1WCMI

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 4
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wcmI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wcmI02
3LUSA 4BBSI 1K83I 2YU9I 4A93I 3HOWI 1NUIA 1L1OC 1DL6A 4A3EI 2NVYI 1WW9A 3GTJI 4A3GI 3S15I 4NB9A 3GKQA 4NBDA 1WCMI 2DE6A 4NBHA 3RZOI 1RO4A 3H0GI 1I50I 3D6WA 4NBCA 2F4MA 3M4OI 1I3QI 1TWAI 3I4MI 3VMGA 5IP9I 2E2HI 2F4OA 2E2II 3S16I 5FLMI 4MH4A 3H3VJ 4QTUA 3I4NI 3FKII 2BJOA 2NVTI 3CQZI 4A3MI 3GTMI 3GTMS 4A3KI 3GTLI 3S2DI 4BY7I 3HOXI 3GTKI 3S1NI 3PO3I 3S14I 1ZB9A 4NBBA 4NBAA 2P3YA 2R93I 2KPIA 1USPB 3GTOI 4BY1I 1VLAA 3VMHA 4A3BI 2R92I 2R7ZI 5C4JI 2JNYA 2JA7I 1PFTA 4A3DI 1USPA 2K5RA 1SFOI 1I6HI 1X3WA 2JA5I 3VB9A 5C3EI 1RLYA 1N2FA 5C4XI 4QTTA 4A3II 3RZDI 3S1QI 1TWGI 1Y1VI 2AKLA 2PK7A 1Y1VS 3K7AI 2JR6A 3GTQI 1R9TI 1TWFI 3M3YI 3GTPI 4Y7NI 3PO3S 3EERA 4A3FI 3U50C 2DE5A 3HOUI 2RBLA 4NOZA 3GTGI 1QYPA 3GCFA 3ESWA 2JA8I 1ML8A 4A3CI 3S1MI 3I07A 2DE7A 4NBGA 2JS4A 4BBRI 1X3ZA 3HOZI 4NB8A 3HOVI 2HF1A 2NVXI 2B63I 5C44I 4XX2A 5CM2M 1Y1WI 4NBEA 4Y52I 3Q87A 3S17I 3S1RI 2JA6I 3HOYI 3S2HI 4BXXI 1LQLA 5IP7I 4A3JI 4A3LI 1TFIA 1ZB8A 1YUAA 4X6AI 2VUMI 3VMIA 4NBFA 2NVQI 3PO2I 2J6AA 2E2JI 1TWCI 1TWHI
chains in the Genus database with same CATH superfamily
1KC82 3CCSZ 1W2BZ 4CL1A 1NUIA 3G6E1 1L1OC 4A3EI 1W2BY 1M1K2 1WW9A 3QWUA 1VQK1 4MD9A 3S15I 2VUGA 4NB9A 3GKQA 1WCMI 2DE6A 3IFUA 1Z02A 1Q822 3CCVZ 1M901 1VQ81 3M4OI 1I3QI 3T4NB 2E2HI 2F4OA 4RVFA 2V8IA 1K8A1 3H3VJ 3J7A4 1N8R1 3IF8A 3CQZI 4A3MI 3GTMI 1QF8A 1K731 4A3KI 2Q4ZA 3CCS1 3S2DI 3GTKI 3MZKB 1ZB9A 3J81f 1Q7Y2 3CMEZ 2KPIA 1VQ4Z 1QXFA 4BY1I 4RV9A 1Q811 2RT9A 5C4JI 2JNYA 1PFTA 1ZH1A 3CCU1 3CCV1 3KIHA 4DK1A 2QR1B 2R6MA 4TNUA 4HH4A 1Y1VI 2PK7A 3CCEZ 1WJ2A 3J80f 1R9TI 1YIJZ 3M3YI 2OTLZ 4Y7NI 3GTPI 4A3FI 1KQSZ 2M48A 2RBLA 1QYPA 1KQSY 5LL6f 5FLXb 2AYDA 2E7ZA 4RVHA 3EEDA 3D2LA 4BBRI 5D1OB 2M6NA 3CME1 3HOZI 3FQQA 1VQ41 2HF1A 2B63I 1K9M1 3P5JB 1NJI2 4E30A 4EWCA 3OW2Z 1QVGZ 3OW2Y 2RHBA 1QVGY 1QVFZ 3IX0A 1ZB8A 1QVFY 2QREB 3VMIA 1WZNA 3CCE1 2J6AA 2LFUA 4BBSI 1YIJ1 1KD12 2JMOA 1YITZ 2OTL1 3VTNA 1X0TA 2JUBA 1Q862 5D1OA 3FQMA 2W03A 4NFRA 4NBHA 3CC4Z 1VQ7Z 3MZLB 3CMAZ 3D6WA 