1WCMI

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 4
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wcmI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wcmI02
1I50I 4A3MI 3HOZI 3S14I 3K7AI 2B63I 4BY1I 2NVTI 1VLAA 2P3YA 1TWHI 1TFIA 4A93I 2VUMI 1RO4A 4MH4A 1RLYA 2NVYI 3HOVI 2J6AA 4BY7I 4NBEA 3S2DI 3H3VJ 1LQLA 2K5RA 3GTJI 1QYPA 3D6WA 2DE5A 3S16I 3LUSA 1Y1WI 1L1OC 1USPA 3I07A 4BXXI 4X6AI 2R7ZI 2RBLA 4NBCA 2E2II 2YU9I 4A3CI 3GTPI 2E2HI 3PO3S 1N2FA 3FKII 3GTOI 3HOUI 3S1MI 2NVQI 1I3QI 1PFTA 3VB9A 4NBFA 4NB9A 4NBGA 1WW9A 3M4OI 3GKQA 3HOYI 5C44I 2AKLA 4BBSI 4A3DI 4NB8A 4QTUA 4BBRI 4Y7NI 3PO2I 3PO3I 1ZB9A 1USPB 3HOWI 4NBHA 3S17I 4NBAA 3GTLI 2KPIA 2JA7I 2DE7A 4XX2A 3S15I 1K83I 3S1QI 1TWFI 2R92I 4A3GI 2JR6A 4A3EI 3I4MI 2F4OA 5IP9I 1ML8A 1YUAA 4A3II 5CM2M 1X3WA 3M3YI 2F4MA 2NVXI 5FLMI 5C3EI 1Y1VS 1TWGI 2JA6I 3GTKI 3GTGI 1ZB8A 3H0GI 4NOZA 2DE6A 1X3ZA 3I4NI 2HF1A 2PK7A 3S1RI 1I6HI 2JA8I 3HOXI 1Y1VI 4NBBA 2JNYA 3Q87A 2JS4A 4A3JI 4A3KI 3RZDI 5C4XI 1TWAI 1NUIA 3ESWA 2E2JI 4A3LI 4A3BI 3GTMS 3GTQI 4NBDA 1R9TI 4Y52I 1DL6A 5C4JI 3S2HI 2R93I 3GCFA 4A3FI 3VMHA 3S1NI 2JA5I 1WCMI 3RZOI 1TWCI 5IP7I 3VMGA 1SFOI 3CQZI 2BJOA 3EERA 3U50C 3GTMI 3VMIA 4QTTA
chains in the Genus database with same CATH superfamily
1NP6A 1Z03A 1QVFZ 3I56Z 3JAMf 2K3RA 3G6EZ 1Z01A 1VQO1 2QEXZ 4HGYA 3HKZA 1AA6A 1K8A2 3CCSZ 1VQ7Z 1QYPA 4NFRA 1VQ9Z 4HH4A 1N8R1 3LUSA 1Q822 1USPA 4X6AI 3JAMb 2R7ZI 3TDHB 2OOYB 3CC7Z 3I55Z 4RVGA 4MRIA 3GTOI 1KQSY 2QR1B 3HOYI 4A3DI 3PO2I 1USPB 1KC81 1YJW1 3GTLI 2KPIA 1VQ81 2VPYA 1TWFI 1NJI2 2JR6A 3MZLB 3G711 3CCV1 1YUAA 1VQMZ 2QLVB 4A3II 1K731 3CD61 1KD11 2F4MA 2G2KA 5FLMI 3CPWZ 4RVFA 5C3EI 1Y1VS 4E30A 1TWGI 3GTGI 2P28A 1QF8A 1WJ2A 3CCJZ 2DE6A 2RPRA 2E9HA 1VQ61 5T67A 3S1RI 2JIPA 1WIIA 1I6HI 3CCQZ 1Y1VI 4NBBA 3CCEZ 2M6NA 2M48A 2Q51A 5C4XI 2AYDA 3CCMZ 3GTMS 4EWCA 1JJ2Y 4NBDA 3MZKB 4HGZA 1M1K2 3S2HI 3GCFA 4A3FI 3J7A4 2JA5I 3RZOI 2JUBA 3U50C 1K9M1 3GTMI 1Q7Y2 3VMIA 1LQLA 1FDOA 3HOZI 1VQ51 1W2BY 4MD9A 3K7AI 2B63I 4BY1I 3NH8A 1YJ91 2P3YA 1TFIA 4A93I 1RLYA 2NVYI 2W03A 2IZ4A 3HOVI 4MONA 4NBEA 1VQ6Z 2OTLZ 2GU2A 2K5RA 3GTJI 2JIQA 3CMEZ 4TNUA 2O53A 1JJ2Z 2QREB 3J80b 1L1OC 3P5JB 