4MD8A

Crystal structure of full-length symmetric ck2 holoenzyme with mutated alpha subunit (f121e)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
199
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 199
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md8A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md8A02
4MD7A 2JMOA 2RT9A 4MD8A 1QF8A 4MD9A 4DGLA 2M6NA 3EEDA 2R6MA 2M48A 1RQFA 4NH1C 1JWHC
chains in the Genus database with same CATH superfamily
3U50C 3RZDI 1WZNA 3S16I 3MZKB 3I55Z 3IX0A 2Q51A 1VQO1 1JJ2Y 4BY7I 1M902 1K9M1 3G4SZ 5CM2M 2OOYB 3CXCZ 2PK7A 2EGTA 1YIJ1 3S1RI 2OTJZ 4Y7NI 1QYPA 2VPWA 4NBHA 4E2XA 2YU9I 2V8KA 2QEXZ 2VF1A 5IT9b 4QTTA 2DE7A 1VQK1 4NB9A 3GTLI 1Y8CA 2QR1B 3CCR1 5IT9f 3CD61 3CCSZ 3CCUZ 3MZLB 1YITZ 1TWGI 1N8R1 4RVFA 3S15I 4NFRA 3CCM1 1Q16A 3IFUA 1P9NA 1YJWZ 1VQ91 4E31A 3CC2Z 3H0GI 2OTL1 1VQ71 4NBAA 5AN9F 1YUAA 4MRIA 2JIQA 1NP6A 1TFIA 4EWCA 3CCE1 3CCVZ 2NVQI 1WJ2A 2AKLA 2NAPA 3NH5A 3NH8A 4RVGA 3NDIA 1Q861 5D1OB 1YI21 4E33A 1VQOZ 2JR6A 2E2JI 2DE5A 1RLYA 5FLMI 1DL6A 4NBGA 4RV9A 1TWAI 2KPIA 3PO3I 4NBBA 2PM9A 3ESWA 3RZOI 3GTGI 1Q812 1K83I 2M48A 4BBRI 1JWHC 4DK1A 1VQ5Z 2BJOA 1VQKZ 3CD6Z 1VQ81 1Z02A 2JIOA 3CMAZ 1X3ZA 3EEDA 1Z01A 2RIQA 3T4NB 1M1K2 5FLXf 3CC41 2HU9A 4NBFA 1KD12 1YJ9Z 1FDIA 2R92I 3GTMI 1QF8A 3KIFA 2V3VA 1RQFA 3GCFA 2OTLZ 4X6AI 2V45A 3JAMb 4RVHA 1KQSY 4MD8A 1K732 2JMOA 2LFUA 3PO3S 4RS4A 3CCEZ 3CCL1 3JAMf 3CCJ1 3MONA 1YUKA 1USPA 2QRDB 2JA6I 1VLAA 1YI2Z 3Q87A 1LQLA 1QVGZ 1I50I 3NDJA 2QRCB 5IP9I 1N2FA 2RT9A 4TNUA 3CCQ1 1NJI1 1YJN1 1Q7Y2 2JA8I 2JA5I 4MH4A 1QXFA 1VQN1 4AYBA 3BG0B 4CL1A 5IP7I 2VPYA 4BBSI 3S1QI 4DGLA 3VMIA 2JIMA 2JIPA 3NFZA 2OZKA 3GTOI 2JS4A 1SIWA 1QVFY 2JUBA 2IZ4A 1ZH1A 2IZ3A 1Q822 1VQP1 4A3LI 3FKII 4HH4A 3VMGA 2K3RA 4A3CI 1Y1VI 3GTPI 4A3DI 4HGYA 3CPWZ 1W2BY 1S72Z 3CC7Z 1VQL1 1K9M2 4E2WA 2P3YA 3GKQA 4DQYB 2VPXA 3IR7A 3H3VJ 2JNYA 4MD9A 3VTNA 2QLVB 