1Z03A 3CCJZ 3I4MI 3VMGA 4S1TA 5AN9F 3FKII 4E31A 3J81b 3GTLI 1VQNZ 2YADA 1YIT1 3CXCZ 3HOXI 2Q51A 1FDIA 3PO3I 2OZKA 3CXCY 4NBBA 4NBAA 2P3YA 2QA4Z 2OOYB 3HKZA 3GTOI 1VLAA 4MONA 3CC41 3JAMf 4MXUA 1Q16A 1VQ71 2PM9A 3CMA1 3J80b 1SFOI 3G4SZ 2JA5I 1S72Z 4E33A 3CCJ1 3CCLZ 2AKLA 3TDHB 2JR6A 2OOXB 3PO3S 2WB1A 3U50C 1KC81 3HOUI 1VQN1 3F3PC 1VQ5Z 1M1K1 3ESWA 2JA8I 4DGLA 2DE7A 2JIQA 2JS4A 2NAPA 3HOVI 2QA41 2E9HA 3G71Z 3NDIA 4HGZA 5C44I 3D9XA 3IR7A 1Y1WI 2QRCB 4Y52I 3S1RI 2QEXZ 1Q821 2RPRA 5A2Qb 3HOYI 3CPWZ 3G4S1 1S721 4A3LI 3CPWY 1SIWA 4E2WA 3CC7Z 2LEXA 1YUAA 4X6AI 2H85A 3CCL1 2VUMI 4NBFA 2NVQI 2QRDB 4RVGA 1TWHI 2GU2A 1FDOA 4A93I 3HOWI 2NVYI 3CCRZ 3I55Z 2W04A 4A3GI 1VQ51 2JIPA 4NBDA 1YJWZ 1Q7Y1 3G711 4RVDA 3H0GI 1I50I 2RIQA 2F4MA 4HGYA 2QEX1 3KIFA 2KI7B 2VPXA 5T6BA 5IP9I 2E2II 4MH4A 4QTUA 2V45A 3I4NI 5A2Qf 3CC71 1AA6A 2V8KA 2WAQA 3JAMb 3CCR1 3S14I 3I551 1YI2Z 2VF1A 2VPWA 3VMHA 4A3BI 1YJW1 2O4HA 2R92I 2R7ZI 2JA7I 4A3DI 1USPA 2V8JA 1NJI1 1K8A2 1RLYA 1N8R2 4A3II 3RZDI 3S1QI 1K732 1TWGI 3GTQI 2QLVB 1TWFI 3I56Z 2DE5A 1KD11 5IT9b 4MD7A 4NOZA 3GCFA 1VQOZ 4NBGA 1Q861 1WIIA 1X3ZA 1YI21 4MRIA 4NB8A 1Q812 1RQFA 2LIYA 2OTJZ 1YJNZ 5CM2M 3NH5A 3Q87A 3TE5B 4BXXI 1LQLA 3CCUZ 4A3JI 3CD6Z 1YUKA 2IV2X 4NH1C 2I3CA 3PO2I 1TWCI 3LUSA 1JWHC 1K83I 2YU9I 4E2XA 3I561 3CC2Z 4RS4A 1VQMZ 1VQ9Z 3MONA 1DL6A 3GTJI 3NDJA 2V3VA 4E32A 5IT9f 1VQO1 4DQYB 1VQLZ 1K9M2 2P28A 3RZOI 1RO0A 1RO4A 4MD8A 2OTJ1 1YJN1 5T64A 4NBCA 1TWAI 2G2KA 2GTHA 1KRLA 3S16I 5FLMI 1RNIA 2HU9A 2VPYA 2JIOA 3CD61 2BJOA 3NH4A 2NVTI 3GTMS 1RO2A 3F3FC 3NH8A 5T67A 4BY7I 1VQM1 3CC21 1VQ91 3S1NI 1YJ9Z 3CCMZ 1Y8CA 2R93I 2VPZA 1VQL1 1USPB 4E2ZA 4E2YA 2GTIA 5D1PA 2JIMA 2JIRA 1VQPZ 2K5RA 2O53A 1NP6A 1I6HI 1X3WA 1YHQZ 3VB9A 5C3EI 2IZ4A 1VQ6Z 2EGTA 1N2FA 5C4XI 4QTTA 3BG1B 3CCQZ 1Z01A 1Y1VS 3K7AI 3NFZA 3EERA 3G6EZ 1VQKZ 1P9NA 3GTGI 2ZAEB 1ML8A 1M902 1YJ91 4A3CI 3S1MI 3CCM1 3I07A 1S7MA 2IZ3A 2NVXI 4AYBA 1JJ2Z 4XX2A 4NBEA 1VQ8Z 2QKDA 1JJ2Y 1VQP1 3S17I 2JA6I 5FLXf 1YHQ1 3S2HI 5IP7I 1VQ61 2Y0SA 1TFIA 2PMZA 3BG0B 3CCQ1 2K3RA 2E2JI
chains in the Genus database with same CATH topology
