3OW2Z

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Z00
2OTL1 2QEXZ 1K9M2 1K8A1 1NJI2 1VQO1 1VQLZ 1VQ81 3CCUZ 1S72Z 1VQKZ 1Q861 1VQ5Z 3CCJ1 1QVGY 3CMAZ 3CXCY 3CPWY 1KQSZ 1VQ61 1VQ8Z 3CC41 2QA41 3CCVZ 3CCE1 3OW2Z 1VQM1 3CCJZ 1Q821 3CME1 1Q7Y2 1VQ7Z 3CC2Z 1N8R2 3CCRZ 1K732 1VQN1 3CCQZ 3I55Z 3CCM1 3CC71 3CCMZ 1N8R1 1YI2Z 1Q7Y1 2OTLZ 1VQ91 1Q822 2OTJ1 1W2BY 1YJ9Z 1M902 2OTJZ 1VQNZ 3I56Z 1VQP1 1YIJ1 3I551 1YIJZ 3G6EZ 1K8A2 1JJ2Z 1M901 1YIT1 1K731 3CD61 1YITZ 3I561 1QVFY 1YJNZ 3G6E1 1YJN1 3CCL1 1JJ2Y 3CCLZ 1K9M1 1M1K1 3CCU1 3CCEZ 1KQSY 1VQK1 3CXCZ 3CC21 3CMA1 1YHQ1 1KD12 1VQ6Z 1Q811 3CCV1 1S721 1YJW1 3G4SZ 1VQ51 3CCS1 3G4S1 3CMEZ 1NJI1 1YHQZ 1VQL1 1YJWZ 1Q862 1VQMZ 3CCSZ 1VQ9Z 1YJ91 3G711 1KC82 3OW2Y 1VQPZ 2QA4Z 3CC4Z 3CPWZ 3CD6Z 1QVGZ 1VQ41 3G71Z 1VQ71 1QVFZ 3CCQ1 1Q812 1VQ4Z 3CC7Z 3CCR1 1YI21 2QEX1 1M1K2 1W2BZ 1KC81 1KD11 1VQOZ
chains in the Genus database with same CATH superfamily
2QEXZ 2E2II 4BY7I 1X3ZA 4BBRI 1I50I 3GTMS 3CCUZ 3VTNA 4MH4A 1VQKZ 2R6MA 5A2Qb 2AYDA 2PMZA 3CPWY 5FLXb 1VQ61 3BG0B 3CC41 4A3MI 3VB9A 4NFRA 3D2LA 3M3YI 1N2FA 2M48A 1RLYA 4NBBA 1WZNA 3CCM1 3CC71 1N8R1 1Q16A 2G2KA 2P3YA 1Q7Y1 2OTJ1 1W2BY 1QYPA 3I551 2R7ZI 2E2HI 2NVXI 3NH8A 2K3RA 1JJ2Z 3H3VJ 3EEDA 3K7AI 3GTMI 1DL6A 3VMGA 1Y8CA 2GTIA 5T64A 4RVDA 1WIIA 3HOVI 2HF1A 4E33A 3CXCZ 1Z01A 1Z02A 3NDIA 1KD12 2VPXA 1S7MA 1ML8A 3CCV1 3MZLB 2K5RA 3MONA 1ZB9A 4DGLA 3CMEZ 1NJI1 1USPA 5C4XI 3F3PC 3IX0A 1K83I 1VLAA 3G711 1KC82 1Y1VS 3P5JB 4E30A 2QA4Z 5C3EI 1YUAA 1KRLA 2JA6I 1QVGZ 3G71Z 2VPYA 3NFZA 1R9TI 3CC7Z 4Y7NI 2LIYA 2QR1B 5D1OA 1YI21 1X3WA 4E31A 2W03A 4E32A 1KC81 3BG1B 3RZOI 3VMHA 2QRCB 1SFOI 3HOWI 2WB1A 1WW9A 1K9M2 2PM9A 3VMIA 4RVHA 1VQLZ 2JA8I 1RO4A 4NH1C 3GTLI 4E2ZA 3TE5B 2JIMA 3CMAZ 2OZKA 2Q4ZA 1VQ8Z 2QA41 3MZKB 1RO0A 1TWFI 4HGYA 3CME1 5T67A 3F3FC 4NBAA 4HH4A 3J80b 2R92I 4MRIA 2JIQA 4NB9A 5CM2M 1RQFA 3CCQZ 3PO2I 3CCMZ 5C44I 4BXXI 4NBHA 3S1QI 2LFUA 1VQ91 1YJ9Z 1P9NA 3KIFA 1VQNZ 3I56Z 4X6AI 1K8A2 1M901 1L1OC 3S1NI 3CD61 2JUBA 5FLXf 5AN9F 2WAQA 1YJNZ 3S1MI 1SIWA 1ZH1A 2JMOA 1NUIA 1VQK1 4DK1A 4MONA 3CC21 4QTUA 5IP7I 