8JA 3CC4Z 2G2KA 3NFZA 3S14I 2YADA 3GTKI 5A2Qf 3JAMb 1LQLA 3IFUA 1KQSZ 3HOZI 1VQ8Z 3HOUI 4E2XA 2NVYI 2KI7B 2QREB 4NBFA 3HOXI 1Q7Y2 3GTGI 2KPIA 4NFRA 2K3RA 4DGLA 1TWHI 2YU9I 5C3EI 1YUKA 1YJW1 4E33A 2DE6A 1K8A2 4HH4A 1QVFY 4NOZA 3G4S1 3S16I 3CCUZ 2RPRA 1ZH1A 2V8IA 3GTLI 3CCMZ 2O4HA 3I561 1VQ41 4MH4A 2NVXI 1K9M1 1RLYA 1RNIA 3CXCZ 1M1K2 2PMZA 3I4NI 2R7ZI 3CMAZ 4AYBA 2E2HI 4NBCA 3I4MI 2OOXB 1YITZ 2E2JI 1Q821 4DQYB 1USPA 2LIYA 3S1RI 2W04A 1KD11 2QEX1 2NVQI 5D1PA 5C4JI 3CPWY 3J7A4 4NBGA 1TWFI 1I50I 3MZLB 1USPB 1W2BY 4S1TA 2QA4Z 3CCSZ 1YJNZ 1YUAA 1VQ91 3TE5B 2PK7A 1S721 4BY1I 5C44I 3CC41 3CC7Z 1KQSY 1WCMI 2RBLA 5FLMI 5IT9b 1Q812 2QLVB 1X0TA 2JNYA 2M6NA 1NJI2 4CL1A 1YIJZ 1ZB8A 1YHQZ 3BG1B 4A3FI 1I3QI 2QKDA 4BBSI 3NH5A 2NVTI 1N8R2 3H0GI 3CCU1 3CXCY 3GTQI 2GU2A 4A3KI 2M48A 3PO3I 3TDHB 4A3II 1K83I 3OW2Z 4Y7NI 2OTJZ 1R9TI 1K9M2 3CMA1 1Z02A 2HU9A 1VQ9Z 2VUMI 1YIT1 3MONA 2WB1A 3F3PC 2QRDB 1KRLA 3M3YI 1X3ZA 4A3EI 3IF8A 1Q822 2B63I 1KD12 4A3GI 2QA41 3MZKB 2K5RA 1VQ51 2IZ4A 3CMEZ 3CCS1 1RO2A 2RHBA 1YJN1 4BY7I 1VQMZ 3D6WA 2JMOA 1VQLZ 3CCL1 5IT9f 3CC71 1QF8A 3FQQA 1I6HI 3S2HI 1YIJ1 3HKZA 5IP9I 2P3YA 1YHQ1 2VUGA 2RT9A 1DL6A 4A3JI 3PO3S 2Q51A 3KIFA 1L1OC 2W03A 4A93I 3J80b 5D1OA 3D9XA 3J81b 3OW2Y 3GTOI 2WAQA 3GCFA 1Q862 1VQP1 2F4OA 2JA8I 1VQ5Z 5D1OB 2H85A 4E31A 2V8KA 1VQ6Z 2OTJ1 1M901 3NH8A 1KC82 3CCLZ 2DE7A 3S17I 3JAMf 2O53A 1JJ2Z 3F3FC 4MRIA 1K732 1VQKZ 2JR6A 1K8A1 4Y52I 3G6E1 2OZKA 2DE5A 3G71Z 4NBAA 1ZB9A 4BBRI 4RVFA 3H3VJ 3HOVI 4HGYA 1X3WA 3CME1 3LUSA 4NB9A 1VQM1 1WW9A 3CC2Z 1VQL1 1Y1WI 3EEDA 4RVHA 1M1K1 2AKLA 4NBHA 5LL6f 2GTHA 4NBBA 4MXUA 3CCQZ 1VLAA 3CCE1 1VQPZ 3S1NI 1VQNZ 4X6AI 4QTTA 1NP6A 3CQZI 4RVGA 2P28A 4A3BI 3I551 3Q87A 3CCRZ 4E32A 3BG0B 3HOWI 1Z03A 3GTJI 3S1QI 2Q4ZA 4HGZA 4XX2A 3G6EZ 1Z01A 3T4NB 2F4MA 2QR1B 2OTLZ 1Q811 2R6MA 3CCJ1 1VQ61 3FKII 3EERA 1JJ2Y 5AN9F 2JA5I 2Y0SA 3M4OI 2JA7I 1M902 1VQK1 3GTMI 3VMGA 3GKQA 4NBDA 3CCEZ 3G711 1N8R1 3FQMA 2PM9A 5T6BA 4E2WA 2RIQA 4A3DI 3P5JB 2ZAEB 4QTUA 2E9HA 5C4XI 1VQO1 4DK1A 3CC21 3I55Z 2JA6I 2E2II 4E2ZA 2J6AA 5IP7I 1TFIA 1YJ9Z 3S15I 5CM2M 3CD6Z 