1YUKA 2VF1A 3FQMA 3BG0B 3PO3S 3J81b 1N2FA 2NAPA 2QA4Z 3FKII 3G4SZ 3HOUI 2NVQI 3D9XA 5T6BA 1W2BZ 3VB9A 4DGLA 4NBGA 2VPXA 1YIJZ 4S1TA 5C44I 4BBSI 4NB8A 4QTUA 4CL1A 3PO3I 2HU9A 2QRDB 1Y8CA 1ZB9A 3HOWI 5A2Qb 4NBHA 4NBAA 1N8R2 1VQN1 2VUGA 4XX2A 2W04A 3S1QI 2R92I 2QRCB 3I4MI 5IP9I 1VQL1 2OTJZ 2VPWA 2V3VA 3CCLZ 2OZKA 3NH5A 2IV2X 3OW2Y 1S72Z 1VQK1 1JWHC 3M3YI 1RQFA 3CC4Z 3CCUZ 5AN9F 3CC2Z 1ZB8A 1KC82 2ZAEB 3H0GI 1YIT1 2V45A 4NOZA 1Q821 4E2ZA 3CCR1 2O4HA 3HOXI 1RO2A 1VQOZ 1K732 1Q16A 1KD12 3VTNA 3RZDI 3ESWA 1VQNZ 4RS4A 3OW2Z 1KQSZ 2I3CA 4Y52I 5C4JI 1WCMI 2Y0SA 2IZ3A 2R6MA 3VMGA 2BJOA 1M901 4RVHA 1KRLA 3CMA1 3S14I 1VLAA 1VQP1 1TWHI 3IR7A 4NH1C 2VUMI 1RO4A 2J6AA 4BY7I 1YJWZ 1VQ8Z 3KIFA 3H3VJ 3G71Z 3EEDA 3CCVZ 1YJN1 1YHQ1 3D6WA 3S16I 4E2XA 3CD6Z 1K9M2 4RVDA 1Y1WI 1YI21 3T4NB 2RBLA 4NBCA 2YU9I 2GTIA 2E2HI 1PFTA 4NBFA 2RT9A 3J80f 3GKQA 2AKLA 1RO0A 2LEXA 3J81f 1WZNA 1X0TA 3I561 4MD7A 3G6E1 3QWUA 1K83I 1QVFY 2QEX1 2RIQA 3CCS1 1QVGY 1VQ71 1VQ91 2JIOA 5CM2M 3NDIA 1X3WA 4E2YA 5A2Qf 3CC71 2V8IA 3I551 1YI2Z 3F3PC 1FDIA 2EGTA 1VQ5Z 2OOXB 1Q861 1YJ9Z 3I4NI 2LFUA 1Q811 2JNYA 3Q87A 4A3JI 3CXCY 4E31A 1NUIA 4A3LI 1QVGZ 3GTQI 1QXFA 1VQM1 1DL6A 3D2LA 2LIYA 1K8A1 2JIRA 3VMHA 1S7MA 3S1NI 4DK1A 1TWCI 5IP7I 1SFOI 3CQZI 3EERA 4E33A 4QTTA 1I50I 4A3MI 3CPWY 1SIWA 3CCJ1 2NVTI 4MH4A 3CCQ1 2RHBA 3CCE1 3CXCZ 3S2DI 2QKDA 2VPZA 3IF8A 1P9NA 4MXUA 3CCM1 1VQLZ 2WAQA 1RNIA 2DE5A 3NDJA 3I07A 1M902 4BXXI 1VQKZ 2E2II 4A3CI 3FQQA 1NJI1 5D1OA 3GTPI 4E2WA 2JIMA 3IFUA 3F3FC 3S1MI 4E32A 1I3QI 1YITZ 4NB9A 5D1PA 1WW9A 3M4OI 2V8JA 3CCRZ 4BBRI 4Y7NI 3MONA 3S17I 1VQ41 2JA7I 2OTL1 2DE7A 5D1OB 3S15I 4A3GI 2PMZA 3CME1 5IT9f 4A3EI 2F4OA 1ML8A 1ZH1A 3IX0A 2GTHA 4AYBA 2NVXI 2E7ZA 2V8KA 5IT9b 2QA41 2JA6I 3GTKI 2YADA 1Z02A 3G4S1 5T64A 1M1K1 3CMAZ 2KI7B 4DQYB 3KIHA 1X3ZA 3NFZA 1YIJ1 1VQPZ 2HF1A 2PK7A 2WB1A 1Q7Y1 2JA8I 2H85A 3TE5B 2JS4A 4A3KI 1TWAI 2E2JI 1YJNZ 1VQ4Z 4A3BI 1YHQZ 2OTJ1 4RV9A 5FLXf 4MD8A 3CCL1 1R9TI 1S721 2R93I 2JMOA 3CC41 1Q862 3CCU1 2Q4ZA 5LL6f 2PM9A 3NH4A 3CC21 5FLXb 3BG1B 1Q812
chains in the Genus database with same CATH topology
