3OW2Z

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Z00
1K9M2 1VQP1 1M1K1 1VQ41 1K9M1 3I56Z 3CMEZ 3CC71 1VQNZ 1VQ6Z 1K8A2 1K732 3CPWZ 3CC41 1VQ51 3CCV1 3CMA1 3CXCY 1VQ9Z 1YJ9Z 3CXCZ 1K731 1Q812 3CCRZ 3CCQ1 3CCS1 1YITZ 2OTJZ 1VQKZ 3CCMZ 1Q811 1YJNZ 2OTLZ 3CC2Z 1QVGY 1VQ81 1QVGZ 1VQMZ 3CCE1 2QA4Z 1QVFY 3CCJZ 1YHQ1 1VQOZ 1NJI2 2QEXZ 3CD61 3G4S1 1S72Z 1YJWZ 3CCLZ 3G6E1 1NJI1 1W2BY 1VQ91 1K8A1 3CCUZ 1YIJZ 1YI2Z 1KC82 1M902 1KC81 1VQPZ 1M901 1KD12 3I55Z 1KQSY 1KD11 1KQSZ 3CC7Z 1QVFZ 3I561 1VQ5Z 3CME1 3CCVZ 1VQN1 1VQ61 3CMAZ 3G71Z 3OW2Y 1VQLZ 3CCSZ 1Q7Y2 1YJW1 1JJ2Y 1YJ91 1W2BZ 3CCR1 1YIJ1 1Q7Y1 1YIT1 2OTJ1 1M1K2 1Q822 1VQK1 3CCM1 1VQ7Z 1YJN1 1Q821 3CCEZ 2OTL1 1VQ4Z 3I551 3CC21 1VQM1 1YHQZ 1Q862 2QA41 3CPWY 3CCJ1 3CD6Z 3CC4Z 3G4SZ 1VQO1 1Q861 3G6EZ 3G711 2QEX1 3OW2Z 1VQL1 3CCQZ 1S721 3CCL1 1JJ2Z 1N8R2 3CCU1 1YI21 1N8R1 1VQ8Z 1VQ71
chains in the Genus database with same CATH superfamily
1WIIA 4NH1C 4MD7A 1WJ2A 3I56Z 2QR1B 3K7AI 3CMEZ 4RVGA 5AN9F 3S1NI 2F4MA 5FLXf 2R7ZI 3MZKB 2VUMI 1X3ZA 4NBCA 3CC41 1VQ51 3CCV1 4MXUA 2E2JI 3CMA1 1RLYA 3F3PC 5IT9f 3CXCY 4E32A 3CXCZ 1YJ9Z 2H85A 2VPYA 3CCS1 1TWAI 3GTMI 2OTJZ 3M3YI 2VPWA 3MONA 1YJNZ 1RO0A 3CC2Z 3ESWA 1Y1VI 1X3WA 1QYPA 3D9XA 4BBSI 4E31A 2K3RA 1NJI2 4A3JI 1ZB8A 3CD61 4NB9A 4CL1A 3CCLZ 1W2BY 2OOYB 3BG1B 3CCUZ 5A2Qf 1DL6A 4A3GI 4DGLA 3VB9A 4A3CI 4A93I 4S1TA 1KC81 1M901 4E33A 3PO3I 1KD12 2P3YA 4NBHA 3HOUI 3J80f 3GTJI 1KQSY 1KQSZ 1YUAA 4BBRI 5C4JI 1RQFA 1USPA 1VQ5Z 3Q87A 3CCVZ 1VQN1 2JIOA 3CMAZ 3J81f 3G71Z 1L1OC 2QKDA 3CCSZ 1YJW1 2YADA 1YIJ1 2F4OA 1WCMI 3CCM1 1Q821 3GTOI 4E2WA 1VQM1 2RHBA 5FLMI 2NVTI 2QA41 1R9TI 3CD6Z 3GCFA 3OW2Z 3CCQZ 2BJOA 5LL6f 1N2FA 3GTMS 3J7A4 4A3BI 2V8IA 1VQ8Z 1VQ71 3RZOI 2LFUA 1K9M2 1M1K1 4A3II 2W03A 5IP9I 1Y1VS 1SFOI 3CC71 1VQNZ 1K8A2 3MZLB 2NVYI 1K732 2JMOA 1ZB9A 1QXFA 1Q812 4Y7NI 1Z02A 3CCMZ 3U50C 3EEDA 4RS4A 1QVGY 1QVGZ 1VQMZ 3GTGI 3CCE1 3PO3S 2E7ZA 4NBAA 3IX0A 2QA4Z 1WZNA 4BY7I 2JIQA 4Y52I 4TNUA 2B63I 3VTNA 1NJI1 4X6AI 1VQ91 3LUSA 1K83I 2NVXI 3I55Z 2JA6I 2OZKA 3HKZA 1KD11 3CC7Z 2HF1A 5C4XI 4NBEA 2VPZA 1JWHC 1S7MA 