4RV9A 3CCQ1 2R92I 3GTPI 4RVDA 2BJOA 4MONA 4A3CI 1QVGZ 3S2DI 5T67A 4E2YA 2R93I 3NH4A 3CCV1 1VQN1 3CCJZ 3RZOI 1TWGI 1TWAI 5FLXb 2QRCB 1Y1VI 1VQ71 1Q7Y1 1S7MA 3NDIA 3CCR1 5A2Qb 2EGTA 1RO4A 3U50C 1YI21 4TNUA 4RS4A 1YJWZ 2OTL1 1RO0A 4E30A 3GTMS 2JS4A 3G4SZ 2I3CA 1VQOZ 3QWUA 1QVFZ 3I56Z 1VQ4Z 4MD9A 2IZ3A 1QYPA 3NDJA 3KIHA 3VB9A 1VQ81 4MD7A 3S1MI 1PFTA 4NH1C 1ML8A 1SFOI 3VMIA 3CCVZ 3K7AI 4A3LI 4NBEA 4NB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 1;  1VQ9 1;  1S72 1;  1JJ2 Y;  3CC4 1;  3CC7 Z;  1KQS Y;  1Q86 1;  1VQ7 Z;  2QEX Z;  3CCM 1;  1Q81 2;  1M90 2;  1QVG Y;  1NJI 2;  1VQK 1;  1YIJ Z;  3OW2 Y;  1YJ9 1;  3CD6 1;  1Q86 2;  3CCE Z;  1KC8 1;  3CPW Z;  1VQP 1;  3G71 1;  1N8R 1;  1YI2 Z;  1VQ5 Z;  1YHQ Z;  1VQ6 Z;  2OTJ 1;  1W2B Z;  1K73 1;  1S72 Z;  1M90 1;  1NJI 1;  3CC4 Z;  1KC8 2;  3CCL Z;  1VQO 1;  1N8R 2;  3CC2 1;  3I55 Z;  3CCU 1;  3CXC Y;  1JJ2 Z;  1KQS Z;  1K73 2;  1VQK Z;  1VQ8 Z;  1YJ9 Z;  1K8A 1;  3CD6 Z;  3CCQ 1;  3G6E 1;  3G71 Z;  1Q7Y 2;  1QVG Z;  3OW2 Z;  2OTJ Z;  1K9M 2;  3CCV 1;  1YJW 1;  3CME 1;  3CCJ Z;  1VQN 1;  3CMA 1;  1K8A 2;  1VQ9 Z;  1QVF Y;  1VQM 1;  3G4S 1;  3CC2 Z;  1YIT 1;  1VQL 1;  3CCU Z;  1VQ7 1;  1Q7Y 1;  1M1K 1;  3CCM Z;  3I56 1;  3CCR 1;  1VQ4 1;  1Q81 1;  1K9M 1;  3CCQ Z;  1Q82 2;  3CXC Z;  3CCE 1;  1VQP Z;  1KD1 2;  1YI2 1;  1M1K 2;  2QA4 1;  1VQ5 1;  1YJW Z;  3CME Z;  3CCS 1;  1VQN Z;  3CMA Z;  2OTL 1;  1YJN 1;  1VQM Z;  3G4S Z;  1YIT Z;  1VQL Z;  3CCL 1;  1Q82 1;  1VQO Z;  3CC7 1;  3I55 1;  1QVF Z;  1KD1 1;  3I56 Z;  2QEX 1;  3CCR Z;  1VQ4 Z;  3CPW Y;  1VQ8 1;  1YIJ 1;  3G6E Z;  1W2B Y;  2QA4 Z;  3CCS Z;  2OTL Z;  1YJN Z;  3CCV Z;  1YHQ 1;  3CCJ 1; 
#chains in the Genus database with same CATH topology
 1JWH C;  4MD8 A;  2VF1 A;  3PO2 I;  3RZD I;  1TWC I;  4A3M I;  2OOY B;  1Q86 1;  3ESW A;  1VQ7 Z;  3J80 f;  2QEX Z;  3IX0 A;  3J81 f;  3CCM 1;  5T64 A;  1RQF A;  2LFU A;  1QVG Y;  4EWC A;  2HF1 A;  4BXX I;  1YJ9 1;  3I07 A;  1Y1V S;  3VMH A;  3VTN A;  3CD6 1;  1KC8 1;  3CPW Z;  1YI2 Z;  1NUI A;  1P9N A;  3HOY I;  1WII A;  2GTI A;  2JUB