1K8A1 3CXCY 3I4MI 4NBEA 3CCQZ 2G2KA 3S2DI 2QA41 1R9TI 1KC81 1TWHI 1YIJZ 2RBLA 2DE6A 3CME1 4NBCA 4RVDA 2JIRA 1N8R2 3S2HI 4E32A 3GTQI 2R6MA 2E9HA 1Y1WI 2QREB 3LUSA 2QKDA 5A2Qb 2GU2A 4QTUA 4BY1I 5C4JI 2R7ZI 5FLXb 3CCRZ 1K731 3FQQA 3S14I 3NH4A 2K5RA 5A2Qf 1VQM1 3HOVI 1WW9A 1ML8A 4A93I 2OTJ1 1JJ2Z 3CCMZ 3GTJI 3J80f 1VQ9Z 1Q862 4MD7A 1VQ7Z 4A3EI 1WCMI 3P5JB 3J81f 1VQLZ 3S1MI 1M901 1TWFI 2VPZA 3CCS1 2WAQA 3M3YI 3S1NI 3CCU1 4A3II 2E2HI 1ZB8A 2PMZA 1YIT1 3G711 3S17I 2F4MA 3EERA 5D1OA 5C44I 4Y52I 1X0TA 2Y0SA 3HOYI 2QA4Z 4NB8A 3FQMA 2W04A 2J6AA 3GTMS 3CMEZ 1YHQ1 1RO0A 3HOUI 2O53A 3CCV1 4A3FI 2LEXA 4E2YA 2YADA 4MXUA 4S1TA 2VUGA 2O4HA 3HOXI 2F4OA 2ZAEB 3VB9A 4BXXI 2OOXB 3GTKI 5T64A 2W03A 1VQ8Z 2VUMI 3D6WA 1VQMZ 4HGZA 3PO2I 3F3FC 1VQ61 3CC4Z 3HOWI 2IV2X 3HOZI 3OW2Y 2E7ZA 1AA6A 2NVTI 4A3GI 1VQ51 2NVXI 1NJI2 2M6NA 3CCLZ 5LL6f 3CMA1 3M4OI 2GTIA 1QVGY 2RHBA 3I561 3CCJZ 3G6E1 4A3MI 1KRLA 4NH1C 3G71Z 3TDHB 5C3EI 2B63I 1VQ41 2H85A 1YJ91 1Q811 2HF1A 1FDOA 1YJNZ 2V8JA 5T67A 1RNIA 1ZB9A 3J7A4 3VMHA 1Z03A 1YHQZ 5D1PA 1M1K1 1VQNZ 1Y1VS 3KIHA 1KD11 1KQSZ 4A3BI 1USPB 2GTHA 2WB1A 2Q4ZA 1TWCI 2P28A 1X3WA 3F3PC 1L1OC 2RPRA 1SFOI 3I551 4NOZA 1RO2A 4MONA 1VQ6Z 3TE5B 4XX2A 1WIIA 1PFTA 1VQPZ 3CPWY 3J80b 3G4S1 3CQZI 2NVYI 4A3JI 3I4NI 4E30A 1K8A2 3J81b 2QEX1 1RO4A 2E2II 2V8IA 1Q7Y1 2LIYA 4E2ZA 1I6HI 3IF8A 3I56Z 3G6EZ 4A3KI 1KC82 3I07A 1VQ4Z 1S7MA 2AYDA 2JA7I 3K7AI 5C4XI 1QVFZ 3QWUA 2I3CA 3D2LA 1YJW1 1NUIA 3OW2Z 3CC21 1S721 3HKZA 3BG1B 2R93I 4NBDA 1I3QI 3CC71 2KI7B 1W2BZ 1Q821 3D9XA 5T6BA
chains in the Genus database with same CATH topology
3U50C 3RZDI 3S16I 3MZKB 3I55Z 3IX0A 2Q51A 1VQO1 1JJ2Y 4BY7I 1M902 1K9M1 3G4SZ 5CM2M 2OOYB 3CXCZ 2PK7A 2EGTA 1YIJ1 3S1RI 2OTJZ 4Y7NI 1QYPA 4NBHA 4E2XA 2YU9I 2V8KA 2QEXZ 2VF1A 5IT9b 4QTTA 2DE7A 1VQK1 4NB9A 3GTLI 2QR1B 3CCR1 5IT9f 3CD61 3CCSZ 3CCUZ 3MZLB 1YITZ 1TWGI 1N8R1 4RVFA 3S15I 4NFRA 3CCM1 3IFUA 1P9NA 