1VQ61 2V3VA 2M48A 4NBBA 1JJ2Y 1Y8CA 4A3MI 1W2BZ 4E2ZA 3CCR1 1YIT1 2AYDA 2DE5A 4AYBA 3RZDI 3CCEZ 2E9HA 1Z03A 3I07A 3IR7A 2OTL1 3JAMf 2E2HI 2JUBA 1X0TA 3I4NI 1Q862 4HH4A 1VLAA 3CPWY 3CCJ1 3CC4Z 3NH5A 2R92I 1TWFI 2QEX1 1VQL1 1QF8A 1S721 2E2II 1LQLA 4MD9A 1YI21 2P28A 3GTKI 3FKII 4RVHA 2O4HA 1VQ41 1K9M1 4A3KI 5FLXb 1VQ6Z 4RVDA 5IT9b 2JIMA 2V8JA 4E2YA 3CCRZ 2IZ3A 1K731 1YITZ 3GTLI 4RVFA 2WAQA 4NFRA 3VMIA 1Q811 3T4NB 3FQMA 1NUIA 4NB8A 2OTLZ 2YU9I 2W04A 3VMHA 2VUGA 3M4OI 2ZAEB 1QVFY 3CCJZ 4DK1A 2O53A 3FQQA 2QRCB 2QEXZ 2J6AA 3G4S1 1S72Z 1YJWZ 3G6E1 5A2Qb 5C3EI 3H3VJ 2EGTA 1YIJZ 4QTUA 1USPB 1YI2Z 4A3DI 3NH8A 4BXXI 2IV2X 2VPXA 2PK7A 3HOYI 4BY1I 1PFTA 3J80b 3HOZI 4NOZA 3GTPI 1Y1WI 1KRLA 2JS4A 4A3EI 2NAPA 3P5JB 2I3CA 5D1OA 3J81b 3S16I 2QRDB 1I3QI 4RV9A 1WW9A 1Q7Y2 3HOWI 4MD8A 1M1K2 1I6HI 1VQK1 1FDIA 2Y0SA 1VQ7Z 1I50I 2HU9A 3F3FC 2JIPA 4DQYB 3S1RI 2JIRA 4A3FI 2V45A 3H0GI 5T67A 3S2HI 3G4SZ 2M6NA 1VQO1 4NBDA 1Q861 3G6EZ 3G711 2JNYA 1TFIA 2PMZA 4HGZA 1AA6A 2OOXB 4HGYA 3S2DI 3BG0B 2PM9A 1JJ2Z 1SIWA 3S14I 1N8R2 3CQZI 2RIQA 4EWCA 1VQP1 2JA5I 2Q4ZA 2DE7A 3NDIA 3HOVI 1RO2A 3IF8A 3NH4A 3EERA 4MH4A 3CPWZ 1YUKA 5IP7I 1VQ9Z 1TWGI 5D1OB 3CCQ1 2G2KA 5T64A 5CM2M 4QTTA 1VQKZ 3GTQI 2GTHA 3S1MI 1TWCI 1VQ81 2LIYA 3S15I 3NDJA 2KPIA 2R6MA 3KIHA 4E2XA 2RT9A 2JA8I 1YHQ1 2WB1A 1VQOZ 4A3LI 2JA7I 2KI7B 1RO4A 1RNIA 3NFZA 3GKQA 3KIFA 2V8KA 3I4MI 1K8A1 4NBFA 2LEXA 1KC82 1M902 3PO2I 2R93I 5D1PA 1VQPZ 1NP6A 2DE6A 1ML8A 2NVQI 1Z01A 1QVFZ 3I561 3CME1 3D2LA 3IFUA 3D6WA 3HOXI 3TE5B 3OW2Y 1Q16A 2GU2A 1VQLZ 3TDHB 5C44I 2JR6A 1YJ91 4XX2A 1Q7Y1 2OTJ1 1Q822 1TWHI 3S1QI 1YJN1 2VF1A 3JAMb 2K5RA 1VQ4Z 3I551 3CC21 4MRIA 1YHQZ 2Q51A 2QREB 2IZ4A 5T6BA 2QLVB 2RPRA 2GTIA 1ZH1A 2RBLA 2AKLA 3CCL1 4MONA 1P9NA 3QWUA 4E30A 3CCU1 4NBGA 3VMGA 3S17I 1FDOA 1N8R1
chains in the Genus database with same CATH topology