1KC82 3CCSZ 1W2BZ 4CL1A 1NUIA 3G6E1 1L1OC 4A3EI 1W2BY 1M1K2 1WW9A 3QWUA 1VQK1 4MD9A 3S15I 2VUGA 4NB9A 3GKQA 1WCMI 2DE6A 3IFUA 1Z02A 1Q822 3CCVZ 1M901 1VQ81 3M4OI 1I3QI 3T4NB 2E2HI 2F4OA 4RVFA 2V8IA 1K8A1 3H3VJ 3J7A4 1N8R1 3IF8A 3CQZI 4A3MI 3GTMI 1QF8A 1K731 4A3KI 2Q4ZA 3CCS1 3S2DI 3GTKI 3MZKB 1ZB9A 3J81f 1Q7Y2 3CMEZ 2KPIA 1VQ4Z 4BY1I 4RV9A 1Q811 2RT9A 5C4JI 2JNYA 1PFTA 1ZH1A 3CCU1 3CCV1 3KIHA 4DK1A 2QR1B 2R6MA 4TNUA 4HH4A 1Y1VI 2PK7A 3CCEZ 3J80f 1R9TI 1YIJZ 3M3YI 2OTLZ 4Y7NI 3GTPI 4A3FI 1KQSZ 2M48A 2RBLA 1QYPA 1KQSY 5LL6f 5FLXb 4RVHA 3EEDA 4BBRI 5D1OB 2M6NA 3CME1 3HOZI 3FQQA 1VQ41 2HF1A 2B63I 1K9M1 3P5JB 1NJI2 4E30A 4EWCA 3OW2Z 1QVGZ 3OW2Y 2RHBA 1QVGY 1QVFZ 3IX0A 1ZB8A 1QVFY 2QREB 3VMIA 3CCE1 2J6AA 2LFUA 4BBSI 1YIJ1 1KD12 2JMOA 1YITZ 2OTL1 3VTNA 1X0TA 2JUBA 1Q862 5D1OA 3FQMA 2W03A 4NFRA 4NBHA 3CC4Z 1VQ7Z 3MZLB 3CMAZ 3D6WA 1Z03A 3CCJZ 3I4MI 3VMGA 4S1TA 5AN9F 3FKII 4E31A 3J81b 3GTLI 1VQNZ 2YADA 1YIT1 3CXCZ 3HOXI 2Q51A 3PO3I 2OZKA 3CXCY 4NBBA 4NBAA 2P3YA 2QA4Z 2OOYB 3HKZA 3GTOI 1VLAA 4MONA 3CC41 3JAMf 4MXUA 1VQ71 2PM9A 3CMA1 3J80b 1SFOI 3G4SZ 2JA5I 1S72Z 4E33A 3CCJ1 3CCLZ 2AKLA 3TDHB 2JR6A 2OOXB 3PO3S 2WB1A 3U50C 1KC81 3HOUI 1VQN1 3F3PC 1VQ5Z 1M1K1 3ESWA 2JA8I 4DGLA 2DE7A 2JS4A 3HOVI 2QA41 2E9HA 3G71Z 3NDIA 4HGZA 5C44I 3D9XA 1Y1WI 2QRCB 4Y52I 3S1RI 2QEXZ 1Q821 2RPRA 5A2Qb 3HOYI 3CPWZ 3G4S1 1S721 4A3LI 3CPWY 4E2WA 3CC7Z 1YUAA 4X6AI 2H85A 3CCL1 2VUMI 4NBFA 2NVQI 2QRDB 4RVGA 1TWHI 2GU2A 4A93I 3HOWI 2NVYI 3CCRZ 3I55Z 2W04A 4A3GI 1VQ51 4NBDA 1YJWZ 1Q7Y1 3G711 4RVDA 3H0GI 1I50I 2RIQA 2F4MA 4HGYA 2QEX1 3KIFA 2KI7B 5T6BA 5IP9I 2E2II 4MH4A 4QTUA 3I4NI 5A2Qf 3CC71 2V8KA 2WAQA 3JAMb 3CCR1 3S14I 3I551 1YI2Z 2VF1A 3VMHA 4A3BI 1YJW1 2O4HA 2R92I 2R7ZI 2JA7I 4A3DI 1USPA 2V8JA 1NJI1 1K8A2 1RLYA 1N8R2 4A3II 3RZDI 3S1QI 1K732 1TWGI 3GTQI 2QLVB 1TWFI 3I56Z 2DE5A 1KD11 5IT9b 4MD7A 4NOZA 3GCFA 1VQOZ 4NBGA 1Q861 1WIIA 1X3ZA 1YI21 4MRIA 4NB8A 1Q812 1RQFA 2LIYA 2OTJZ 1YJNZ 5CM2M 3NH5A 3Q87A 3TE5B 4BXXI 1LQLA 3CCUZ 4A3JI 3CD6Z 1YUKA 4NH1C 2I3CA 3PO2I 1TWCI 3LUSA 1JWHC 1K83I 2YU9I 4E2XA 3I561 3CC2Z 4RS4A 1VQMZ 1VQ9Z 3MONA 1DL6A 3GTJI 3NDJA 4E32A 5IT9f 1VQO1 4DQYB 1VQLZ 1K9M2 2P28A 3RZOI 1RO0A 1RO4A 4MD8A 2OTJ1 1YJN1 5T64A 4NBCA 1TWAI 2G2KA 2GTHA 1KRLA 3S16I 