1YJW1 4E2XA 1VQ51 2V3VA 3HKZA 1YHQZ 2RBLA 1LQLA 4Y52I 3J81f 4NBCA 2QKDA 2JS4A 1YJWZ 1Q862 1VQMZ 1TWHI 1VQ9Z 2QRDB 2GTHA 3IR7A 3CC4Z 4A3II 2LEXA 3S15I 4NB8A 1VQ41 1VQ71 3CCQ1 4A3CI 1TWCI 2GU2A 1PFTA 1X0TA 2V45A 4AYBA 1FDOA 3S16I 1RO2A 2KI7B 2RPRA 3JAMb 3H0GI 2QEX1 4QTTA 2NAPA 2Q51A 3FQQA 3GTGI 5IP9I 3LUSA 1QF8A 2I3CA 2ZAEB 3FKII 2W04A 2VPZA 2E7ZA 2H85A 3CCJ1 1QVGY 1ZB8A 3GTPI 3GTQI 4E2WA 4NBDA 3OW2Z 3CCJZ 1VQ7Z 2DE7A 5A2Qf 3CCRZ 2OOXB 2NVTI 3QWUA 2IV2X 5LL6f 3PO3S 3I55Z 2JIRA 1WJ2A 3Q87A 1YI2Z 1Q822 4BY1I 2OOYB 2B63I 1YIJ1 1TFIA 2VUGA 2F4MA 3G6EZ 4A3LI 2KPIA 1K731 1YITZ 3HOXI 3I07A 3I4NI 3S14I 4BBSI 2DE5A 3G6E1 5T6BA 2IZ3A 1YJN1 2PK7A 2RHBA 1YUKA 1USPB 1JJ2Y 3CCLZ 2VPWA 1K9M1 4MD7A 4MD9A 1M1K1 2O4HA 3CMA1 2RT9A 4E2YA 4MXUA 3G4SZ 2E2JI 2NVQI 2RIQA 2V8JA 3GTJI 1VQL1 3NDJA 4A3BI 4A3GI 2VF1A 1WCMI 3IFUA 2J6AA 4HGZA 3T4NB 4DQYB 3CPWZ 1QVFZ 1Q812 1VQ4Z 3I4MI 3D9XA 4TNUA 3U50C 3KIHA 5D1PA 1W2BZ 1KD11 3NH4A 4NOZA 4A3DI 1VQOZ 2YU9I 2OTL1 4RV9A 2JNYA 4RVFA 3RZDI 4RS4A 1K8A1 1NJI2 3S2HI 1VQO1 1VQ81 1I3QI 2JA5I 1S72Z 1Q861 1VQ5Z 3J80f 3GKQA 3CXCY 1KQSZ 2QREB 4RVGA 3CCVZ 2E9HA 3CCE1 2JIOA 1VQM1 4A3FI 1Q821 1Q7Y2 3EERA 3CC2Z 1N8R2 1NP6A 2AKLA 2M6NA 1K732 3TDHB 2IZ4A 2F4OA 2V8KA 1VQN1 3J7A4 4S1TA 1Y1WI 5D1OB 1QXFA 2EGTA 2Y0SA 2OTLZ 3D6WA 1M902 2OTJZ 2R93I 2BJOA 1VQP1 2DE6A 1YIJZ 2P28A 5FLMI 5C4JI 1TWAI 1YIT1 2QLVB 3I561 4NBEA 3M4OI 1Z03A 3S17I 4MD8A 4A3KI 1QVFY 2JR6A 2O53A 1AA6A 3ESWA 3CCL1 3PO3I 4NBFA 1FDIA 3HOUI 3CCU1 3CCEZ 4NBGA 4XX2A 1KQSY 4A3JI 3S2DI 1YHQ1 2JA7I 1VQ6Z 1Q811 1S721 3HOYI 3FQMA 2YADA 3CCS1 3G4S1 2V8IA 3JAMf 2NVYI 2HU9A 3CCSZ 3NH5A 4EWCA 1YJ91 3GTKI 5IT9b 3OW2Y 1VQPZ 4A93I 1TWGI 3GCFA 4A3EI 5IT9f 2JIPA 3S1RI 3IF8A 3CD6Z 3J81b 3CCR1 4CL1A 3HOZI 1I6HI 2VUMI 1M1K2 3CQZI 1JWHC 1RNIA 1Y1VI 3GTOI
chains in the Genus database with same CATH topology