1WIIA 4NH1C 4MD7A 3I56Z 2QR1B 3K7AI 3CMEZ 4RVGA 5AN9F 3S1NI 2F4MA 5FLXf 2R7ZI 3MZKB 2VUMI 1X3ZA 4NBCA 3CC41 1VQ51 3CCV1 4MXUA 2E2JI 3CMA1 1RLYA 3F3PC 5IT9f 3CXCY 4E32A 3CXCZ 1YJ9Z 2H85A 3CCS1 1TWAI 3GTMI 2OTJZ 3M3YI 3MONA 1YJNZ 1RO0A 3CC2Z 3ESWA 1Y1VI 1X3WA 1QYPA 3D9XA 4BBSI 4E31A 2K3RA 1NJI2 4A3JI 1ZB8A 3CD61 4NB9A 4CL1A 3CCLZ 1W2BY 2OOYB 3BG1B 3CCUZ 5A2Qf 1DL6A 4A3GI 4DGLA 3VB9A 4A3CI 4A93I 4S1TA 1KC81 1M901 4E33A 3PO3I 1KD12 2P3YA 4NBHA 3HOUI 3J80f 3GTJI 1KQSY 1KQSZ 1YUAA 4BBRI 5C4JI 1RQFA 1USPA 1VQ5Z 3Q87A 3CCVZ 1VQN1 3CMAZ 3J81f 3G71Z 1L1OC 2QKDA 3CCSZ 1YJW1 2YADA 1YIJ1 2F4OA 1WCMI 3CCM1 1Q821 3GTOI 4E2WA 1VQM1 2RHBA 5FLMI 2NVTI 2QA41 1R9TI 3CD6Z 3GCFA 3OW2Z 3CCQZ 2BJOA 5LL6f 1N2FA 3GTMS 3J7A4 4A3BI 2V8IA 1VQ8Z 1VQ71 3RZOI 2LFUA 1K9M2 1M1K1 4A3II 2W03A 5IP9I 1Y1VS 1SFOI 3CC71 1VQNZ 1K8A2 3MZLB 2NVYI 1K732 2JMOA 1ZB9A 1Q812 4Y7NI 1Z02A 3CCMZ 3U50C 3EEDA 4RS4A 1QVGY 1QVGZ 1VQMZ 3GTGI 3CCE1 3PO3S 4NBAA 3IX0A 2QA4Z 4BY7I 4Y52I 4TNUA 2B63I 3VTNA 1NJI1 4X6AI 1VQ91 3LUSA 1K83I 2NVXI 3I55Z 2JA6I 2OZKA 3HKZA 1KD11 3CC7Z 2HF1A 5C4XI 4NBEA 1JWHC 1S7MA 1VQ61 2M48A 4NBBA 1JJ2Y 4A3MI 1W2BZ 4E2ZA 3CCR1 1YIT1 2DE5A 4AYBA 3RZDI 3CCEZ 2E9HA 1Z03A 3I07A 2OTL1 3JAMf 2E2HI 2JUBA 1X0TA 3I4NI 1Q862 4HH4A 1VLAA 3CPWY 3CCJ1 3CC4Z 3NH5A 2R92I 1TWFI 2QEX1 1VQL1 1QF8A 1S721 2E2II 1LQLA 4MD9A 1YI21 2P28A 3GTKI 3FKII 4RVHA 2O4HA 1VQ41 1K9M1 4A3KI 5FLXb 1VQ6Z 4RVDA 5IT9b 1K731 2V8JA 4E2YA 3CCRZ 2IZ3A 1YITZ 3GTLI 4RVFA 2WAQA 4NFRA 3VMIA 1Q811 3T4NB 3FQMA 1NUIA 4NB8A 2OTLZ 2YU9I 2W04A 3VMHA 2VUGA 3M4OI 2ZAEB 1QVFY 3CCJZ 4DK1A 2O53A 3FQQA 2QRCB 2QEXZ 2J6AA 3G4S1 1S72Z 1YJWZ 3G6E1 5A2Qb 5C3EI 3H3VJ 2EGTA 1YIJZ 4QTUA 1USPB 1YI2Z 4A3DI 3NH8A 4BXXI 2PK7A 3HOYI 4BY1I 1PFTA 3J80b 3HOZI 4NOZA 3GTPI 1Y1WI 1KRLA 2JS4A 4A3EI 3P5JB 2I3CA 5D1OA 3J81b 3S16I 2QRDB 1I3QI 4RV9A 1WW9A 1Q7Y2 3HOWI 4MD8A 1M1K2 1I6HI 1VQK1 2Y0SA 1VQ7Z 1I50I 2HU9A 3F3FC 4DQYB 3S1RI 4A3FI 3H0GI 5T67A 3S2HI 3G4SZ 2M6NA 1VQO1 4NBDA 1Q861 3G6EZ 3G711 2JNYA 1TFIA 2PMZA 4HGZA 2OOXB 4HGYA 3S2DI 3BG0B 2PM9A 1JJ2Z 3S14I 1N8R2 3CQZI 2RIQA 4EWCA 1VQP1 2JA5I 2Q4ZA 2DE7A 3NDIA 3HOVI 1RO2A 3IF8A 3NH4A 3EERA 4MH4A 3CPWZ 1YUKA 5IP7I 1VQ9Z 1TWGI 5D1OB 3CCQ1 2G2KA 5T64A 5CM2M 4QTTA 1VQKZ 3GTQI 2GTHA 3S1MI 1TWCI 1VQ81 2LIYA 3S15I 3NDJA 2KPIA 2R6MA 3KIHA 4E2XA 2RT9A 2JA8I 1YHQ1 2WB1A 1VQOZ 4A3LI 2JA7I 