1NP6A 1Z03A 1QVFZ 3I56Z 3JAMf 2K3RA 3G6EZ 1Z01A 1VQO1 2QEXZ 4HGYA 3HKZA 1K8A2 3CCSZ 1VQ7Z 1QYPA 4NFRA 1VQ9Z 4HH4A 1N8R1 3LUSA 1Q822 1USPA 4X6AI 3JAMb 2R7ZI 3TDHB 2OOYB 3CC7Z 3I55Z 4RVGA 4MRIA 3GTOI 1KQSY 2QR1B 3HOYI 4A3DI 3PO2I 1USPB 1KC81 1YJW1 3GTLI 2KPIA 1VQ81 1TWFI 1NJI2 2JR6A 3MZLB 3G711 3CCV1 1YUAA 1VQMZ 2QLVB 4A3II 1K731 3CD61 1KD11 2F4MA 2G2KA 5FLMI 3CPWZ 4RVFA 5C3EI 1Y1VS 4E30A 1TWGI 3GTGI 2P28A 1QF8A 3CCJZ 2DE6A 2RPRA 2E9HA 1VQ61 5T67A 3S1RI 1WIIA 1I6HI 3CCQZ 1Y1VI 4NBBA 3CCEZ 2M6NA 2M48A 2Q51A 5C4XI 3CCMZ 3GTMS 4EWCA 1JJ2Y 4NBDA 3MZKB 4HGZA 1M1K2 3S2HI 3GCFA 4A3FI 3J7A4 2JA5I 3RZOI 2JUBA 3U50C 1K9M1 3GTMI 1Q7Y2 3VMIA 1LQLA 3HOZI 1VQ51 1W2BY 4MD9A 3K7AI 2B63I 4BY1I 3NH8A 1YJ91 2P3YA 1TFIA 4A93I 1RLYA 2NVYI 2W03A 2IZ4A 3HOVI 4MONA 4NBEA 1VQ6Z 2OTLZ 2GU2A 2K5RA 3GTJI 3CMEZ 4TNUA 2O53A 1JJ2Z 2QREB 3J80b 1L1OC 3P5JB 1YUKA 2VF1A 3FQMA 3BG0B 3PO3S 3J81b 1N2FA 2QA4Z 3FKII 3G4SZ 3HOUI 2NVQI 3D9XA 5T6BA 1W2BZ 3VB9A 4DGLA 4NBGA 1YIJZ 4S1TA 5C44I 4BBSI 4NB8A 4QTUA 4CL1A 3PO3I 2HU9A 2QRDB 1ZB9A 3HOWI 5A2Qb 4NBHA 4NBAA 1N8R2 1VQN1 2VUGA 4XX2A 2W04A 3S1QI 2R92I 2QRCB 3I4MI 5IP9I 1VQL1 2OTJZ 3CCLZ 2OZKA 3NH5A 3OW2Y 1S72Z 1VQK1 1JWHC 3M3YI 1RQFA 3CC4Z 3CCUZ 5AN9F 3CC2Z 1ZB8A 1KC82 2ZAEB 3H0GI 1YIT1 4NOZA 1Q821 4E2ZA 3CCR1 2O4HA 3HOXI 1RO2A 1VQOZ 1K732 1KD12 3VTNA 3RZDI 3ESWA 1VQNZ 4RS4A 3OW2Z 1KQSZ 2I3CA 4Y52I 5C4JI 1WCMI 2Y0SA 2IZ3A 2R6MA 3VMGA 2BJOA 1M901 4RVHA 1KRLA 3CMA1 3S14I 1VLAA 1VQP1 1TWHI 4NH1C 2VUMI 1RO4A 2J6AA 4BY7I 1YJWZ 1VQ8Z 3KIFA 3H3VJ 3G71Z 3EEDA 3CCVZ 1YJN1 1YHQ1 3D6WA 3S16I 4E2XA 3CD6Z 1K9M2 4RVDA 1Y1WI 1YI21 3T4NB 2RBLA 4NBCA 2YU9I 2GTIA 2E2HI 1PFTA 4NBFA 2RT9A 3J80f 3GKQA 2AKLA 1RO0A 3J81f 1X0TA 3I561 4MD7A 3G6E1 3QWUA 1K83I 1QVFY 2QEX1 2RIQA 3CCS1 1QVGY 1VQ71 1VQ91 5CM2M 3NDIA 1X3WA 4E2YA 5A2Qf 3CC71 2V8IA 3I551 1YI2Z 3F3PC 2EGTA 1VQ5Z 2OOXB 1Q861 1YJ9Z 3I4NI 2LFUA 1Q811 2JNYA 3Q87A 4A3JI 3CXCY 4E31A 1NUIA 4A3LI 1QVGZ 3GTQI 1VQM1 1DL6A 2LIYA 1K8A1 3VMHA 1S7MA 3S1NI 4DK1A 1TWCI 5IP7I 1SFOI 3CQZI 3EERA 4E33A 4QTTA 1I50I 4A3MI 3CPWY 3CCJ1 2NVTI 4MH4A 3CCQ1 2RHBA 3CCE1 3CXCZ 3S2DI 2QKDA 3IF8A 1P9NA 4MXUA 3CCM1 1VQLZ 2WAQA 1RNIA 2DE5A 3NDJA 3I07A 1M902 4BXXI 1VQKZ 2E2II 4A3CI 3FQQA 1NJI1 5D1OA 3GTPI 4E2WA 3IFUA 3F3FC 