2QEXZ 2E2II 4BY7I 1X3ZA 4BBRI 1I50I 3GTMS 3CCUZ 3VTNA 4MH4A 1VQKZ 2R6MA 5A2Qb 2PMZA 3CPWY 5FLXb 1VQ61 3BG0B 3CC41 4A3MI 3VB9A 4NFRA 3M3YI 1N2FA 2M48A 1RLYA 4NBBA 3CCM1 3CC71 1N8R1 2G2KA 2P3YA 1Q7Y1 2OTJ1 1W2BY 1QYPA 3I551 2R7ZI 2E2HI 2NVXI 3NH8A 2K3RA 1JJ2Z 3H3VJ 3EEDA 3K7AI 3GTMI 1DL6A 3VMGA 2GTIA 5T64A 4RVDA 1WIIA 3HOVI 2HF1A 4E33A 3CXCZ 1Z01A 1Z02A 3NDIA 1KD12 1S7MA 1ML8A 3CCV1 3MZLB 2K5RA 3MONA 1ZB9A 4DGLA 3CMEZ 1NJI1 1USPA 5C4XI 3F3PC 3IX0A 1K83I 1VLAA 3G711 1KC82 1Y1VS 3P5JB 4E30A 2QA4Z 5C3EI 1YUAA 1KRLA 2JA6I 1QVGZ 3G71Z 3NFZA 1R9TI 3CC7Z 4Y7NI 2LIYA 2QR1B 5D1OA 1YI21 1X3WA 4E31A 2W03A 4E32A 1KC81 3BG1B 3RZOI 3VMHA 2QRCB 1SFOI 3HOWI 2WB1A 1WW9A 1K9M2 2PM9A 3VMIA 4RVHA 1VQLZ 2JA8I 1RO4A 4NH1C 3GTLI 4E2ZA 3TE5B 3CMAZ 2OZKA 2Q4ZA 1VQ8Z 2QA41 3MZKB 1RO0A 1TWFI 4HGYA 3CME1 5T67A 3F3FC 4NBAA 4HH4A 3J80b 2R92I 4MRIA 4NB9A 5CM2M 1RQFA 3CCQZ 3PO2I 3CCMZ 5C44I 4BXXI 4NBHA 3S1QI 2LFUA 1VQ91 1YJ9Z 1P9NA 3KIFA 1VQNZ 3I56Z 4X6AI 1K8A2 1M901 1L1OC 3S1NI 3CD61 2JUBA 5FLXf 5AN9F 2WAQA 1YJNZ 3S1MI 1ZH1A 2JMOA 1NUIA 1VQK1 4DK1A 4MONA 3CC21 4QTUA 5IP7I 1YJW1 4E2XA 1VQ51 3HKZA 1YHQZ 2RBLA 1LQLA 4Y52I 3J81f 4NBCA 2QKDA 2JS4A 1YJWZ 1Q862 1VQMZ 1TWHI 1VQ9Z 2QRDB 2GTHA 3CC4Z 4A3II 3S15I 4NB8A 1VQ41 1VQ71 3CCQ1 4A3CI 1TWCI 2GU2A 1PFTA 1X0TA 4AYBA 3S16I 1RO2A 2KI7B 2RPRA 3JAMb 3H0GI 2QEX1 4QTTA 2Q51A 3FQQA 3GTGI 5IP9I 3LUSA 1QF8A 2I3CA 2ZAEB 3FKII 2W04A 3CCJ1 2H85A 1QVGY 1ZB8A 3GTPI 3GTQI 4E2WA 4NBDA 3OW2Z 3CCJZ 1VQ7Z 2DE7A 5A2Qf 3CCRZ 2OOXB 2NVTI 3QWUA 5LL6f 3PO3S 3I55Z 3Q87A 1YI2Z 1Q822 4BY1I 2OOYB 2B63I 1YIJ1 1TFIA 2VUGA 2F4MA 3G6EZ 4A3LI 2KPIA 1K731 1YITZ 3HOXI 3I07A 3I4NI 3S14I 4BBSI 2DE5A 3G6E1 5T6BA 2IZ3A 1YJN1 2PK7A 2RHBA 1YUKA 1USPB 1JJ2Y 3CCLZ 1K9M1 4MD7A 4MD9A 1M1K1 2O4HA 3CMA1 2RT9A 4E2YA 4MXUA 3G4SZ 2E2JI 2NVQI 2RIQA 2V8JA 3GTJI 1VQL1 3NDJA 4A3BI 4A3GI 2VF1A 1WCMI 3IFUA 2J6AA 4HGZA 3T4NB 4DQYB 3CPWZ 1QVFZ 1Q812 1VQ4Z 3I4MI 3D9XA 4TNUA 3U50C 3KIHA 5D1PA 1W2BZ 1KD11 3NH4A 4NOZA 4A3DI 1VQOZ 2YU9I 2OTL1 4RV9A 2JNYA 4RVFA 3RZDI 4RS4A 1K8A1 1NJI2 3S2HI 1VQO1 1VQ81 1I3QI 2JA5I 1S72Z 1Q861 1VQ5Z 3J80f 3GKQA 3CXCY 1KQSZ 2QREB 4RVGA 3CCVZ 2E9HA 3CCE1 1VQM1 4A3FI 1Q821 1Q7Y2 3EERA 3CC2Z 1N8R2 1NP6A 2AKLA 2M6NA 1K732 3TDHB 2IZ4A 2F4OA 2V8KA 1VQN1 3J7A4 4S1TA 1Y1WI 5D1OB 2EGTA 2Y0SA 2OTLZ 3D6WA 1M902 2OTJZ 2R93I 2BJOA 1VQP1 2DE6A 