2KI7B 1RO4A 1RNIA 3NFZA 3GKQA 3KIFA 2V8KA 3I4MI 1K8A1 4NBFA 1KC82 1M902 3PO2I 2R93I 5D1PA 1VQPZ 1NP6A 2DE6A 1ML8A 2NVQI 1Z01A 1QVFZ 3I561 3CME1 3IFUA 3D6WA 3HOXI 3TE5B 3OW2Y 2GU2A 1VQLZ 3TDHB 5C44I 2JR6A 1YJ91 4XX2A 1Q7Y1 2OTJ1 1Q822 1TWHI 3S1QI 1YJN1 2VF1A 3JAMb 2K5RA 1VQ4Z 3I551 3CC21 4MRIA 1YHQZ 2Q51A 2QREB 2IZ4A 5T6BA 2QLVB 2RPRA 2GTIA 1ZH1A 2RBLA 2AKLA 3CCL1 4MONA 1P9NA 3QWUA 4E30A 3CCU1 4NBGA 3VMGA 3S17I 1N8R1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 2;  1VQP 1;  1M1K 1;  1VQ4 1;  1K9M 1;  3I56 Z;  3CME Z;  3CC7 1;  1VQN Z;  1VQ6 Z;  1K8A 2;  1K73 2;  3CPW Z;  3CC4 1;  1VQ5 1;  3CCV 1;  3CMA 1;  3CXC Y;  1VQ9 Z;  1YJ9 Z;  3CXC Z;  1K73 1;  1Q81 2;  3CCR Z;  3CCQ 1;  3CCS 1;  1YIT Z;  2OTJ Z;  1VQK Z;  3CCM Z;  1Q81 1;  1YJN Z;  2OTL Z;  3CC2 Z;  1QVG Y;  1VQ8 1;  1QVG Z;  1VQM Z;  3CCE 1;  2QA4 Z;  1QVF Y;  3CCJ Z;  1YHQ 1;  1VQO Z;  1NJI 2;  2QEX Z;  3CD6 1;  3G4S 1;  1S72 Z;  1YJW Z;  3CCL Z;  3G6E 1;  1NJI 1;  1W2B Y;  1VQ9 1;  1K8A 1;  3CCU Z;  1YIJ Z;  1YI2 Z;  1KC8 2;  1M90 2;  1KC8 1;  1VQP Z;  1M90 1;  1KD1 2;  3I55 Z;  1KQS Y;  1KD1 1;  1KQS Z;  3CC7 Z;  1QVF Z;  3I56 1;  1VQ5 Z;  3CME 1;  3CCV Z;  1VQN 1;  1VQ6 1;  3CMA Z;  3G71 Z;  3OW2 Y;  1VQL Z;  3CCS Z;  1Q7Y 2;  1YJW 1;  1JJ2 Y;  1YJ9 1;  1W2B Z;  3CCR 1;  1YIJ 1;  1Q7Y 1;  1YIT 1;  2OTJ 1;  1M1K 2;  1Q82 2;  1VQK 1;  3CCM 1;  1VQ7 Z;  1YJN 1;  1Q82 1;  3CCE Z;  2OTL 1;  1VQ4 Z;  3I55 1;  3CC2 1;  1VQM 1;  1YHQ Z;  1Q86 2;  2QA4 1;  3CPW Y;  3CCJ 1;  3CD6 Z;  3CC4 Z;  3G4S Z;  1VQO 1;  1Q86 1;  3G6E Z;  3G71 1;  2QEX 1;  3OW2 Z;  1VQL 1;  3CCQ Z;  1S72 1;  3CCL 1;  1JJ2 Z;  1N8R 2;  3CCU 1;  1YI2 1;  1N8R 1;  1VQ8 Z;  1VQ7 1; 
#chains in the Genus database with same CATH topology
 1WII A;  4NH1 C;  4MD7 A;  1WJ2 A;  3I56 Z;  2QR1 B;  3K7A I;  3CME Z;  4RVG A;  5AN9 F;  3S1N I;  2F4M A;  5FLX f;  2R7Z I;  3MZK B;  2VUM I;  1X3Z A;  4NBC A;  3CC4 1;  1VQ5 1;  3CCV 1;  4MXU A;  2E2J I;  3CMA 1;  1RLY A;  3F3P C;  5IT9 f;  3CXC Y;  4E32 A;  3CXC Z;  1YJ9 Z;  2H85 A;  2VPY A;  3CCS 1;  1TWA I;  3GTM