A;  1W2B Z;  5FLX f;  1S72 Z;  1K73 1;  1NJI 1;  1N2F A;  2V8J A;  3CC4 Z;  2G2K A;  3NFZ A;  3S14 I;  2YAD A;  3GTK I;  5A2Q f;  3JAM b;  1LQL A;  3IFU A;  1KQS Z;  3HOZ I;  1VQ8 Z;  3HOU I;  4E2X A;  2NVY I;  2KI7 B;  2JIQ A;  2QRE B;  4NBF A;  3HOX I;  1Q7Y 2;  3GTG I;  2KPI A;  4NFR A;  2K3R A;  4DGL A;  1TWH I;  2YU9 I;  5C3E I;  1YUK A;  1YJW 1;  4E33 A;  2DE6 A;  1K8A 2;  4HH4 A;  1QVF Y;  4NOZ A;  3G4S 1;  3S16 I;  3CCU Z;  2RPR A;  1ZH1 A;  2V8I A;  3GTL I;  3CCM Z;  2O4H A;  3I56 1;  1VQ4 1;  2JIO A;  4MH4 A;  2NVX I;  1K9M 1;  1RLY A;  1RNI A;  2VPW A;  3CXC Z;  1M1K 2;  2PMZ A;  3I4N I;  2R7Z I;  3CMA Z;  4AYB A;  2E2H I;  4NBC A;  3I4M I;  2OOX B;  1YIT Z;  2E2J I;  1Q82 1;  4DQY B;  1USP A;  2LIY A;  3S1R I;  2W04 A;  1KD1 1;  2VPX A;  2QEX 1;  2NVQ I;  5D1P A;  5C4J I;  3CPW Y;  3J7A 4;  4NBG A;  1TWF I;  1I50 I;  3MZL B;  1USP B;  1W2B Y;  4S1T A;  2V45 A;  2QA4 Z;  3CCS Z;  1YJN Z;  1FDO A;  1YUA A;  1VQ9 1;  3TE5 B;  2PK7 A;  1S72 1;  4BY1 I;  5C44 I;  3CC4 1;  3CC7 Z;  1KQS Y;  1WCM I;  1Q16 A;  2RBL A;  5FLM I;  5IT9 b;  1Q81 2;  2QLV B;  1X0T A;  2JNY A;  2M6N A;  1NJI 2;  4CL1 A;  1YIJ Z;  1ZB8 A;  1YHQ Z;  3BG1 B;  4A3F I;  1I3Q I;  2QKD A;  4BBS I;  3NH5 A;  2NVT I;  1N8R 2;  1WZN A;  3H0G I;  3CCU 1;  1QXF A;  3CXC Y;  3GTQ I;  2GU2 A;  4A3K I;  2M48 A;  3PO3 I;  3TDH B;  4A3I I;  1K83 I;  3OW2 Z;  4Y7N I;  2OTJ Z;  1R9T I;  1K9M 2;  3CMA 1;  1Z02 A;  2HU9 A;  1VQ9 Z;  2VUM I;  1YIT 1;  3MON A;  2WB1 A;  3F3P C;  2QRD B;  1KRL A;  3M3Y I;  1X3Z A;  4A3E I;  3IF8 A;  1Q82 2;  2B63 I;  1KD1 2;  4A3G I;  2QA4 1;  3MZK B;  2K5R A;  1VQ5 1;  2IZ4 A;  3CME Z;  3CCS 1;  1WJ2 A;  1RO2 A;  2RHB A;  1YJN 1;  4BY7 I;  1VQM Z;  3D6W A;  2JMO A;  1VQL Z;  3CCL 1;  5IT9 f;  3CC7 1;  1QF8 A;  3FQQ A;  1I6H I;  3S2H I;  1YIJ 1;  3HKZ A;  5IP9 I;  2P3Y A;  1YHQ 1;  2VUG A;  2RT9 A;  1DL6 A;  4A3J I;  3PO3 S;  2VPY A;  2Q51 A;  2VPZ A;  3KIF A;  1L1O C;  2JIR A;  2W03 A;  4A93 I;  3J80 b;  5D1O A;  3D9X A;  3J81 b;  3D2L A;  3OW2 Y;  3GTO I;  2WAQ A;  3GCF A;  1Q86 2;  