5FLMI 1RNIA 2HU9A 3CD61 2BJOA 3NH4A 2NVTI 3GTMS 1RO2A 3F3FC 3NH8A 5T67A 4BY7I 1VQM1 3CC21 1VQ91 3S1NI 1YJ9Z 3CCMZ 2R93I 1VQL1 1USPB 4E2ZA 4E2YA 2GTIA 5D1PA 1VQPZ 2K5RA 2O53A 1NP6A 1I6HI 1X3WA 1YHQZ 3VB9A 5C3EI 2IZ4A 1VQ6Z 2EGTA 1N2FA 5C4XI 4QTTA 3BG1B 3CCQZ 1Z01A 1Y1VS 3K7AI 3NFZA 3EERA 3G6EZ 1VQKZ 1P9NA 3GTGI 2ZAEB 1ML8A 1M902 1YJ91 4A3CI 3S1MI 3I07A 3CCM1 1S7MA 2IZ3A 2NVXI 4AYBA 1JJ2Z 4XX2A 4NBEA 1VQ8Z 2QKDA 1JJ2Y 1VQP1 3S17I 2JA6I 5FLXf 1YHQ1 3S2HI 5IP7I 1VQ61 2Y0SA 1TFIA 2PMZA 3BG0B 3CCQ1 2K3RA 2E2JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUS A;  4BBS I;  1K83 I;  2YU9 I;  4A93 I;  3HOW I;  1NUI A;  1L1O C;  1DL6 A;  4A3E I;  2NVY I;  1WW9 A;  3GTJ I;  4A3G I;  3S15 I;  4NB9 A;  3GKQ A;  4NBD A;  1WCM I;  2DE6 A;  4NBH A;  3RZO I;  1RO4 A;  3H0G I;  1I50 I;  3D6W A;  4NBC A;  2F4M A;  3M4O I;  1I3Q I;  1TWA I;  3I4M I;  3VMG A;  5IP9 I;  2E2H I;  2F4O A;  2E2I I;  3S16 I;  5FLM I;  4MH4 A;  3H3V J;  4QTU A;  3I4N I;  3FKI I;  2BJO A;  2NVT I;  3CQZ I;  4A3M I;  3GTM I;  3GTM S;  4A3K I;  3GTL I;  3S2D I;  4BY7 I;  3HOX I;  3GTK I;  3S1N I;  3PO3 I;  3S14 I;  1ZB9 A;  4NBB A;  4NBA A;  2P3Y A;  2R93 I;  2KPI A;  1USP B;  3GTO I;  4BY1 I;  1VLA A;  3VMH A;  4A3B I;  2R92 I;  2R7Z I;  5C4J I;  2JNY A;  2JA7 I;  1PFT A;  4A3D I;  1USP A;  2K5R A;  1SFO I;  1I6H I;  1X3W A;  2JA5 I;  3VB9 A;  5C3E I;  1RLY A;  1N2F A;  5C4X I;  4QTT A;  4A3I I;  3RZD I;  3S1Q I;  1TWG I;  1Y1V I;  2AKL A;  2PK7 A;  1Y1V S;  3K7A I;  2JR6 A;  3GTQ I;  1R9T I;  1TWF I;  3M3Y I;  3GTP I;  4Y7N I;  3PO3 S;  3EER A;  4A3F I;  3U50 C;  2DE5 A;  3HOU I;  2RBL A;  4NOZ A;  3GTG I;  1QYP A;  3GCF A;  3ESW A;  2JA8 I;  1ML8 A;  4A3C I;  3S1M I;  3I07 A;  2DE7 A;  4NBG A;  2JS4 A;  4BBR I;  1X3Z A;  3HOZ I;  4NB8 A;  3HOV I;  2HF1 A;  2NVX I;  2B63 I;  5C44 I;  4XX2 A;  5CM2 M;  1Y1W I;  4NBE A;  4Y52 I;  3Q87 A;  3S17 I;  3S1R I;  2JA6 I;  3HOY I;  3S2H I;  4BXX I;  1LQL A;  5IP7 I;  4A3J I;  4A3L I;  1TFI A;  1ZB8 A;  1YUA A;  4X6A I;  2VUM I;  3VMI A;  4NBF A;  2NVQ I;  3PO2 I;  2J6A A;  2E2J I;  1TWC I;  1TWH I; 
#chains in the Genus database with same CATH topology