1YIJZ 2P28A 5FLMI 5C4JI 1TWAI 1YIT1 2QLVB 3I561 4NBEA 3M4OI 1Z03A 3S17I 4MD8A 4A3KI 1QVFY 2JR6A 2O53A 3ESWA 3CCL1 3PO3I 4NBFA 3HOUI 3CCU1 3CCEZ 4NBGA 4XX2A 1KQSY 4A3JI 3S2DI 1YHQ1 2JA7I 1VQ6Z 1Q811 1S721 3HOYI 3FQMA 2YADA 3CCS1 3G4S1 2V8IA 3JAMf 2NVYI 2HU9A 3CCSZ 3NH5A 4EWCA 1YJ91 3GTKI 5IT9b 3OW2Y 1VQPZ 4A93I 1TWGI 3GCFA 4A3EI 5IT9f 3S1RI 3IF8A 3CD6Z 3J81b 3CCR1 4CL1A 3HOZI 1I6HI 2VUMI 1M1K2 3CQZI 1JWHC 1RNIA 1Y1VI 3GTOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL 1;  2QEX Z;  1K9M 2;  1K8A 1;  1NJI 2;  1VQO 1;  1VQL Z;  1VQ8 1;  3CCU Z;  1S72 Z;  1VQK Z;  1Q86 1;  1VQ5 Z;  3CCJ 1;  1QVG Y;  3CMA Z;  3CXC Y;  3CPW Y;  1KQS Z;  1VQ6 1;  1VQ8 Z;  3CC4 1;  2QA4 1;  3CCV Z;  3CCE 1;  3OW2 Z;  1VQM 1;  3CCJ Z;  1Q82 1;  3CME 1;  1Q7Y 2;  1VQ7 Z;  3CC2 Z;  1N8R 2;  3CCR Z;  1K73 2;  1VQN 1;  3CCQ Z;  3I55 Z;  3CCM 1;  3CC7 1;  3CCM Z;  1N8R 1;  1YI2 Z;  1Q7Y 1;  2OTL Z;  1VQ9 1;  1Q82 2;  2OTJ 1;  1W2B Y;  1YJ9 Z;  1M90 2;  2OTJ Z;  1VQN Z;  3I56 Z;  1VQP 1;  1YIJ 1;  3I55 1;  1YIJ Z;  3G6E Z;  1K8A 2;  1JJ2 Z;  1M90 1;  1YIT 1;  1K73 1;  3CD6 1;  1YIT Z;  3I56 1;  1QVF Y;  1YJN Z;  3G6E 1;  1YJN 1;  3CCL 1;  1JJ2 Y;  3CCL Z;  1K9M 1;  1M1K 1;  3CCU 1;  3CCE Z;  1KQS Y;  1VQK 1;  3CXC Z;  3CC2 1;  3CMA 1;  1YHQ 1;  1KD1 2;  1VQ6 Z;  1Q81 1;  3CCV 1;  1S72 1;  1YJW 1;  3G4S Z;  1VQ5 1;  3CCS 1;  3G4S 1;  3CME Z;  1NJI 1;  1YHQ Z;  1VQL 1;  1YJW Z;  1Q86 2;  1VQM Z;  3CCS Z;  1VQ9 Z;  1YJ9 1;  3G71 1;  1KC8 2;  3OW2 Y;  1VQP Z;  2QA4 Z;  3CC4 Z;  3CPW Z;  3CD6 Z;  1QVG Z;  1VQ4 1;  3G71 Z;  1VQ7 1;  1QVF Z;  3CCQ 1;  1Q81 2;  1VQ4 Z;  3CC7 Z;  3CCR 1;  1YI2 1;  2QEX 1;  1M1K 2;  1W2B Z;  1KC8 1;  1KD1 1;  1VQO Z; 
#chains in the Genus database with same CATH topology
 2QEX Z;  2E2I I;  4BY7 I;  1X3Z A;  4BBR I;  1I50 I;  3GTM S;  3CCU Z;  3VTN A;  4MH4 A;  1VQK Z;  2R6M A;  5A2Q b;  2AYD A;  2PMZ A;  3CPW Y;  5FLX b;  1VQ6 1;  3BG0 B;  3CC4 1;  4A3M I;  3VB9 A;  4NFR A;  3D2L A;  3M3Y I;  1N2F A;  2M48 A;  1RLY A;  4NBB A;  1WZN A;  3CCM 1;  3CC7 1;  1N8R 1;  1Q16 A;  2G2K A;  2P3Y