3S1MI 4E32A 1I3QI 1YITZ 4NB9A 5D1PA 1WW9A 3M4OI 2V8JA 3CCRZ 4BBRI 4Y7NI 3MONA 3S17I 1VQ41 2JA7I 2OTL1 2DE7A 5D1OB 3S15I 4A3GI 2PMZA 3CME1 5IT9f 4A3EI 2F4OA 1ML8A 1ZH1A 3IX0A 2GTHA 4AYBA 2NVXI 2V8KA 5IT9b 2QA41 2JA6I 3GTKI 2YADA 1Z02A 3G4S1 5T64A 1M1K1 3CMAZ 2KI7B 4DQYB 3KIHA 1X3ZA 3NFZA 1YIJ1 1VQPZ 2HF1A 2PK7A 2WB1A 1Q7Y1 2JA8I 2H85A 3TE5B 2JS4A 4A3KI 1TWAI 2E2JI 1YJNZ 1VQ4Z 4A3BI 1YHQZ 2OTJ1 4RV9A 5FLXf 4MD8A 3CCL1 1R9TI 1S721 2R93I 2JMOA 3CC41 1Q862 3CCU1 2Q4ZA 5LL6f 2PM9A 3NH4A 3CC21 5FLXb 3BG1B 1Q812
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 I;  4A3M I;  3HOZ I;  3S14 I;  3K7A I;  2B63 I;  4BY1 I;  2NVT I;  1VLA A;  2P3Y A;  1TWH I;  1TFI A;  4A93 I;  2VUM I;  1RO4 A;  4MH4 A;  1RLY A;  2NVY I;  3HOV I;  2J6A A;  4BY7 I;  4NBE A;  3S2D I;  3H3V J;  1LQL A;  2K5R A;  3GTJ I;  1QYP A;  3D6W A;  2DE5 A;  3S16 I;  3LUS A;  1Y1W I;  1L1O C;  1USP A;  3I07 A;  4BXX I;  4X6A I;  2R7Z I;  2RBL A;  4NBC A;  2E2I I;  2YU9 I;  4A3C I;  3GTP I;  2E2H I;  3PO3 S;  1N2F A;  3FKI I;  3GTO I;  3HOU I;  3S1M I;  2NVQ I;  1I3Q I;  1PFT A;  3VB9 A;  4NBF A;  4NB9 A;  4NBG A;  1WW9 A;  3M4O I;  3GKQ A;  3HOY I;  5C44 I;  2AKL A;  4BBS I;  4A3D I;  4NB8 A;  4QTU A;  4BBR I;  4Y7N I;  3PO2 I;  3PO3 I;  1ZB9 A;  1USP B;  3HOW I;  4NBH A;  3S17 I;  4NBA A;  3GTL I;  2KPI A;  2JA7 I;  2DE7 A;  4XX2 A;  3S15 I;  1K83 I;  3S1Q I;  1TWF I;  2R92 I;  4A3G I;  2JR6 A;  4A3E I;  3I4M I;  2F4O A;  5IP9 I;  1ML8 A;  1YUA A;  4A3I I;  5CM2 M;  1X3W A;  3M3Y I;  2F4M A;  2NVX I;  5FLM I;  5C3E I;  1Y1V S;  1TWG I;  2JA6 I;  3GTK I;  3GTG I;  1ZB8 A;  3H0G I;  4NOZ A;  2DE6 A;  1X3Z A;  3I4N I;  2HF1 A;  2PK7 A;  3S1R I;  1I6H I;  2JA8 I;  3HOX I;  1Y1V I;  4NBB A;  2JNY A;  3Q87 A;  2JS4 A;  4A3J I;  4A3K I;  3RZD I;  5C4X I;  1TWA I;  1NUI A;  3ESW A;  2E2J I;  4A3L I;  4A3B I;  3GTM S;  3GTQ I;  4NBD A;  1R9T I;  4Y52 I;  1DL6 A;  5C4J I;  3S2H I;  2R93 I;  3GCF A;  4A3F I;  3VMH A;  3S1N I;  2JA5 I;  1WCM I;  3RZO I;  1TWC I;  5IP7 I;  3VMG A;  1SFO I;  3CQZ I;  2BJO A;  3EER A;  3U50 C;  3GTM I;  3VMI A;  4QTT A; 
#chains in the Genus database with same CATH topology