 1KC8 2;  3CCS Z;  1W2B Z;  4CL1 A;  1NUI A;  3G6E 1;  1L1O C;  4A3E I;  1W2B Y;  1M1K 2;  1WW9 A;  3QWU A;  1VQK 1;  4MD9 A;  3S15 I;  2VUG A;  4NB9 A;  3GKQ A;  1WCM I;  2DE6 A;  3IFU A;  1Z02 A;  1Q82 2;  3CCV Z;  1M90 1;  1VQ8 1;  3M4O I;  1I3Q I;  3T4N B;  2E2H I;  2F4O A;  4RVF A;  2V8I A;  1K8A 1;  3H3V J;  3J7A 4;  1N8R 1;  3IF8 A;  3CQZ I;  4A3M I;  3GTM I;  1QF8 A;  1K73 1;  4A3K I;  2Q4Z A;  3CCS 1;  3S2D I;  3GTK I;  3MZK B;  1ZB9 A;  3J81 f;  1Q7Y 2;  3CME Z;  2KPI A;  1VQ4 Z;  1QXF A;  4BY1 I;  4RV9 A;  1Q81 1;  2RT9 A;  5C4J I;  2JNY A;  1PFT A;  1ZH1 A;  3CCU 1;  3CCV 1;  3KIH A;  4DK1 A;  2QR1 B;  2R6M A;  4TNU A;  4HH4 A;  1Y1V I;  2PK7 A;  3CCE Z;  1WJ2 A;  3J80 f;  1R9T I;  1YIJ Z;  3M3Y I;  2OTL Z;  4Y7N I;  3GTP I;  4A3F I;  1KQS Z;  2M48 A;  2RBL A;  1QYP A;  1KQS Y;  5LL6 f;  5FLX b;  2AYD A;  2E7Z A;  4RVH A;  3EED A;  3D2L A;  4BBR I;  5D1O B;  2M6N A;  3CME 1;  3HOZ I;  3FQQ A;  1VQ4 1;  2HF1 A;  2B63 I;  1K9M 1;  3P5J B;  1NJI 2;  4E30 A;  4EWC A;  3OW2 Z;  1QVG Z;  3OW2 Y;  2RHB A;  1QVG Y;  1QVF Z;  3IX0 A;  1ZB8 A;  1QVF Y;  2QRE B;  3VMI A;  1WZN A;  3CCE 1;  2J6A A;  2LFU A;  4BBS I;  1YIJ 1;  1KD1 2;  2JMO A;  1YIT Z;  2OTL 1;  3VTN A;  1X0T A;  2JUB A;  1Q86 2;  5D1O A;  3FQM A;  2W03 A;  4NFR A;  4NBH A;  3CC4 Z;  1VQ7 Z;  3MZL B;  3CMA Z;  3D6W A;  1Z03 A;  3CCJ Z;  3I4M I;  3VMG A;  4S1T A;  5AN9 F;  3FKI I;  4E31 A;  3J81 b;  3GTL I;  1VQN Z;  2YAD A;  1YIT 1;  3CXC Z;  3HOX I;  2Q51 A;  1FDI A;  3PO3 I;  2OZK A;  3CXC Y;  4NBB A;  4NBA A;  2P3Y A;  2QA4 Z;  2OOY B;  3HKZ A;  3GTO I;  1VLA A;  4MON A;  3CC4 1;  3JAM f;  4MXU A;  1Q16 A;  1VQ7 1;  2PM9 A;  3CMA 1;  3J80 b;  1SFO I;  3G4S Z;  2JA5 I;  1S72 Z;  4E33 A;  3CCJ 1;  3CCL Z;  2AKL A;  3TDH B;  2JR6 A;  2OOX B;  3PO3 S;  2WB1 A;  3U50 C;  1KC8 1;  3HOU I;  1VQN 1;  3F3P C;  1VQ5 Z;  1M1K 1;  3ESW A;  2JA8 I;  4DGL A;  2DE7 A;  2JIQ A;  2JS4 A;  2NAP A;  3HOV I;  2QA4 1;  2E9H A;  3G71 Z;  3NDI A;  4HGZ A;  5C44 I;  3D9X A;  3IR7 A;  1Y1W I;  2QRC B;  4Y52 I;  3S1R I;  2QEX Z;  1Q82 1;  2RPR A;  5A2Q b;  3HOY I;  3CPW Z;  3G4S 1;  1S72 1;  4A3L I;  3CPW Y;  1SIW A;  