1VQP 1;  3IR7 A;  2AYD A;  2F4O A;  2JA8 I;  1VQ5 Z;  5D1O B;  2H85 A;  4E31 A;  2V8K A;  1VQ6 Z;  2OTJ 1;  1M90 1;  3NH8 A;  1KC8 2;  3CCL Z;  2DE7 A;  3S17 I;  3JAM f;  2O53 A;  1JJ2 Z;  3F3F C;  4MRI A;  1K73 2;  1VQK Z;  2JR6 A;  1K8A 1;  4Y52 I;  3G6E 1;  2OZK A;  2DE5 A;  2E7Z A;  3G71 Z;  4NBA A;  1ZB9 A;  4BBR I;  4RVF A;  3H3V J;  3HOV I;  4HGY A;  1X3W A;  3CME 1;  3LUS A;  4NB9 A;  1VQM 1;  1WW9 A;  3CC2 Z;  1VQL 1;  1Y1W I;  3EED A;  4RVH A;  1M1K 1;  2AKL A;  4NBH A;  5LL6 f;  2V3V A;  2GTH A;  4NBB A;  2JIP A;  4MXU A;  3CCQ Z;  1VLA A;  3CCE 1;  1VQP Z;  2NAP A;  3S1N I;  1VQN Z;  4X6A I;  4QTT A;  1NP6 A;  3CQZ I;  4RVG A;  2P28 A;  4A3B I;  3I55 1;  3Q87 A;  3CCR Z;  4E32 A;  3BG0 B;  2LEX A;  1AA6 A;  1Z03 A;  3GTJ I;  3HOW I;  3S1Q I;  2Q4Z A;  4HGZ A;  4XX2 A;  3G6E Z;  1Z01 A;  2IV2 X;  3T4N B;  2F4M A;  2QR1 B;  2OTL Z;  1Q81 1;  2R6M A;  3CCJ 1;  1VQ6 1;  3FKI I;  3EER A;  1JJ2 Y;  5AN9 F;  2JA5 I;  2Y0S A;  3M4O I;  2JA7 I;  1M90 2;  1VQK 1;  3GTM I;  3VMG A;  3GKQ A;  4NBD A;  3CCE Z;  3G71 1;  1N8R 1;  3FQM A;  2PM9 A;  5T6B A;  4E2W A;  1FDI A;  2RIQ A;  4A3D I;  3P5J B;  2ZAE B;  4QTU A;  2E9H A;  5C4X I;  1VQO 1;  4DK1 A;  3CC2 1;  3I55 Z;  2JA6 I;  2E2I I;  4E2Z A;  2J6A A;  5IP7 I;  1TFI A;  1YJ9 Z;  3S15 I;  5CM2 M;  3CD6 Z;  4RV9 A;  3CCQ 1;  2R92 I;  3GTP I;  4RVD A;  2BJO A;  4MON A;  4A3C I;  1QVG Z;  3S2D I;  5T67 A;  4E2Y A;  2R93 I;  3NH4 A;  3CCV 1;  1VQN 1;  3CCJ Z;  3RZO I;  1SIW A;  1TWG I;  1TWA I;  5FLX b;  2QRC B;  1Y1V I;  1VQ7 1;  1Q7Y 1;  1S7M A;  3NDI A;  3CCR 1;  5A2Q b;  2EGT A;  1RO4 A;  3U50 C;  1YI2 1;  4TNU A;  1Y8C A;  4RS4 A;  1YJW Z;  2OTL 1;  1RO0 A;  4E30 A;  3GTM S;  2JS4 A;  3G4S Z;  2I3C A;  1VQO Z;  3QWU A;  1QVF Z;  3I56 Z;  1VQ4 Z;  4MD9 A;  2IZ3 A;  1QYP A;  3NDJ A;  3KIH A;  3VB9 A;  1VQ8 1;  4MD7 A;  2JIM A;  3S1M I;  1PFT A;  4NH1 C;  1ML8 A;  1SFO I;  3VMI A;  3CCV Z;  3K7A I;  4A3L I;  4NBE A;  4NB8 A; 
#chains in the Genus database with same CATH homology