 1NP6 A;  1Z03 A;  1QVF Z;  3I56 Z;  3JAM f;  2K3R A;  3G6E Z;  1Z01 A;  1VQO 1;  2QEX Z;  4HGY A;  3HKZ A;  1AA6 A;  1K8A 2;  3CCS Z;  1VQ7 Z;  1QYP A;  4NFR A;  1VQ9 Z;  4HH4 A;  1N8R 1;  3LUS A;  1Q82 2;  1USP A;  4X6A I;  3JAM b;  2R7Z I;  3TDH B;  2OOY B;  3CC7 Z;  3I55 Z;  4RVG A;  4MRI A;  3GTO I;  1KQS Y;  2QR1 B;  3HOY I;  4A3D I;  3PO2 I;  1USP B;  1KC8 1;  1YJW 1;  3GTL I;  2KPI A;  1VQ8 1;  2VPY A;  1TWF I;  1NJI 2;  2JR6 A;  3MZL B;  3G71 1;  3CCV 1;  1YUA A;  1VQM Z;  2QLV B;  4A3I I;  1K73 1;  3CD6 1;  1KD1 1;  2F4M A;  2G2K A;  5FLM I;  3CPW Z;  4RVF A;  5C3E I;  1Y1V S;  4E30 A;  1TWG I;  3GTG I;  2P28 A;  1QF8 A;  1WJ2 A;  3CCJ Z;  2DE6 A;  2RPR A;  2E9H A;  1VQ6 1;  5T67 A;  3S1R I;  2JIP A;  1WII A;  1I6H I;  3CCQ Z;  1Y1V I;  4NBB A;  3CCE Z;  2M6N A;  2M48 A;  2Q51 A;  5C4X I;  2AYD A;  3CCM Z;  3GTM S;  4EWC A;  1JJ2 Y;  4NBD A;  3MZK B;  4HGZ A;  1M1K 2;  3S2H I;  3GCF A;  4A3F I;  3J7A 4;  2JA5 I;  3RZO I;  2JUB A;  3U50 C;  1K9M 1;  3GTM I;  1Q7Y 2;  3VMI A;  1LQL A;  1FDO A;  3HOZ I;  1VQ5 1;  1W2B Y;  4MD9 A;  3K7A I;  2B63 I;  4BY1 I;  3NH8 A;  1YJ9 1;  2P3Y A;  1TFI A;  4A93 I;  1RLY A;  2NVY I;  2W03 A;  2IZ4 A;  3HOV I;  4MON A;  4NBE A;  1VQ6 Z;  2OTL Z;  2GU2 A;  2K5R A;  3GTJ I;  2JIQ A;  3CME Z;  4TNU A;  2O53 A;  1JJ2 Z;  2QRE B;  3J80 b;  1L1O C;  3P5J B;  1YUK A;  2VF1 A;  3FQM A;  3BG0 B;  3PO3 S;  3J81 b;  1N2F A;  2NAP A;  2QA4 Z;  3FKI I;  3G4S Z;  3HOU I;  2NVQ I;  3D9X A;  5T6B A;  1W2B Z;  3VB9 A;  4DGL A;  4NBG A;  2VPX A;  1YIJ Z;  4S1T A;  5C44 I;  4BBS I;  4NB8 A;  4QTU A;  4CL1 A;  3PO3 I;  2HU9 A;  2QRD B;  1Y8C A;  1ZB9 A;  3HOW I;  5A2Q b;  4NBH A;  4NBA A;  1N8R 2;  1VQN 1;  2VUG A;  4XX2 A;  2W04 A;  3S1Q I;  2R92 I;  2QRC B;  3I4M I;  5IP9 I;  1VQL 1;  2OTJ Z;  2VPW A;  2V3V A;  3CCL Z;  2OZK A;  3NH5 A;  2IV2 X;  3OW2 Y;  1S72 Z;  1VQK 1;  1JWH C;  3M3Y I;  1RQF A;  3CC4 Z;  3CCU Z;  5AN9 F;  3CC2 Z;  1ZB8 A;  1KC8 2;  2ZAE B;  3H0G I;  1YIT 1;  2V45 A;  4NOZ A;  1Q82 1;  4E2Z A;  3CCR 1;  2O4H A;  3HOX I;  1RO2 A;  1VQO Z;  1K73 2;  1Q16 A;  1KD1 2;  3VTN A;  3RZD I;  3ESW A;  1VQN Z;  4RS4 A;  3OW2 Z;  