4E2W A;  3CC7 Z;  2LEX A;  1YUA A;  4X6A I;  2H85 A;  3CCL 1;  2VUM I;  4NBF A;  2NVQ I;  2QRD B;  4RVG A;  1TWH I;  2GU2 A;  1FDO A;  4A93 I;  3HOW I;  2NVY I;  3CCR Z;  3I55 Z;  2W04 A;  4A3G I;  1VQ5 1;  2JIP A;  4NBD A;  1YJW Z;  1Q7Y 1;  3G71 1;  4RVD A;  3H0G I;  1I50 I;  2RIQ A;  2F4M A;  4HGY A;  2QEX 1;  3KIF A;  2KI7 B;  2VPX A;  5T6B A;  5IP9 I;  2E2I I;  4MH4 A;  4QTU A;  2V45 A;  3I4N I;  5A2Q f;  3CC7 1;  1AA6 A;  2V8K A;  2WAQ A;  3JAM b;  3CCR 1;  3S14 I;  3I55 1;  1YI2 Z;  2VF1 A;  2VPW A;  3VMH A;  4A3B I;  1YJW 1;  2O4H A;  2R92 I;  2R7Z I;  2JA7 I;  4A3D I;  1USP A;  2V8J A;  1NJI 1;  1K8A 2;  1RLY A;  1N8R 2;  4A3I I;  3RZD I;  3S1Q I;  1K73 2;  1TWG I;  3GTQ I;  2QLV B;  1TWF I;  3I56 Z;  2DE5 A;  1KD1 1;  5IT9 b;  4MD7 A;  4NOZ A;  3GCF A;  1VQO Z;  4NBG A;  1Q86 1;  1WII A;  1X3Z A;  1YI2 1;  4MRI A;  4NB8 A;  1Q81 2;  1RQF A;  2LIY A;  2OTJ Z;  1YJN Z;  5CM2 M;  3NH5 A;  3Q87 A;  3TE5 B;  4BXX I;  1LQL A;  3CCU Z;  4A3J I;  3CD6 Z;  1YUK A;  2IV2 X;  4NH1 C;  2I3C A;  3PO2 I;  1TWC I;  3LUS A;  1JWH C;  1K83 I;  2YU9 I;  4E2X A;  3I56 1;  3CC2 Z;  4RS4 A;  1VQM Z;  1VQ9 Z;  3MON A;  1DL6 A;  3GTJ I;  3NDJ A;  2V3V A;  4E32 A;  5IT9 f;  1VQO 1;  4DQY B;  1VQL Z;  1K9M 2;  2P28 A;  3RZO I;  1RO0 A;  1RO4 A;  4MD8 A;  2OTJ 1;  1YJN 1;  5T64 A;  4NBC A;  1TWA I;  2G2K A;  2GTH A;  1KRL A;  3S16 I;  5FLM I;  1RNI A;  2HU9 A;  2VPY A;  2JIO A;  3CD6 1;  2BJO A;  3NH4 A;  2NVT I;  3GTM S;  1RO2 A;  3F3F C;  3NH8 A;  5T67 A;  4BY7 I;  1VQM 1;  3CC2 1;  1VQ9 1;  3S1N I;  1YJ9 Z;  3CCM Z;  1Y8C A;  2R93 I;  2VPZ A;  1VQL 1;  1USP B;  4E2Z A;  4E2Y A;  2GTI A;  5D1P A;  2JIM A;  2JIR A;  1VQP Z;  2K5R A;  2O53 A;  1NP6 A;  1I6H I;  1X3W A;  1YHQ Z;  3VB9 A;  5C3E I;  2IZ4 A;  1VQ6 Z;  2EGT A;  1N2F A;  5C4X I;  4QTT A;  3BG1 B;  3CCQ Z;  1Z01 A;  1Y1V S;  3K7A I;  3NFZ A;  3EER A;  3G6E Z;  1VQK Z;  1P9N A;  3GTG I;  2ZAE B;  1ML8 A;  1M90 2;  1YJ9 1;  4A3C I;  3S1M I;  3CCM 1;  3I07 A;  1S7M A;  2IZ3 A;  2NVX I;  4AYB A;  1JJ2 Z;  4XX2 A;  4NBE A;  1VQ8 Z;  2QKD A;  1JJ2 Y;  1VQP 1;  3S17 I;  2JA6 I;  5FLX f;  1YHQ 1;  3S2H I;  5IP7 I;  1VQ6 1;  2Y0S A;  1TFI A;  2PMZ A;  3BG0 B;  3CCQ 1;  2K3R A;  2E2J I; 