1YJWZ 1VQ91 4E31A 3CC2Z 3H0GI 2OTL1 1VQ71 4NBAA 5AN9F 1YUAA 4MRIA 1NP6A 1TFIA 4EWCA 3CCE1 3CCVZ 2NVQI 2AKLA 3NH5A 3NH8A 4RVGA 3NDIA 1Q861 5D1OB 1YI21 4E33A 1VQOZ 2JR6A 2E2JI 2DE5A 1RLYA 5FLMI 1DL6A 4NBGA 4RV9A 1TWAI 2KPIA 3PO3I 4NBBA 2PM9A 3ESWA 3RZOI 3GTGI 1Q812 1K83I 2M48A 4BBRI 1JWHC 4DK1A 1VQ5Z 2BJOA 1VQKZ 3CD6Z 1VQ81 1Z02A 3CMAZ 1X3ZA 3EEDA 1Z01A 2RIQA 3T4NB 1M1K2 5FLXf 3CC41 2HU9A 4NBFA 1KD12 1YJ9Z 2R92I 3GTMI 1QF8A 3KIFA 1RQFA 3GCFA 2OTLZ 4X6AI 3JAMb 4RVHA 1KQSY 4MD8A 1K732 2JMOA 2LFUA 3PO3S 4RS4A 3CCEZ 3CCL1 3JAMf 3CCJ1 3MONA 1YUKA 1USPA 2QRDB 2JA6I 1VLAA 1YI2Z 3Q87A 1LQLA 1QVGZ 1I50I 3NDJA 2QRCB 5IP9I 1N2FA 2RT9A 4TNUA 3CCQ1 1NJI1 1YJN1 1Q7Y2 2JA8I 2JA5I 4MH4A 1VQN1 4AYBA 3BG0B 4CL1A 5IP7I 4BBSI 3S1QI 4DGLA 3VMIA 3NFZA 2OZKA 3GTOI 2JS4A 1QVFY 2JUBA 2IZ4A 1ZH1A 2IZ3A 1Q822 1VQP1 4A3LI 3FKII 4HH4A 3VMGA 2K3RA 4A3CI 1Y1VI 3GTPI 4A3DI 4HGYA 3CPWZ 1W2BY 1S72Z 3CC7Z 1VQL1 1K9M2 4E2WA 2P3YA 3GKQA 4DQYB 3H3VJ 2JNYA 4MD9A 3VTNA 2QLVB 1K8A1 3CXCY 3I4MI 4NBEA 3CCQZ 2G2KA 3S2DI 2QA41 1R9TI 1KC81 1TWHI 1YIJZ 2RBLA 2DE6A 3CME1 4NBCA 4RVDA 1N8R2 3S2HI 4E32A 3GTQI 2R6MA 2E9HA 1Y1WI 2QREB 3LUSA 2QKDA 5A2Qb 2GU2A 4QTUA 4BY1I 5C4JI 2R7ZI 5FLXb 3CCRZ 1K731 3FQQA 3S14I 3NH4A 2K5RA 5A2Qf 1VQM1 3HOVI 1WW9A 1ML8A 4A93I 2OTJ1 1JJ2Z 3CCMZ 3GTJI 3J80f 1VQ9Z 1Q862 4MD7A 1VQ7Z 4A3EI 1WCMI 3P5JB 3J81f 1VQLZ 3S1MI 1M901 1TWFI 3CCS1 3S1NI 2WAQA 3M3YI 3CCU1 4A3II 2E2HI 1ZB8A 2PMZA 1YIT1 3G711 3S17I 2F4MA 3EERA 5D1OA 5C44I 4Y52I 1X0TA 2Y0SA 3HOYI 2QA4Z 4NB8A 3FQMA 2W04A 2J6AA 3GTMS 3CMEZ 1YHQ1 1RO0A 3HOUI 2O53A 3CCV1 4A3FI 4E2YA 2YADA 4MXUA 4S1TA 2VUGA 2O4HA 3HOXI 2F4OA 2ZAEB 3VB9A 4BXXI 2OOXB 3GTKI 5T64A 2W03A 1VQ8Z 2VUMI 3D6WA 1VQMZ 4HGZA 3PO2I 3F3FC 1VQ61 3CC4Z 3HOWI 3HOZI 3OW2Y 2NVTI 4A3GI 1VQ51 2NVXI 1NJI2 2M6NA 3CCLZ 5LL6f 3CMA1 3M4OI 2GTIA 1QVGY 2RHBA 3I561 3CCJZ 3G6E1 4A3MI 1KRLA 4NH1C 3G71Z 3TDHB 5C3EI 2B63I 1VQ41 2H85A 