I;  2OTJ Z;  3M3Y I;  2VPW A;  3MON A;  1YJN Z;  1RO0 A;  3CC2 Z;  3ESW A;  1Y1V I;  1X3W A;  1QYP A;  3D9X A;  4BBS I;  4E31 A;  2K3R A;  1NJI 2;  4A3J I;  1ZB8 A;  3CD6 1;  4NB9 A;  4CL1 A;  3CCL Z;  1W2B Y;  2OOY B;  3BG1 B;  3CCU Z;  5A2Q f;  1DL6 A;  4A3G I;  4DGL A;  3VB9 A;  4A3C I;  4A93 I;  4S1T A;  1KC8 1;  1M90 1;  4E33 A;  3PO3 I;  1KD1 2;  2P3Y A;  4NBH A;  3HOU I;  3J80 f;  3GTJ I;  1KQS Y;  1KQS Z;  1YUA A;  4BBR I;  5C4J I;  1RQF A;  1USP A;  1VQ5 Z;  3Q87 A;  3CCV Z;  1VQN 1;  2JIO A;  3CMA Z;  3J81 f;  3G71 Z;  1L1O C;  2QKD A;  3CCS Z;  1YJW 1;  2YAD A;  1YIJ 1;  2F4O A;  1WCM I;  3CCM 1;  1Q82 1;  3GTO I;  4E2W A;  1VQM 1;  2RHB A;  5FLM I;  2NVT I;  2QA4 1;  1R9T I;  3CD6 Z;  3GCF A;  3OW2 Z;  3CCQ Z;  2BJO A;  5LL6 f;  1N2F A;  3GTM S;  3J7A 4;  4A3B I;  2V8I A;  1VQ8 Z;  1VQ7 1;  3RZO I;  2LFU A;  1K9M 2;  1M1K 1;  4A3I I;  2W03 A;  5IP9 I;  1Y1V S;  1SFO I;  3CC7 1;  1VQN Z;  1K8A 2;  3MZL B;  2NVY I;  1K73 2;  2JMO A;  1ZB9 A;  1QXF A;  1Q81 2;  4Y7N I;  1Z02 A;  3CCM Z;  3U50 C;  3EED A;  4RS4 A;  1QVG Y;  1QVG Z;  1VQM Z;  3GTG I;  3CCE 1;  3PO3 S;  2E7Z A;  4NBA A;  3IX0 A;  2QA4 Z;  1WZN A;  4BY7 I;  2JIQ A;  4Y52 I;  4TNU A;  2B63 I;  3VTN A;  1NJI 1;  4X6A I;  1VQ9 1;  3LUS A;  1K83 I;  2NVX I;  3I55 Z;  2JA6 I;  2OZK A;  3HKZ A;  1KD1 1;  3CC7 Z;  2HF1 A;  5C4X I;  4NBE A;  2VPZ A;  1JWH C;  1S7M A;  1VQ6 1;  2V3V A;  2M48 A;  4NBB A;  1JJ2 Y;  1Y8C A;  4A3M I;  1W2B Z;  4E2Z A;  3CCR 1;  1YIT 1;  2AYD A;  2DE5 A;  4AYB A;  3RZD I;  3CCE Z;  2E9H A;  1Z03 A;  3I07 A;  3IR7 A;  2OTL 1;  3JAM f;  2E2H I;  2JUB A;  1X0T A;  3I4N I;  1Q86 2;  4HH4 A;  1VLA A;  3CPW Y;  3CCJ 1;  3CC4 Z;  3NH5 A;  2R92 I;  1TWF I;  2QEX 1;  1VQL 1;  1QF8 A;  1S72 1;  2E2I I;  1LQL A;  4MD9 A;  1YI2 1;  2P28 A;  3GTK I;  3FKI I;  4RVH A;  2O4H A;  1VQ4 1;  1K9M 1;  4A3K I;  5FLX b;  1VQ6 Z;  4RVD A;  5IT9 b;  2JIM A;  2V8J A;  4E2Y A;  3CCR Z;  2IZ3 A;  1K73 1;  1YIT Z;  3GTL I;  4RVF A;  2WAQ A;  4NFR A;  3VMI A;  1Q81 1;  3T4N B;  3FQM A;  1NUI A;  4NB8 A;  2OTL Z;  2YU9 