#chains in the Genus database with same CATH homology
 1KC8 2;  3CCS Z;  1W2B Z;  4CL1 A;  1NUI A;  3G6E 1;  1L1O C;  4A3E I;  1W2B Y;  1M1K 2;  1WW9 A;  3QWU A;  1VQK 1;  4MD9 A;  3S15 I;  2VUG A;  4NB9 A;  3GKQ A;  1WCM I;  2DE6 A;  3IFU A;  1Z02 A;  1Q82 2;  3CCV Z;  1M90 1;  1VQ8 1;  3M4O I;  1I3Q I;  3T4N B;  2E2H I;  2F4O A;  4RVF A;  2V8I A;  1K8A 1;  3H3V J;  3J7A 4;  1N8R 1;  3IF8 A;  3CQZ I;  4A3M I;  3GTM I;  1QF8 A;  1K73 1;  4A3K I;  2Q4Z A;  3CCS 1;  3S2D I;  3GTK I;  3MZK B;  1ZB9 A;  3J81 f;  1Q7Y 2;  3CME Z;  2KPI A;  1VQ4 Z;  4BY1 I;  4RV9 A;  1Q81 1;  2RT9 A;  5C4J I;  2JNY A;  1PFT A;  1ZH1 A;  3CCU 1;  3CCV 1;  3KIH A;  4DK1 A;  2QR1 B;  2R6M A;  4TNU A;  4HH4 A;  1Y1V I;  2PK7 A;  3CCE Z;  3J80 f;  1R9T I;  1YIJ Z;  3M3Y I;  2OTL Z;  4Y7N I;  3GTP I;  4A3F I;  1KQS Z;  2M48 A;  2RBL A;  1QYP A;  1KQS Y;  5LL6 f;  5FLX b;  4RVH A;  3EED A;  4BBR I;  5D1O B;  2M6N A;  3CME 1;  3HOZ I;  3FQQ A;  1VQ4 1;  2HF1 A;  2B63 I;  1K9M 1;  3P5J B;  1NJI 2;  4E30 A;  4EWC A;  3OW2 Z;  1QVG Z;  3OW2 Y;  2RHB A;  1QVG Y;  1QVF Z;  3IX0 A;  1ZB8 A;  1QVF Y;  2QRE B;  3VMI A;  3CCE 1;  2J6A A;  2LFU A;  4BBS I;  1YIJ 1;  1KD1 2;  2JMO A;  1YIT Z;  2OTL 1;  3VTN A;  1X0T A;  2JUB A;  1Q86 2;  5D1O A;  3FQM A;  2W03 A;  4NFR A;  4NBH A;  3CC4 Z;  1VQ7 Z;  3MZL B;  3CMA Z;  3D6W A;  1Z03 A;  3CCJ Z;  3I4M I;  3VMG A;  4S1T A;  5AN9 F;  3FKI I;  4E31 A;  3J81 b;  3GTL I;  1VQN Z;  2YAD A;  1YIT 1;  3CXC Z;  3HOX I;  2Q51 A;  3PO3 I;  2OZK A;  3CXC Y;  4NBB A;  4NBA A;  2P3Y A;  2QA4 Z;  2OOY B;  3HKZ A;  3GTO I;  1VLA A;  4MON A;  3CC4 1;  3JAM f;  4MXU A;  1VQ7 1;  2PM9 A;  3CMA 1;  3J80 b;  1SFO I;  3G4S Z;  2JA5 I;  1S72 Z;  4E33 A;  3CCJ 1;  3CCL Z;  2AKL A;  3TDH B;  2JR6 A;  2OOX B;  3PO3 S;  2WB1 A;  3U50 C;  1KC8 1;  3HOU I;  1VQN 1;  3F3P C;  1VQ5 Z;  1M1K 1;  3ESW A;  2JA8 I;  4DGL A;  2DE7 A;  2JS4 A;  3HOV I;  2QA4 1;  2E9H A;  3G71 Z;  3NDI A;  4HGZ A;  5C44 I;  3D9X A;  1Y1W I;  2QRC B;  4Y52 I;  3S1R I;  2QEX Z;  1Q82 1;  2RPR A;  5A2Q b;  3HOY I;  3CPW Z;  3G4S 1;  1S72 1;  