1KQS Z;  2I3C A;  4Y52 I;  5C4J I;  1WCM I;  2Y0S A;  2IZ3 A;  2R6M A;  3VMG A;  2BJO A;  1M90 1;  4RVH A;  1KRL A;  3CMA 1;  3S14 I;  1VLA A;  1VQP 1;  1TWH I;  3IR7 A;  4NH1 C;  2VUM I;  1RO4 A;  2J6A A;  4BY7 I;  1YJW Z;  1VQ8 Z;  3KIF A;  3H3V J;  3G71 Z;  3EED A;  3CCV Z;  1YJN 1;  1YHQ 1;  3D6W A;  3S16 I;  4E2X A;  3CD6 Z;  1K9M 2;  4RVD A;  1Y1W I;  1YI2 1;  3T4N B;  2RBL A;  4NBC A;  2YU9 I;  2GTI A;  2E2H I;  1PFT A;  4NBF A;  2RT9 A;  3J80 f;  3GKQ A;  2AKL A;  1RO0 A;  2LEX A;  3J81 f;  1WZN A;  1X0T A;  3I56 1;  4MD7 A;  3G6E 1;  3QWU A;  1K83 I;  1QVF Y;  2QEX 1;  2RIQ A;  3CCS 1;  1QVG Y;  1VQ7 1;  1VQ9 1;  2JIO A;  5CM2 M;  3NDI A;  1X3W A;  4E2Y A;  5A2Q f;  3CC7 1;  2V8I A;  3I55 1;  1YI2 Z;  3F3P C;  1FDI A;  2EGT A;  1VQ5 Z;  2OOX B;  1Q86 1;  1YJ9 Z;  3I4N I;  2LFU A;  1Q81 1;  2JNY A;  3Q87 A;  4A3J I;  3CXC Y;  4E31 A;  1NUI A;  4A3L I;  1QVG Z;  3GTQ I;  1QXF A;  1VQM 1;  1DL6 A;  3D2L A;  2LIY A;  1K8A 1;  2JIR A;  3VMH A;  1S7M A;  3S1N I;  4DK1 A;  1TWC I;  5IP7 I;  1SFO I;  3CQZ I;  3EER A;  4E33 A;  4QTT A;  1I50 I;  4A3M I;  3CPW Y;  1SIW A;  3CCJ 1;  2NVT I;  4MH4 A;  3CCQ 1;  2RHB A;  3CCE 1;  3CXC Z;  3S2D I;  2QKD A;  2VPZ A;  3IF8 A;  1P9N A;  4MXU A;  3CCM 1;  1VQL Z;  2WAQ A;  1RNI A;  2DE5 A;  3NDJ A;  3I07 A;  1M90 2;  4BXX I;  1VQK Z;  2E2I I;  4A3C I;  3FQQ A;  1NJI 1;  5D1O A;  3GTP I;  4E2W A;  2JIM A;  3IFU A;  3F3F C;  3S1M I;  4E32 A;  1I3Q I;  1YIT Z;  4NB9 A;  5D1P A;  1WW9 A;  3M4O I;  2V8J A;  3CCR Z;  4BBR I;  4Y7N I;  3MON A;  3S17 I;  1VQ4 1;  2JA7 I;  2OTL 1;  2DE7 A;  5D1O B;  3S15 I;  4A3G I;  2PMZ A;  3CME 1;  5IT9 f;  4A3E I;  2F4O A;  1ML8 A;  1ZH1 A;  3IX0 A;  2GTH A;  4AYB A;  2NVX I;  2E7Z A;  2V8K A;  5IT9 b;  2QA4 1;  2JA6 I;  3GTK I;  2YAD A;  1Z02 A;  3G4S 1;  5T64 A;  1M1K 1;  3CMA Z;  2KI7 B;  4DQY B;  3KIH A;  1X3Z A;  3NFZ A;  1YIJ 1;  1VQP Z;  2HF1 A;  2PK7 A;  2WB1 A;  1Q7Y 1;  2JA8 I;  2H85 A;  3TE5 B;  2JS4 A;  4A3K I;  1TWA I;  2E2J I;  1YJN Z;  1VQ4 Z;  4A3B I;  1YHQ Z;  2OTJ 1;  4RV9 A;  5FLX f;  4MD8 A;  3CCL 1;  1R9T I;  1S72 1;  2R93 I;  2JMO A;  3CC4 1;  1Q86 2;  3CCU 1;  2Q4Z A;  5LL6 f;  2PM9 A;  3NH4 A;  3CC2 1;  5FLX b;  3BG1 B;  1Q81 2; 