I;  2W04 A;  3VMH A;  2VUG A;  3M4O I;  2ZAE B;  1QVF Y;  3CCJ Z;  4DK1 A;  2O53 A;  3FQQ A;  2QRC B;  2QEX Z;  2J6A A;  3G4S 1;  1S72 Z;  1YJW Z;  3G6E 1;  5A2Q b;  5C3E I;  3H3V J;  2EGT A;  1YIJ Z;  4QTU A;  1USP B;  1YI2 Z;  4A3D I;  3NH8 A;  4BXX I;  2IV2 X;  2VPX A;  2PK7 A;  3HOY I;  4BY1 I;  1PFT A;  3J80 b;  3HOZ I;  4NOZ A;  3GTP I;  1Y1W I;  1KRL A;  2JS4 A;  4A3E I;  2NAP A;  3P5J B;  2I3C A;  5D1O A;  3J81 b;  3S16 I;  2QRD B;  1I3Q I;  4RV9 A;  1WW9 A;  1Q7Y 2;  3HOW I;  4MD8 A;  1M1K 2;  1I6H I;  1VQK 1;  1FDI A;  2Y0S A;  1VQ7 Z;  1I50 I;  2HU9 A;  3F3F C;  2JIP A;  4DQY B;  3S1R I;  2JIR A;  4A3F I;  2V45 A;  3H0G I;  5T67 A;  3S2H I;  3G4S Z;  2M6N A;  1VQO 1;  4NBD A;  1Q86 1;  3G6E Z;  3G71 1;  2JNY A;  1TFI A;  2PMZ A;  4HGZ A;  1AA6 A;  2OOX B;  4HGY A;  3S2D I;  3BG0 B;  2PM9 A;  1JJ2 Z;  1SIW A;  3S14 I;  1N8R 2;  3CQZ I;  2RIQ A;  4EWC A;  1VQP 1;  2JA5 I;  2Q4Z A;  2DE7 A;  3NDI A;  3HOV I;  1RO2 A;  3IF8 A;  3NH4 A;  3EER A;  4MH4 A;  3CPW Z;  1YUK A;  5IP7 I;  1VQ9 Z;  1TWG I;  5D1O B;  3CCQ 1;  2G2K A;  5T64 A;  5CM2 M;  4QTT A;  1VQK Z;  3GTQ I;  2GTH A;  3S1M I;  1TWC I;  1VQ8 1;  2LIY A;  3S15 I;  3NDJ A;  2KPI A;  2R6M A;  3KIH A;  4E2X A;  2RT9 A;  2JA8 I;  1YHQ 1;  2WB1 A;  1VQO Z;  4A3L I;  2JA7 I;  2KI7 B;  1RO4 A;  1RNI A;  3NFZ A;  3GKQ A;  3KIF A;  2V8K A;  3I4M I;  1K8A 1;  4NBF A;  2LEX A;  1KC8 2;  1M90 2;  3PO2 I;  2R93 I;  5D1P A;  1VQP Z;  1NP6 A;  2DE6 A;  1ML8 A;  2NVQ I;  1Z01 A;  1QVF Z;  3I56 1;  3CME 1;  3D2L A;  3IFU A;  3D6W A;  3HOX I;  3TE5 B;  3OW2 Y;  1Q16 A;  2GU2 A;  1VQL Z;  3TDH B;  5C44 I;  2JR6 A;  1YJ9 1;  4XX2 A;  1Q7Y 1;  2OTJ 1;  1Q82 2;  1TWH I;  3S1Q I;  1YJN 1;  2VF1 A;  3JAM b;  2K5R A;  1VQ4 Z;  3I55 1;  3CC2 1;  4MRI A;  1YHQ Z;  2Q51 A;  2QRE B;  2IZ4 A;  5T6B A;  2QLV B;  2RPR A;  2GTI A;  1ZH1 A;  2RBL A;  2AKL A;  3CCL 1;  4MON A;  1P9N A;  3QWU A;  4E30 A;  3CCU 1;  4NBG A;  3VMG A;  3S17 I;  1FDO A;  1N8R 1; 
#chains in the Genus database with same CATH homology