A;  1Q7Y 1;  2OTJ 1;  1W2B Y;  1QYP A;  3I55 1;  2R7Z I;  2E2H I;  2NVX I;  3NH8 A;  2K3R A;  1JJ2 Z;  3H3V J;  3EED A;  3K7A I;  3GTM I;  1DL6 A;  3VMG A;  1Y8C A;  2GTI A;  5T64 A;  4RVD A;  1WII A;  3HOV I;  2HF1 A;  4E33 A;  3CXC Z;  1Z01 A;  1Z02 A;  3NDI A;  1KD1 2;  2VPX A;  1S7M A;  1ML8 A;  3CCV 1;  3MZL B;  2K5R A;  3MON A;  1ZB9 A;  4DGL A;  3CME Z;  1NJI 1;  1USP A;  5C4X I;  3F3P C;  3IX0 A;  1K83 I;  1VLA A;  3G71 1;  1KC8 2;  1Y1V S;  3P5J B;  4E30 A;  2QA4 Z;  5C3E I;  1YUA A;  1KRL A;  2JA6 I;  1QVG Z;  3G71 Z;  2VPY A;  3NFZ A;  1R9T I;  3CC7 Z;  4Y7N I;  2LIY A;  2QR1 B;  5D1O A;  1YI2 1;  1X3W A;  4E31 A;  2W03 A;  4E32 A;  1KC8 1;  3BG1 B;  3RZO I;  3VMH A;  2QRC B;  1SFO I;  3HOW I;  2WB1 A;  1WW9 A;  1K9M 2;  2PM9 A;  3VMI A;  4RVH A;  1VQL Z;  2JA8 I;  1RO4 A;  4NH1 C;  3GTL I;  4E2Z A;  3TE5 B;  2JIM A;  3CMA Z;  2OZK A;  2Q4Z A;  1VQ8 Z;  2QA4 1;  3MZK B;  1RO0 A;  1TWF I;  4HGY A;  3CME 1;  5T67 A;  3F3F C;  4NBA A;  4HH4 A;  3J80 b;  2R92 I;  4MRI A;  2JIQ A;  4NB9 A;  5CM2 M;  1RQF A;  3CCQ Z;  3PO2 I;  3CCM Z;  5C44 I;  4BXX I;  4NBH A;  3S1Q I;  2LFU A;  1VQ9 1;  1YJ9 Z;  1P9N A;  3KIF A;  1VQN Z;  3I56 Z;  4X6A I;  1K8A 2;  1M90 1;  1L1O C;  3S1N I;  3CD6 1;  2JUB A;  5FLX f;  5AN9 F;  2WAQ A;  1YJN Z;  3S1M I;  1SIW A;  1ZH1 A;  2JMO A;  1NUI A;  1VQK 1;  4DK1 A;  4MON A;  3CC2 1;  4QTU A;  5IP7 I;  1YJW 1;  4E2X A;  1VQ5 1;  2V3V A;  3HKZ A;  1YHQ Z;  2RBL A;  1LQL A;  4Y52 I;  3J81 f;  4NBC A;  2QKD A;  2JS4 A;  1YJW Z;  1Q86 2;  1VQM Z;  1TWH I;  1VQ9 Z;  2QRD B;  2GTH A;  3IR7 A;  3CC4 Z;  4A3I I;  2LEX A;  3S15 I;  4NB8 A;  1VQ4 1;  1VQ7 1;  3CCQ 1;  4A3C I;  1TWC I;  2GU2 A;  1PFT A;  1X0T A;  2V45 A;  4AYB A;  1FDO A;  3S16 I;  1RO2 A;  2KI7 B;  2RPR A;  3JAM b;  3H0G I;  2QEX 1;  4QTT A;  2NAP A;  2Q51 A;  3FQQ A;  3GTG I;  5IP9 I;  3LUS A;  1QF8 A;  2I3C A;  2ZAE B;  3FKI I;  2W04 A;  2VPZ A;  2E7Z A;  2H85 A;  3CCJ 1;  1QVG Y;  1ZB8 A;  3GTP I;  3GTQ I;  4E2W A;  4NBD A;  3OW2 Z;  3CCJ Z;  1VQ7 Z;  2DE7 A;  5A2Q f;  3CCR Z;  2OOX B;  