1YJ91 1Q811 2HF1A 1YJNZ 2V8JA 5T67A 1RNIA 1ZB9A 3J7A4 3VMHA 1Z03A 1YHQZ 5D1PA 1M1K1 1VQNZ 1Y1VS 3KIHA 1KD11 1KQSZ 4A3BI 1USPB 2GTHA 2WB1A 2Q4ZA 1TWCI 2P28A 1X3WA 3F3PC 1L1OC 2RPRA 1SFOI 3I551 4NOZA 1RO2A 4MONA 1VQ6Z 3TE5B 4XX2A 1WIIA 1PFTA 1VQPZ 3CPWY 3J80b 3G4S1 3CQZI 2NVYI 4A3JI 3I4NI 4E30A 1K8A2 3J81b 2QEX1 1RO4A 2E2II 2V8IA 1Q7Y1 2LIYA 4E2ZA 1I6HI 3IF8A 3I56Z 3G6EZ 4A3KI 1KC82 3I07A 1VQ4Z 1S7MA 2JA7I 3K7AI 5C4XI 1QVFZ 3QWUA 2I3CA 1YJW1 1NUIA 3OW2Z 3CC21 1S721 3HKZA 3BG1B 2R93I 4NBDA 1I3QI 3CC71 2KI7B 1W2BZ 1Q821 3D9XA 5T6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD7 A;  2JMO A;  2RT9 A;  4MD8 A;  1QF8 A;  4MD9 A;  4DGL A;  2M6N A;  3EED A;  2R6M A;  2M48 A;  1RQF A;  4NH1 C;  1JWH C; 
#chains in the Genus database with same CATH topology
 3U50 C;  3RZD I;  1WZN A;  3S16 I;  3MZK B;  3I55 Z;  3IX0 A;  2Q51 A;  1VQO 1;  1JJ2 Y;  4BY7 I;  1M90 2;  1K9M 1;  3G4S Z;  5CM2 M;  2OOY B;  3CXC Z;  2PK7 A;  2EGT A;  1YIJ 1;  3S1R I;  2OTJ Z;  4Y7N I;  1QYP A;  2VPW A;  4NBH A;  4E2X A;  2YU9 I;  2V8K A;  2QEX Z;  2VF1 A;  5IT9 b;  4QTT A;  2DE7 A;  1VQK 1;  4NB9 A;  3GTL I;  1Y8C A;  2QR1 B;  3CCR 1;  5IT9 f;  3CD6 1;  3CCS Z;  3CCU Z;  3MZL B;  1YIT Z;  1TWG I;  1N8R 1;  4RVF A;  3S15 I;  4NFR A;  3CCM 1;  1Q16 A;  3IFU A;  1P9N A;  1YJW Z;  1VQ9 1;  4E31 A;  3CC2 Z;  3H0G I;  2OTL 1;  1VQ7 1;  4NBA A;  5AN9 F;  1YUA A;  4MRI A;  2JIQ A;  1NP6 A;  1TFI A;  4EWC A;  3CCE 1;  3CCV Z;  2NVQ I;  1WJ2 A;  2AKL A;  2NAP A;  3NH5 A;  3NH8 A;  4RVG A;  3NDI A;  1Q86 1;  5D1O B;  1YI2 1;  4E33 A;  1VQO Z;  2JR6 A;  2E2J I;  2DE5 A;  1RLY A;  5FLM I;  1DL6 A;  4NBG A;  4RV9 A;  1TWA I;  2KPI A;  3PO3 I;  4NBB A;  2PM9 A;  3ESW A;  3RZO I;  3GTG I;  1Q81 2;  1K83 I;  2M48 A;  4BBR I;  1JWH C;  4DK1 A;  1VQ5 Z;  2BJO A;  1VQK Z;  3CD6 Z;  1VQ8 1;  1Z02 A;  2JIO A;  3CMA Z;  1X3Z A;  3EED A;  1Z01 A;  2RIQ A;  3T4N