 1WII A;  4NH1 C;  4MD7 A;  3I56 Z;  2QR1 B;  3K7A I;  3CME Z;  4RVG A;  5AN9 F;  3S1N I;  2F4M A;  5FLX f;  2R7Z I;  3MZK B;  2VUM I;  1X3Z A;  4NBC A;  3CC4 1;  1VQ5 1;  3CCV 1;  4MXU A;  2E2J I;  3CMA 1;  1RLY A;  3F3P C;  5IT9 f;  3CXC Y;  4E32 A;  3CXC Z;  1YJ9 Z;  2H85 A;  3CCS 1;  1TWA I;  3GTM I;  2OTJ Z;  3M3Y I;  3MON A;  1YJN Z;  1RO0 A;  3CC2 Z;  3ESW A;  1Y1V I;  1X3W A;  1QYP A;  3D9X A;  4BBS I;  4E31 A;  2K3R A;  1NJI 2;  4A3J I;  1ZB8 A;  3CD6 1;  4NB9 A;  4CL1 A;  3CCL Z;  1W2B Y;  2OOY B;  3BG1 B;  3CCU Z;  5A2Q f;  1DL6 A;  4A3G I;  4DGL A;  3VB9 A;  4A3C I;  4A93 I;  4S1T A;  1KC8 1;  1M90 1;  4E33 A;  3PO3 I;  1KD1 2;  2P3Y A;  4NBH A;  3HOU I;  3J80 f;  3GTJ I;  1KQS Y;  1KQS Z;  1YUA A;  4BBR I;  5C4J I;  1RQF A;  1USP A;  1VQ5 Z;  3Q87 A;  3CCV Z;  1VQN 1;  3CMA Z;  3J81 f;  3G71 Z;  1L1O C;  2QKD A;  3CCS Z;  1YJW 1;  2YAD A;  1YIJ 1;  2F4O A;  1WCM I;  3CCM 1;  1Q82 1;  3GTO I;  4E2W A;  1VQM 1;  2RHB A;  5FLM I;  2NVT I;  2QA4 1;  1R9T I;  3CD6 Z;  3GCF A;  3OW2 Z;  3CCQ Z;  2BJO A;  5LL6 f;  1N2F A;  3GTM S;  3J7A 4;  4A3B I;  2V8I A;  1VQ8 Z;  1VQ7 1;  3RZO I;  2LFU A;  1K9M 2;  1M1K 1;  4A3I I;  2W03 A;  5IP9 I;  1Y1V S;  1SFO I;  3CC7 1;  1VQN Z;  1K8A 2;  3MZL B;  2NVY I;  1K73 2;  2JMO A;  1ZB9 A;  1Q81 2;  4Y7N I;  1Z02 A;  3CCM Z;  3U50 C;  3EED A;  4RS4 A;  1QVG Y;  1QVG Z;  1VQM Z;  3GTG I;  3CCE 1;  3PO3 S;  4NBA A;  3IX0 A;  2QA4 Z;  4BY7 I;  4Y52 I;  4TNU A;  2B63 I;  3VTN A;  1NJI 1;  4X6A I;  1VQ9 1;  3LUS A;  1K83 I;  2NVX I;  3I55 Z;  2JA6 I;  2OZK A;  3HKZ A;  1KD1 1;  3CC7 Z;  2HF1 A;  5C4X I;  4NBE A;  1JWH C;  1S7M A;  1VQ6 1;  2M48 A;  4NBB A;  1JJ2 Y;  4A3M I;  1W2B Z;  4E2Z A;  3CCR 1;  1YIT 1;  2DE5 A;  4AYB A;  3RZD I;  3CCE Z;  2E9H A;  1Z03 A;  3I07 A;  2OTL 1;  3JAM f;  2E2H I;  2JUB A;  1X0T A;  3I4N I;  1Q86 2;  4HH4 A;  1VLA A;  3CPW Y;  3CCJ 1;  3CC4 Z;  3NH5 A;  2R92 I;  1TWF I;  2QEX 1;  1VQL 1;  1QF8 A;  1S72 1;  2E2I I;  1LQL A;  4MD9 A;  1YI2 1;  2P28 A;  3GTK I;  3FKI I;  4RVH A;  2O4H A;  1VQ4 1;  1K9M 1;  4A3K I;  5FLX b;  1VQ6 Z;  4RVD A;  5IT9 b;  