2NVT I;  3QWU A;  2IV2 X;  5LL6 f;  3PO3 S;  3I55 Z;  2JIR A;  1WJ2 A;  3Q87 A;  1YI2 Z;  1Q82 2;  4BY1 I;  2OOY B;  2B63 I;  1YIJ 1;  1TFI A;  2VUG A;  2F4M A;  3G6E Z;  4A3L I;  2KPI A;  1K73 1;  1YIT Z;  3HOX I;  3I07 A;  3I4N I;  3S14 I;  4BBS I;  2DE5 A;  3G6E 1;  5T6B A;  2IZ3 A;  1YJN 1;  2PK7 A;  2RHB A;  1YUK A;  1USP B;  1JJ2 Y;  3CCL Z;  2VPW A;  1K9M 1;  4MD7 A;  4MD9 A;  1M1K 1;  2O4H A;  3CMA 1;  2RT9 A;  4E2Y A;  4MXU A;  3G4S Z;  2E2J I;  2NVQ I;  2RIQ A;  2V8J A;  3GTJ I;  1VQL 1;  3NDJ A;  4A3B I;  4A3G I;  2VF1 A;  1WCM I;  3IFU A;  2J6A A;  4HGZ A;  3T4N B;  4DQY B;  3CPW Z;  1QVF Z;  1Q81 2;  1VQ4 Z;  3I4M I;  3D9X A;  4TNU A;  3U50 C;  3KIH A;  5D1P A;  1W2B Z;  1KD1 1;  3NH4 A;  4NOZ A;  4A3D I;  1VQO Z;  2YU9 I;  2OTL 1;  4RV9 A;  2JNY A;  4RVF A;  3RZD I;  4RS4 A;  1K8A 1;  1NJI 2;  3S2H I;  1VQO 1;  1VQ8 1;  1I3Q I;  2JA5 I;  1S72 Z;  1Q86 1;  1VQ5 Z;  3J80 f;  3GKQ A;  3CXC Y;  1KQS Z;  2QRE B;  4RVG A;  3CCV Z;  2E9H A;  3CCE 1;  2JIO A;  1VQM 1;  4A3F I;  1Q82 1;  1Q7Y 2;  3EER A;  3CC2 Z;  1N8R 2;  1NP6 A;  2AKL A;  2M6N A;  1K73 2;  3TDH B;  2IZ4 A;  2F4O A;  2V8K A;  1VQN 1;  3J7A 4;  4S1T A;  1Y1W I;  5D1O B;  1QXF A;  2EGT A;  2Y0S A;  2OTL Z;  3D6W A;  1M90 2;  2OTJ Z;  2R93 I;  2BJO A;  1VQP 1;  2DE6 A;  1YIJ Z;  2P28 A;  5FLM I;  5C4J I;  1TWA I;  1YIT 1;  2QLV B;  3I56 1;  4NBE A;  3M4O I;  1Z03 A;  3S17 I;  4MD8 A;  4A3K I;  1QVF Y;  2JR6 A;  2O53 A;  1AA6 A;  3ESW A;  3CCL 1;  3PO3 I;  4NBF A;  1FDI A;  3HOU I;  3CCU 1;  3CCE Z;  4NBG A;  4XX2 A;  1KQS Y;  4A3J I;  3S2D I;  1YHQ 1;  2JA7 I;  1VQ6 Z;  1Q81 1;  1S72 1;  3HOY I;  3FQM A;  2YAD A;  3CCS 1;  3G4S 1;  2V8I A;  3JAM f;  2NVY I;  2HU9 A;  3CCS Z;  3NH5 A;  4EWC A;  1YJ9 1;  3GTK I;  5IT9 b;  3OW2 Y;  1VQP Z;  4A93 I;  1TWG I;  3GCF A;  4A3E I;  5IT9 f;  2JIP A;  3S1R I;  3IF8 A;  3CD6 Z;  3J81 b;  3CCR 1;  4CL1 A;  3HOZ I;  1I6H I;  2VUM I;  1M1K 2;  3CQZ I;  1JWH C;  1RNI A;  1Y1V I;  3GTO I; 
#chains in the Genus database with same CATH homology