 1JWH C;  4MD8 A;  2VF1 A;  3PO2 I;  3RZD I;  1TWC I;  4A3M I;  2OOY B;  1Q86 1;  3ESW A;  1VQ7 Z;  3J80 f;  2QEX Z;  3IX0 A;  3J81 f;  3CCM 1;  5T64 A;  1RQF A;  2LFU A;  1QVG Y;  4EWC A;  2HF1 A;  4BXX I;  1YJ9 1;  3I07 A;  1Y1V S;  3VMH A;  3VTN A;  3CD6 1;  1KC8 1;  3CPW Z;  1YI2 Z;  1NUI A;  1P9N A;  3HOY I;  1WII A;  2GTI A;  2JUB A;  1W2B Z;  5FLX f;  1S72 Z;  1K73 1;  1NJI 1;  1N2F A;  2V8J A;  3CC4 Z;  2G2K A;  3NFZ A;  3S14 I;  2YAD A;  3GTK I;  5A2Q f;  3JAM b;  1LQL A;  3IFU A;  1KQS Z;  3HOZ I;  1VQ8 Z;  3HOU I;  4E2X A;  2NVY I;  2KI7 B;  2QRE B;  4NBF A;  3HOX I;  1Q7Y 2;  3GTG I;  2KPI A;  4NFR A;  2K3R A;  4DGL A;  1TWH I;  2YU9 I;  5C3E I;  1YUK A;  1YJW 1;  4E33 A;  2DE6 A;  1K8A 2;  4HH4 A;  1QVF Y;  4NOZ A;  3G4S 1;  3S16 I;  3CCU Z;  2RPR A;  1ZH1 A;  2V8I A;  3GTL I;  3CCM Z;  2O4H A;  3I56 1;  1VQ4 1;  4MH4 A;  2NVX I;  1K9M 1;  1RLY A;  1RNI A;  3CXC Z;  1M1K 2;  2PMZ A;  3I4N I;  2R7Z I;  3CMA Z;  4AYB A;  2E2H I;  4NBC A;  3I4M I;  2OOX B;  1YIT Z;  2E2J I;  1Q82 1;  4DQY B;  1USP A;  2LIY A;  3S1R I;  2W04 A;  1KD1 1;  2QEX 1;  2NVQ I;  5D1P A;  5C4J I;  3CPW Y;  3J7A 4;  4NBG A;  1TWF I;  1I50 I;  3MZL B;  1USP B;  1W2B Y;  4S1T A;  2QA4 Z;  3CCS Z;  1YJN Z;  1YUA A;  1VQ9 1;  3TE5 B;  2PK7 A;  1S72 1;  4BY1 I;  5C44 I;  3CC4 1;  3CC7 Z;  1KQS Y;  1WCM I;  2RBL A;  5FLM I;  5IT9 b;  1Q81 2;  2QLV B;  1X0T A;  2JNY A;  2M6N A;  1NJI 2;  4CL1 A;  1YIJ Z;  1ZB8 A;  1YHQ Z;  3BG1 B;  4A3F I;  1I3Q I;  2QKD A;  4BBS I;  3NH5 A;  2NVT I;  1N8R 2;  3H0G I;  3CCU 1;  3CXC Y;  3GTQ I;  2GU2 A;  4A3K I;  2M48 A;  3PO3 I;  3TDH B;  4A3I I;  1K83 I;  3OW2 Z;  4Y7N I;  2OTJ Z;  1R9T I;  1K9M 2;  3CMA 1;  1Z02 A;  2HU9 A;  1VQ9 Z;  2VUM I;  1YIT 1;  3MON A;  2WB1 A;  3F3P C;  2QRD B;  1KRL A;  3M3Y I;  1X3Z A;  4A3E I;  3IF8 A;  1Q82 2;  2B63 I;  1KD1 2;  4A3G I;  2QA4 1;  3MZK B;  2K5R A;  1VQ5 1;  2IZ4 A;  3CME Z;  3CCS 1;  1RO2 A;  2RHB A;  1YJN 1;  4BY7 I;  1VQM Z;  3D6W A;  2JMO A;  1VQL Z;  3CCL 1;  5IT9 f;  3CC7 1;  1QF8 A;  3FQQ A;  1I6H I;  3S2H I;  1YIJ 1;  3HKZ A;  5IP9 I;  2P3Y A;  1YHQ 1;  