1K73 1;  2V8J A;  4E2Y A;  3CCR Z;  2IZ3 A;  1YIT Z;  3GTL I;  4RVF A;  2WAQ A;  4NFR A;  3VMI A;  1Q81 1;  3T4N B;  3FQM A;  1NUI A;  4NB8 A;  2OTL Z;  2YU9 I;  2W04 A;  3VMH A;  2VUG A;  3M4O I;  2ZAE B;  1QVF Y;  3CCJ Z;  4DK1 A;  2O53 A;  3FQQ A;  2QRC B;  2QEX Z;  2J6A A;  3G4S 1;  1S72 Z;  1YJW Z;  3G6E 1;  5A2Q b;  5C3E I;  3H3V J;  2EGT A;  1YIJ Z;  4QTU A;  1USP B;  1YI2 Z;  4A3D I;  3NH8 A;  4BXX I;  2PK7 A;  3HOY I;  4BY1 I;  1PFT A;  3J80 b;  3HOZ I;  4NOZ A;  3GTP I;  1Y1W I;  1KRL A;  2JS4 A;  4A3E I;  3P5J B;  2I3C A;  5D1O A;  3J81 b;  3S16 I;  2QRD B;  1I3Q I;  4RV9 A;  1WW9 A;  1Q7Y 2;  3HOW I;  4MD8 A;  1M1K 2;  1I6H I;  1VQK 1;  2Y0S A;  1VQ7 Z;  1I50 I;  2HU9 A;  3F3F C;  4DQY B;  3S1R I;  4A3F I;  3H0G I;  5T67 A;  3S2H I;  3G4S Z;  2M6N A;  1VQO 1;  4NBD A;  1Q86 1;  3G6E Z;  3G71 1;  2JNY A;  1TFI A;  2PMZ A;  4HGZ A;  2OOX B;  4HGY A;  3S2D I;  3BG0 B;  2PM9 A;  1JJ2 Z;  3S14 I;  1N8R 2;  3CQZ I;  2RIQ A;  4EWC A;  1VQP 1;  2JA5 I;  2Q4Z A;  2DE7 A;  3NDI A;  3HOV I;  1RO2 A;  3IF8 A;  3NH4 A;  3EER A;  4MH4 A;  3CPW Z;  1YUK A;  5IP7 I;  1VQ9 Z;  1TWG I;  5D1O B;  3CCQ 1;  2G2K A;  5T64 A;  5CM2 M;  4QTT A;  1VQK Z;  3GTQ I;  2GTH A;  3S1M I;  1TWC I;  1VQ8 1;  2LIY A;  3S15 I;  3NDJ A;  2KPI A;  2R6M A;  3KIH A;  4E2X A;  2RT9 A;  2JA8 I;  1YHQ 1;  2WB1 A;  1VQO Z;  4A3L I;  2JA7 I;  2KI7 B;  1RO4 A;  1RNI A;  3NFZ A;  3GKQ A;  3KIF A;  2V8K A;  3I4M I;  1K8A 1;  4NBF A;  1KC8 2;  1M90 2;  3PO2 I;  2R93 I;  5D1P A;  1VQP Z;  1NP6 A;  2DE6 A;  1ML8 A;  2NVQ I;  1Z01 A;  1QVF Z;  3I56 1;  3CME 1;  3IFU A;  3D6W A;  3HOX I;  3TE5 B;  3OW2 Y;  2GU2 A;  1VQL Z;  3TDH B;  5C44 I;  2JR6 A;  1YJ9 1;  4XX2 A;  1Q7Y 1;  2OTJ 1;  1Q82 2;  1TWH I;  3S1Q I;  1YJN 1;  2VF1 A;  3JAM b;  2K5R A;  1VQ4 Z;  3I55 1;  3CC2 1;  4MRI A;  1YHQ Z;  2Q51 A;  2QRE B;  2IZ4 A;  5T6B A;  2QLV B;  2RPR A;  2GTI A;  1ZH1 A;  2RBL A;  2AKL A;  3CCL 1;  4MON A;  1P9N A;  3QWU A;  4E30 A;  3CCU 1;  4NBG A;  3VMG A;  3S17 I;  1N8R 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...