#chains in the Genus database with same CATH homology
 1NP6 A;  1Z03 A;  1QVF Z;  3I56 Z;  3JAM f;  2K3R A;  3G6E Z;  1Z01 A;  1VQO 1;  2QEX Z;  4HGY A;  3HKZ A;  1K8A 2;  3CCS Z;  1VQ7 Z;  1QYP A;  4NFR A;  1VQ9 Z;  4HH4 A;  1N8R 1;  3LUS A;  1Q82 2;  1USP A;  4X6A I;  3JAM b;  2R7Z I;  3TDH B;  2OOY B;  3CC7 Z;  3I55 Z;  4RVG A;  4MRI A;  3GTO I;  1KQS Y;  2QR1 B;  3HOY I;  4A3D I;  3PO2 I;  1USP B;  1KC8 1;  1YJW 1;  3GTL I;  2KPI A;  1VQ8 1;  1TWF I;  1NJI 2;  2JR6 A;  3MZL B;  3G71 1;  3CCV 1;  1YUA A;  1VQM Z;  2QLV B;  4A3I I;  1K73 1;  3CD6 1;  1KD1 1;  2F4M A;  2G2K A;  5FLM I;  3CPW Z;  4RVF A;  5C3E I;  1Y1V S;  4E30 A;  1TWG I;  3GTG I;  2P28 A;  1QF8 A;  3CCJ Z;  2DE6 A;  2RPR A;  2E9H A;  1VQ6 1;  5T67 A;  3S1R I;  1WII A;  1I6H I;  3CCQ Z;  1Y1V I;  4NBB A;  3CCE Z;  2M6N A;  2M48 A;  2Q51 A;  5C4X I;  3CCM Z;  3GTM S;  4EWC A;  1JJ2 Y;  4NBD A;  3MZK B;  4HGZ A;  1M1K 2;  3S2H I;  3GCF A;  4A3F I;  3J7A 4;  2JA5 I;  3RZO I;  2JUB A;  3U50 C;  1K9M 1;  3GTM I;  1Q7Y 2;  3VMI A;  1LQL A;  3HOZ I;  1VQ5 1;  1W2B Y;  4MD9 A;  3K7A I;  2B63 I;  4BY1 I;  3NH8 A;  1YJ9 1;  2P3Y A;  1TFI A;  4A93 I;  1RLY A;  2NVY I;  2W03 A;  2IZ4 A;  3HOV I;  4MON A;  4NBE A;  1VQ6 Z;  2OTL Z;  2GU2 A;  2K5R A;  3GTJ I;  3CME Z;  4TNU A;  2O53 A;  1JJ2 Z;  2QRE B;  3J80 b;  1L1O C;  3P5J B;  1YUK A;  2VF1 A;  3FQM A;  3BG0 B;  3PO3 S;  3J81 b;  1N2F A;  2QA4 Z;  3FKI I;  3G4S Z;  3HOU I;  2NVQ I;  3D9X A;  5T6B A;  1W2B Z;  3VB9 A;  4DGL A;  4NBG A;  1YIJ Z;  4S1T A;  5C44 I;  4BBS I;  4NB8 A;  4QTU A;  4CL1 A;  3PO3 I;  2HU9 A;  2QRD B;  1ZB9 A;  3HOW I;  5A2Q b;  4NBH A;  4NBA A;  1N8R 2;  1VQN 1;  2VUG A;  4XX2 A;  2W04 A;  3S1Q I;  2R92 I;  2QRC B;  3I4M I;  5IP9 I;  1VQL 1;  2OTJ Z;  3CCL Z;  2OZK A;  3NH5 A;  3OW2 Y;  1S72 Z;  1VQK 1;  1JWH C;  3M3Y I;  1RQF A;  3CC4 Z;  3CCU Z;  5AN9 F;  3CC2 Z;  1ZB8 A;  1KC8 2;  2ZAE B;  3H0G I;  1YIT 1;  4NOZ A;  1Q82 1;  4E2Z A;  3CCR 1;  2O4H A;  3HOX I;  1RO2 A;  1VQO Z;  1K73 2;  1KD1 2;  3VTN A;  3RZD I;  3ESW A;  1VQN Z;  4RS4 A;  3OW2 Z;  1KQS Z;  