 2QEX Z;  2E2I I;  4BY7 I;  1X3Z A;  4BBR I;  1I50 I;  3GTM S;  3CCU Z;  3VTN A;  4MH4 A;  1VQK Z;  2R6M A;  5A2Q b;  2PMZ A;  3CPW Y;  5FLX b;  1VQ6 1;  3BG0 B;  3CC4 1;  4A3M I;  3VB9 A;  4NFR A;  3M3Y I;  1N2F A;  2M48 A;  1RLY A;  4NBB A;  3CCM 1;  3CC7 1;  1N8R 1;  2G2K A;  2P3Y A;  1Q7Y 1;  2OTJ 1;  1W2B Y;  1QYP A;  3I55 1;  2R7Z I;  2E2H I;  2NVX I;  3NH8 A;  2K3R A;  1JJ2 Z;  3H3V J;  3EED A;  3K7A I;  3GTM I;  1DL6 A;  3VMG A;  2GTI A;  5T64 A;  4RVD A;  1WII A;  3HOV I;  2HF1 A;  4E33 A;  3CXC Z;  1Z01 A;  1Z02 A;  3NDI A;  1KD1 2;  1S7M A;  1ML8 A;  3CCV 1;  3MZL B;  2K5R A;  3MON A;  1ZB9 A;  4DGL A;  3CME Z;  1NJI 1;  1USP A;  5C4X I;  3F3P C;  3IX0 A;  1K83 I;  1VLA A;  3G71 1;  1KC8 2;  1Y1V S;  3P5J B;  4E30 A;  2QA4 Z;  5C3E I;  1YUA A;  1KRL A;  2JA6 I;  1QVG Z;  3G71 Z;  3NFZ A;  1R9T I;  3CC7 Z;  4Y7N I;  2LIY A;  2QR1 B;  5D1O A;  1YI2 1;  1X3W A;  4E31 A;  2W03 A;  4E32 A;  1KC8 1;  3BG1 B;  3RZO I;  3VMH A;  2QRC B;  1SFO I;  3HOW I;  2WB1 A;  1WW9 A;  1K9M 2;  2PM9 A;  3VMI A;  4RVH A;  1VQL Z;  2JA8 I;  1RO4 A;  4NH1 C;  3GTL I;  4E2Z A;  3TE5 B;  3CMA Z;  2OZK A;  2Q4Z A;  1VQ8 Z;  2QA4 1;  3MZK B;  1RO0 A;  1TWF I;  4HGY A;  3CME 1;  5T67 A;  3F3F C;  4NBA A;  4HH4 A;  3J80 b;  2R92 I;  4MRI A;  4NB9 A;  5CM2 M;  1RQF A;  3CCQ Z;  3PO2 I;  3CCM Z;  5C44 I;  4BXX I;  4NBH A;  3S1Q I;  2LFU A;  1VQ9 1;  1YJ9 Z;  1P9N A;  3KIF A;  1VQN Z;  3I56 Z;  4X6A I;  1K8A 2;  1M90 1;  1L1O C;  3S1N I;  3CD6 1;  2JUB A;  5FLX f;  5AN9 F;  2WAQ A;  1YJN Z;  3S1M I;  1ZH1 A;  2JMO A;  1NUI A;  1VQK 1;  4DK1 A;  4MON A;  3CC2 1;  4QTU A;  5IP7 I;  1YJW 1;  4E2X A;  1VQ5 1;  3HKZ A;  1YHQ Z;  2RBL A;  1LQL A;  4Y52 I;  3J81 f;  4NBC A;  2QKD A;  2JS4 A;  1YJW Z;  1Q86 2;  1VQM Z;  1TWH I;  1VQ9 Z;  2QRD B;  2GTH A;  3CC4 Z;  4A3I I;  3S15 I;  4NB8 A;  1VQ4 1;  1VQ7 1;  3CCQ 1;  4A3C I;  1TWC I;  2GU2 A;  1PFT A;  1X0T A;  4AYB A;  3S16 I;  1RO2 A;  2KI7 B;  2RPR A;  3JAM b;  3H0G I;  2QEX 1;  4QTT A;  2Q51 A;  3FQQ A;  3GTG I;  5IP9 I;  3LUS A;  1QF8 A;  2I3C A;  2ZAE B;  3FKI I;  2W04 A;  3CCJ 1;  2H85 A;  