B;  1M1K 2;  5FLX f;  3CC4 1;  2HU9 A;  4NBF A;  1KD1 2;  1YJ9 Z;  1FDI A;  2R92 I;  3GTM I;  1QF8 A;  3KIF A;  2V3V A;  1RQF A;  3GCF A;  2OTL Z;  4X6A I;  2V45 A;  3JAM b;  4RVH A;  1KQS Y;  4MD8 A;  1K73 2;  2JMO A;  2LFU A;  3PO3 S;  4RS4 A;  3CCE Z;  3CCL 1;  3JAM f;  3CCJ 1;  3MON A;  1YUK A;  1USP A;  2QRD B;  2JA6 I;  1VLA A;  1YI2 Z;  3Q87 A;  1LQL A;  1QVG Z;  1I50 I;  3NDJ A;  2QRC B;  5IP9 I;  1N2F A;  2RT9 A;  4TNU A;  3CCQ 1;  1NJI 1;  1YJN 1;  1Q7Y 2;  2JA8 I;  2JA5 I;  4MH4 A;  1QXF A;  1VQN 1;  4AYB A;  3BG0 B;  4CL1 A;  5IP7 I;  2VPY A;  4BBS I;  3S1Q I;  4DGL A;  3VMI A;  2JIM A;  2JIP A;  3NFZ A;  2OZK A;  3GTO I;  2JS4 A;  1SIW A;  1QVF Y;  2JUB A;  2IZ4 A;  1ZH1 A;  2IZ3 A;  1Q82 2;  1VQP 1;  4A3L I;  3FKI I;  4HH4 A;  3VMG A;  2K3R A;  4A3C I;  1Y1V I;  3GTP I;  4A3D I;  4HGY A;  3CPW Z;  1W2B Y;  1S72 Z;  3CC7 Z;  1VQL 1;  1K9M 2;  4E2W A;  2P3Y A;  3GKQ A;  4DQY B;  2VPX A;  3IR7 A;  3H3V J;  2JNY A;  4MD9 A;  3VTN A;  2QLV B;  1K8A 1;  3CXC Y;  3I4M I;  4NBE A;  3CCQ Z;  2G2K A;  3S2D I;  2QA4 1;  1R9T I;  1KC8 1;  1TWH I;  1YIJ Z;  2RBL A;  2DE6 A;  3CME 1;  4NBC A;  4RVD A;  2JIR A;  1N8R 2;  3S2H I;  4E32 A;  3GTQ I;  2R6M A;  2E9H A;  1Y1W I;  2QRE B;  3LUS A;  2QKD A;  5A2Q b;  2GU2 A;  4QTU A;  4BY1 I;  5C4J I;  2R7Z I;  5FLX b;  3CCR Z;  1K73 1;  3FQQ A;  3S14 I;  3NH4 A;  2K5R A;  5A2Q f;  1VQM 1;  3HOV I;  1WW9 A;  1ML8 A;  4A93 I;  2OTJ 1;  1JJ2 Z;  3CCM Z;  3GTJ I;  3J80 f;  1VQ9 Z;  1Q86 2;  4MD7 A;  1VQ7 Z;  4A3E I;  1WCM I;  3P5J B;  3J81 f;  1VQL Z;  3S1M I;  1M90 1;  1TWF I;  2VPZ A;  3CCS 1;  2WAQ A;  3M3Y I;  3S1N I;  3CCU 1;  4A3I I;  2E2H I;  1ZB8 A;  2PMZ A;  1YIT 1;  3G71 1;  3S17 I;  2F4M A;  3EER A;  5D1O A;  5C44 I;  4Y52 I;  1X0T A;  2Y0S A;  3HOY I;  2QA4 Z;  4NB8 A;  3FQM A;  2W04 A;  2J6A A;  3GTM S;  3CME Z;  1YHQ 1;  1RO0 A;  3HOU I;  2O53 A;  3CCV 