2I3C A;  4Y52 I;  5C4J I;  1WCM I;  2Y0S A;  2IZ3 A;  2R6M A;  3VMG A;  2BJO A;  1M90 1;  4RVH A;  1KRL A;  3CMA 1;  3S14 I;  1VLA A;  1VQP 1;  1TWH I;  4NH1 C;  2VUM I;  1RO4 A;  2J6A A;  4BY7 I;  1YJW Z;  1VQ8 Z;  3KIF A;  3H3V J;  3G71 Z;  3EED A;  3CCV Z;  1YJN 1;  1YHQ 1;  3D6W A;  3S16 I;  4E2X A;  3CD6 Z;  1K9M 2;  4RVD A;  1Y1W I;  1YI2 1;  3T4N B;  2RBL A;  4NBC A;  2YU9 I;  2GTI A;  2E2H I;  1PFT A;  4NBF A;  2RT9 A;  3J80 f;  3GKQ A;  2AKL A;  1RO0 A;  3J81 f;  1X0T A;  3I56 1;  4MD7 A;  3G6E 1;  3QWU A;  1K83 I;  1QVF Y;  2QEX 1;  2RIQ A;  3CCS 1;  1QVG Y;  1VQ7 1;  1VQ9 1;  5CM2 M;  3NDI A;  1X3W A;  4E2Y A;  5A2Q f;  3CC7 1;  2V8I A;  3I55 1;  1YI2 Z;  3F3P C;  2EGT A;  1VQ5 Z;  2OOX B;  1Q86 1;  1YJ9 Z;  3I4N I;  2LFU A;  1Q81 1;  2JNY A;  3Q87 A;  4A3J I;  3CXC Y;  4E31 A;  1NUI A;  4A3L I;  1QVG Z;  3GTQ I;  1VQM 1;  1DL6 A;  2LIY A;  1K8A 1;  3VMH A;  1S7M A;  3S1N I;  4DK1 A;  1TWC I;  5IP7 I;  1SFO I;  3CQZ I;  3EER A;  4E33 A;  4QTT A;  1I50 I;  4A3M I;  3CPW Y;  3CCJ 1;  2NVT I;  4MH4 A;  3CCQ 1;  2RHB A;  3CCE 1;  3CXC Z;  3S2D I;  2QKD A;  3IF8 A;  1P9N A;  4MXU A;  3CCM 1;  1VQL Z;  2WAQ A;  1RNI A;  2DE5 A;  3NDJ A;  3I07 A;  1M90 2;  4BXX I;  1VQK Z;  2E2I I;  4A3C I;  3FQQ A;  1NJI 1;  5D1O A;  3GTP I;  4E2W A;  3IFU A;  3F3F C;  3S1M I;  4E32 A;  1I3Q I;  1YIT Z;  4NB9 A;  5D1P A;  1WW9 A;  3M4O I;  2V8J A;  3CCR Z;  4BBR I;  4Y7N I;  3MON A;  3S17 I;  1VQ4 1;  2JA7 I;  2OTL 1;  2DE7 A;  5D1O B;  3S15 I;  4A3G I;  2PMZ A;  3CME 1;  5IT9 f;  4A3E I;  2F4O A;  1ML8 A;  1ZH1 A;  3IX0 A;  2GTH A;  4AYB A;  2NVX I;  2V8K A;  5IT9 b;  2QA4 1;  2JA6 I;  3GTK I;  2YAD A;  1Z02 A;  3G4S 1;  5T64 A;  1M1K 1;  3CMA Z;  2KI7 B;  4DQY B;  3KIH A;  1X3Z A;  3NFZ A;  1YIJ 1;  1VQP Z;  2HF1 A;  2PK7 A;  2WB1 A;  1Q7Y 1;  2JA8 I;  2H85 A;  3TE5 B;  2JS4 A;  4A3K I;  1TWA I;  2E2J I;  1YJN Z;  1VQ4 Z;  4A3B I;  1YHQ Z;  2OTJ 1;  4RV9 A;  5FLX f;  4MD8 A;  3CCL 1;  1R9T I;  1S72 1;  2R93 I;  2JMO A;  3CC4 1;  1Q86 2;  3CCU 1;  2Q4Z A;  5LL6 f;  2PM9 A;  3NH4 A;  3CC2 1;  5FLX b;  3BG1 B;  1Q81 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...