1QVG Y;  1ZB8 A;  3GTP I;  3GTQ I;  4E2W A;  4NBD A;  3OW2 Z;  3CCJ Z;  1VQ7 Z;  2DE7 A;  5A2Q f;  3CCR Z;  2OOX B;  2NVT I;  3QWU A;  5LL6 f;  3PO3 S;  3I55 Z;  3Q87 A;  1YI2 Z;  1Q82 2;  4BY1 I;  2OOY B;  2B63 I;  1YIJ 1;  1TFI A;  2VUG A;  2F4M A;  3G6E Z;  4A3L I;  2KPI A;  1K73 1;  1YIT Z;  3HOX I;  3I07 A;  3I4N I;  3S14 I;  4BBS I;  2DE5 A;  3G6E 1;  5T6B A;  2IZ3 A;  1YJN 1;  2PK7 A;  2RHB A;  1YUK A;  1USP B;  1JJ2 Y;  3CCL Z;  1K9M 1;  4MD7 A;  4MD9 A;  1M1K 1;  2O4H A;  3CMA 1;  2RT9 A;  4E2Y A;  4MXU A;  3G4S Z;  2E2J I;  2NVQ I;  2RIQ A;  2V8J A;  3GTJ I;  1VQL 1;  3NDJ A;  4A3B I;  4A3G I;  2VF1 A;  1WCM I;  3IFU A;  2J6A A;  4HGZ A;  3T4N B;  4DQY B;  3CPW Z;  1QVF Z;  1Q81 2;  1VQ4 Z;  3I4M I;  3D9X A;  4TNU A;  3U50 C;  3KIH A;  5D1P A;  1W2B Z;  1KD1 1;  3NH4 A;  4NOZ A;  4A3D I;  1VQO Z;  2YU9 I;  2OTL 1;  4RV9 A;  2JNY A;  4RVF A;  3RZD I;  4RS4 A;  1K8A 1;  1NJI 2;  3S2H I;  1VQO 1;  1VQ8 1;  1I3Q I;  2JA5 I;  1S72 Z;  1Q86 1;  1VQ5 Z;  3J80 f;  3GKQ A;  3CXC Y;  1KQS Z;  2QRE B;  4RVG A;  3CCV Z;  2E9H A;  3CCE 1;  1VQM 1;  4A3F I;  1Q82 1;  1Q7Y 2;  3EER A;  3CC2 Z;  1N8R 2;  1NP6 A;  2AKL A;  2M6N A;  1K73 2;  3TDH B;  2IZ4 A;  2F4O A;  2V8K A;  1VQN 1;  3J7A 4;  4S1T A;  1Y1W I;  5D1O B;  2EGT A;  2Y0S A;  2OTL Z;  3D6W A;  1M90 2;  2OTJ Z;  2R93 I;  2BJO A;  1VQP 1;  2DE6 A;  1YIJ Z;  2P28 A;  5FLM I;  5C4J I;  1TWA I;  1YIT 1;  2QLV B;  3I56 1;  4NBE A;  3M4O I;  1Z03 A;  3S17 I;  4MD8 A;  4A3K I;  1QVF Y;  2JR6 A;  2O53 A;  3ESW A;  3CCL 1;  3PO3 I;  4NBF A;  3HOU I;  3CCU 1;  3CCE Z;  4NBG A;  4XX2 A;  1KQS Y;  4A3J I;  3S2D I;  1YHQ 1;  2JA7 I;  1VQ6 Z;  1Q81 1;  1S72 1;  3HOY I;  3FQM A;  2YAD A;  3CCS 1;  3G4S 1;  2V8I A;  3JAM f;  2NVY I;  2HU9 A;  3CCS Z;  3NH5 A;  4EWC A;  1YJ9 1;  3GTK I;  5IT9 b;  3OW2 Y;  1VQP Z;  4A93 I;  1TWG I;  3GCF A;  4A3E I;  5IT9 f;  3S1R I;  3IF8 A;  3CD6 Z;  3J81 b;  3CCR 1;  4CL1 A;  3HOZ I;  1I6H I;  2VUM I;  1M1K 2;  3CQZ I;  1JWH C;  1RNI A;  1Y1V I;  3GTO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...