1;  4A3F I;  2LEX A;  4E2Y A;  2YAD A;  4MXU A;  4S1T A;  2VUG A;  2O4H A;  3HOX I;  2F4O A;  2ZAE B;  3VB9 A;  4BXX I;  2OOX B;  3GTK I;  5T64 A;  2W03 A;  1VQ8 Z;  2VUM I;  3D6W A;  1VQM Z;  4HGZ A;  3PO2 I;  3F3F C;  1VQ6 1;  3CC4 Z;  3HOW I;  2IV2 X;  3HOZ I;  3OW2 Y;  2E7Z A;  1AA6 A;  2NVT I;  4A3G I;  1VQ5 1;  2NVX I;  1NJI 2;  2M6N A;  3CCL Z;  5LL6 f;  3CMA 1;  3M4O I;  2GTI A;  1QVG Y;  2RHB A;  3I56 1;  3CCJ Z;  3G6E 1;  4A3M I;  1KRL A;  4NH1 C;  3G71 Z;  3TDH B;  5C3E I;  2B63 I;  1VQ4 1;  2H85 A;  1YJ9 1;  1Q81 1;  2HF1 A;  1FDO A;  1YJN Z;  2V8J A;  5T67 A;  1RNI A;  1ZB9 A;  3J7A 4;  3VMH A;  1Z03 A;  1YHQ Z;  5D1P A;  1M1K 1;  1VQN Z;  1Y1V S;  3KIH A;  1KD1 1;  1KQS Z;  4A3B I;  1USP B;  2GTH A;  2WB1 A;  2Q4Z A;  1TWC I;  2P28 A;  1X3W A;  3F3P C;  1L1O C;  2RPR A;  1SFO I;  3I55 1;  4NOZ A;  1RO2 A;  4MON A;  1VQ6 Z;  3TE5 B;  4XX2 A;  1WII A;  1PFT A;  1VQP Z;  3CPW Y;  3J80 b;  3G4S 1;  3CQZ I;  2NVY I;  4A3J I;  3I4N I;  4E30 A;  1K8A 2;  3J81 b;  2QEX 1;  1RO4 A;  2E2I I;  2V8I A;  1Q7Y 1;  2LIY A;  4E2Z A;  1I6H I;  3IF8 A;  3I56 Z;  3G6E Z;  4A3K I;  1KC8 2;  3I07 A;  1VQ4 Z;  1S7M A;  2AYD A;  2JA7 I;  3K7A I;  5C4X I;  1QVF Z;  3QWU A;  2I3C A;  3D2L A;  1YJW 1;  1NUI A;  3OW2 Z;  3CC2 1;  1S72 1;  3HKZ A;  3BG1 B;  2R93 I;  4NBD A;  1I3Q I;  3CC7 1;  2KI7 B;  1W2B Z;  1Q82 1;  3D9X A;  5T6B A; 
#chains in the Genus database with same CATH homology
 3U50 C;  3RZD I;  3S16 I;  3MZK B;  3I55 Z;  3IX0 A;  2Q51 A;  1VQO 1;  1JJ2 Y;  4BY7 I;  1M90 2;  1K9M 1;  3G4S Z;  5CM2 M;  2OOY B;  3CXC Z;  2PK7 A;  2EGT A;  1YIJ 1;  3S1R I;  2OTJ Z;  4Y7N I;  1QYP A;  4NBH A;  4E2X A;  2YU9 I;  2V8K A;  2QEX Z;  2VF1 A;  5IT9 b;  4QTT A;  2DE7 A;  1VQK 1;  4NB9 A;  3GTL I;  2QR1 B;  3CCR 1;  5IT9 f;  3CD6 1;  3CCS Z;  3CCU Z;  3MZL B;  1YIT Z;  1TWG I;  1N8R 1;  4RVF A;  3S15 I;  4NFR A;  