2VUG A;  2RT9 A;  1DL6 A;  4A3J I;  3PO3 S;  2Q51 A;  3KIF A;  1L1O C;  2W03 A;  4A93 I;  3J80 b;  5D1O A;  3D9X A;  3J81 b;  3OW2 Y;  3GTO I;  2WAQ A;  3GCF A;  1Q86 2;  1VQP 1;  2F4O A;  2JA8 I;  1VQ5 Z;  5D1O B;  2H85 A;  4E31 A;  2V8K A;  1VQ6 Z;  2OTJ 1;  1M90 1;  3NH8 A;  1KC8 2;  3CCL Z;  2DE7 A;  3S17 I;  3JAM f;  2O53 A;  1JJ2 Z;  3F3F C;  4MRI A;  1K73 2;  1VQK Z;  2JR6 A;  1K8A 1;  4Y52 I;  3G6E 1;  2OZK A;  2DE5 A;  3G71 Z;  4NBA A;  1ZB9 A;  4BBR I;  4RVF A;  3H3V J;  3HOV I;  4HGY A;  1X3W A;  3CME 1;  3LUS A;  4NB9 A;  1VQM 1;  1WW9 A;  3CC2 Z;  1VQL 1;  1Y1W I;  3EED A;  4RVH A;  1M1K 1;  2AKL A;  4NBH A;  5LL6 f;  2GTH A;  4NBB A;  4MXU A;  3CCQ Z;  1VLA A;  3CCE 1;  1VQP Z;  3S1N I;  1VQN Z;  4X6A I;  4QTT A;  1NP6 A;  3CQZ I;  4RVG A;  2P28 A;  4A3B I;  3I55 1;  3Q87 A;  3CCR Z;  4E32 A;  3BG0 B;  3HOW I;  1Z03 A;  3GTJ I;  3S1Q I;  2Q4Z A;  4HGZ A;  4XX2 A;  3G6E Z;  1Z01 A;  3T4N B;  2F4M A;  2QR1 B;  2OTL Z;  1Q81 1;  2R6M A;  3CCJ 1;  1VQ6 1;  3FKI I;  3EER A;  1JJ2 Y;  5AN9 F;  2JA5 I;  2Y0S A;  3M4O I;  2JA7 I;  1M90 2;  1VQK 1;  3GTM I;  3VMG A;  3GKQ A;  4NBD A;  3CCE Z;  3G71 1;  1N8R 1;  3FQM A;  2PM9 A;  5T6B A;  4E2W A;  2RIQ A;  4A3D I;  3P5J B;  2ZAE B;  4QTU A;  2E9H A;  5C4X I;  1VQO 1;  4DK1 A;  3CC2 1;  3I55 Z;  2JA6 I;  2E2I I;  4E2Z A;  2J6A A;  5IP7 I;  1TFI A;  1YJ9 Z;  3S15 I;  5CM2 M;  3CD6 Z;  4RV9 A;  3CCQ 1;  2R92 I;  3GTP I;  4RVD A;  2BJO A;  4MON A;  4A3C I;  1QVG Z;  3S2D I;  5T67 A;  4E2Y A;  2R93 I;  3NH4 A;  3CCV 1;  1VQN 1;  3CCJ Z;  3RZO I;  1TWG I;  1TWA I;  5FLX b;  2QRC B;  1Y1V I;  1VQ7 1;  1Q7Y 1;  1S7M A;  3NDI A;  3CCR 1;  5A2Q b;  2EGT A;  1RO4 A;  3U50 C;  1YI2 1;  4TNU A;  4RS4 A;  1YJW Z;  2OTL 1;  1RO0 A;  4E30 A;  3GTM S;  2JS4 A;  3G4S Z;  2I3C A;  1VQO Z;  3QWU A;  1QVF Z;  3I56 Z;  1VQ4 Z;  4MD9 A;  2IZ3 A;  1QYP A;  3NDJ A;  3KIH A;  3VB9 A;  1VQ8 1;  4MD7 A;  3S1M I;  1PFT A;  4NH1 C;  1ML8 A;  1SFO I;  3VMI A;  3CCV Z;  3K7A I;  4A3L I;  4NBE A;  4NB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...