4A3L I;  3CPW Y;  4E2W A;  3CC7 Z;  1YUA A;  4X6A I;  2H85 A;  3CCL 1;  2VUM I;  4NBF A;  2NVQ I;  2QRD B;  4RVG A;  1TWH I;  2GU2 A;  4A93 I;  3HOW I;  2NVY I;  3CCR Z;  3I55 Z;  2W04 A;  4A3G I;  1VQ5 1;  4NBD A;  1YJW Z;  1Q7Y 1;  3G71 1;  4RVD A;  3H0G I;  1I50 I;  2RIQ A;  2F4M A;  4HGY A;  2QEX 1;  3KIF A;  2KI7 B;  5T6B A;  5IP9 I;  2E2I I;  4MH4 A;  4QTU A;  3I4N I;  5A2Q f;  3CC7 1;  2V8K A;  2WAQ A;  3JAM b;  3CCR 1;  3S14 I;  3I55 1;  1YI2 Z;  2VF1 A;  3VMH A;  4A3B I;  1YJW 1;  2O4H A;  2R92 I;  2R7Z I;  2JA7 I;  4A3D I;  1USP A;  2V8J A;  1NJI 1;  1K8A 2;  1RLY A;  1N8R 2;  4A3I I;  3RZD I;  3S1Q I;  1K73 2;  1TWG I;  3GTQ I;  2QLV B;  1TWF I;  3I56 Z;  2DE5 A;  1KD1 1;  5IT9 b;  4MD7 A;  4NOZ A;  3GCF A;  1VQO Z;  4NBG A;  1Q86 1;  1WII A;  1X3Z A;  1YI2 1;  4MRI A;  4NB8 A;  1Q81 2;  1RQF A;  2LIY A;  2OTJ Z;  1YJN Z;  5CM2 M;  3NH5 A;  3Q87 A;  3TE5 B;  4BXX I;  1LQL A;  3CCU Z;  4A3J I;  3CD6 Z;  1YUK A;  4NH1 C;  2I3C A;  3PO2 I;  1TWC I;  3LUS A;  1JWH C;  1K83 I;  2YU9 I;  4E2X A;  3I56 1;  3CC2 Z;  4RS4 A;  1VQM Z;  1VQ9 Z;  3MON A;  1DL6 A;  3GTJ I;  3NDJ A;  4E32 A;  5IT9 f;  1VQO 1;  4DQY B;  1VQL Z;  1K9M 2;  2P28 A;  3RZO I;  1RO0 A;  1RO4 A;  4MD8 A;  2OTJ 1;  1YJN 1;  5T64 A;  4NBC A;  1TWA I;  2G2K A;  2GTH A;  1KRL A;  3S16 I;  5FLM I;  1RNI A;  2HU9 A;  3CD6 1;  2BJO A;  3NH4 A;  2NVT I;  3GTM S;  1RO2 A;  3F3F C;  3NH8 A;  5T67 A;  4BY7 I;  1VQM 1;  3CC2 1;  1VQ9 1;  3S1N I;  1YJ9 Z;  3CCM Z;  2R93 I;  1VQL 1;  1USP B;  4E2Z A;  4E2Y A;  2GTI A;  5D1P A;  1VQP Z;  2K5R A;  2O53 A;  1NP6 A;  1I6H I;  1X3W A;  1YHQ Z;  3VB9 A;  5C3E I;  2IZ4 A;  1VQ6 Z;  2EGT A;  1N2F A;  5C4X I;  4QTT A;  3BG1 B;  3CCQ Z;  1Z01 A;  1Y1V S;  3K7A I;  3NFZ A;  3EER A;  3G6E Z;  1VQK Z;  1P9N A;  3GTG I;  2ZAE B;  1ML8 A;  1M90 2;  1YJ9 1;  4A3C I;  3S1M I;  3I07 A;  3CCM 1;  1S7M A;  2IZ3 A;  2NVX I;  4AYB A;  1JJ2 Z;  4XX2 A;  4NBE A;  1VQ8 Z;  2QKD A;  1JJ2 Y;  1VQP 1;  3S17 I;  2JA6 I;  5FLX f;  1YHQ 1;  3S2H I;  5IP7 I;  1VQ6 1;  2Y0S A;  1TFI A;  2PMZ A;  3BG0 B;  3CCQ 1;  2K3R A;  2E2J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...