3CCM 1;  3IFU A;  1P9N A;  1YJW Z;  1VQ9 1;  4E31 A;  3CC2 Z;  3H0G I;  2OTL 1;  1VQ7 1;  4NBA A;  5AN9 F;  1YUA A;  4MRI A;  1NP6 A;  1TFI A;  4EWC A;  3CCE 1;  3CCV Z;  2NVQ I;  2AKL A;  3NH5 A;  3NH8 A;  4RVG A;  3NDI A;  1Q86 1;  5D1O B;  1YI2 1;  4E33 A;  1VQO Z;  2JR6 A;  2E2J I;  2DE5 A;  1RLY A;  5FLM I;  1DL6 A;  4NBG A;  4RV9 A;  1TWA I;  2KPI A;  3PO3 I;  4NBB A;  2PM9 A;  3ESW A;  3RZO I;  3GTG I;  1Q81 2;  1K83 I;  2M48 A;  4BBR I;  1JWH C;  4DK1 A;  1VQ5 Z;  2BJO A;  1VQK Z;  3CD6 Z;  1VQ8 1;  1Z02 A;  3CMA Z;  1X3Z A;  3EED A;  1Z01 A;  2RIQ A;  3T4N B;  1M1K 2;  5FLX f;  3CC4 1;  2HU9 A;  4NBF A;  1KD1 2;  1YJ9 Z;  2R92 I;  3GTM I;  1QF8 A;  3KIF A;  1RQF A;  3GCF A;  2OTL Z;  4X6A I;  3JAM b;  4RVH A;  1KQS Y;  4MD8 A;  1K73 2;  2JMO A;  2LFU A;  3PO3 S;  4RS4 A;  3CCE Z;  3CCL 1;  3JAM f;  3CCJ 1;  3MON A;  1YUK A;  1USP A;  2QRD B;  2JA6 I;  1VLA A;  1YI2 Z;  3Q87 A;  1LQL A;  1QVG Z;  1I50 I;  3NDJ A;  2QRC B;  5IP9 I;  1N2F A;  2RT9 A;  4TNU A;  3CCQ 1;  1NJI 1;  1YJN 1;  1Q7Y 2;  2JA8 I;  2JA5 I;  4MH4 A;  1VQN 1;  4AYB A;  3BG0 B;  4CL1 A;  5IP7 I;  4BBS I;  3S1Q I;  4DGL A;  3VMI A;  3NFZ A;  2OZK A;  3GTO I;  2JS4 A;  1QVF Y;  2JUB A;  2IZ4 A;  1ZH1 A;  2IZ3 A;  1Q82 2;  1VQP 1;  4A3L I;  3FKI I;  4HH4 A;  3VMG A;  2K3R A;  4A3C I;  1Y1V I;  3GTP I;  4A3D I;  4HGY A;  3CPW Z;  1W2B Y;  1S72 Z;  3CC7 Z;  1VQL 1;  1K9M 2;  4E2W A;  2P3Y A;  3GKQ A;  4DQY B;  3H3V J;  2JNY A;  4MD9 A;  3VTN A;  2QLV B;  1K8A 1;  3CXC Y;  3I4M I;  4NBE A;  3CCQ Z;  2G2K A;  3S2D I;  2QA4 1;  1R9T I;  1KC8 1;  1TWH I;  1YIJ Z;  2RBL A;  2DE6 A;  3CME 1;  4NBC A;  4RVD A;  1N8R 2;  3S2H I;  4E32 A;  3GTQ I;  2R6M A;  2E9H A;  1Y1W I;  2QRE B;  3LUS A;  2QKD A;  5A2Q b;  2GU2 A;  4QTU A;  4BY1 I;  5C4J I;  2R7Z I;  5FLX b;  3CCR Z;  1K73 1;  3FQQ A;  3S14 I;  3NH4 A;  2K5R A;  5A2Q f;  1VQM 1;  3HOV I;  1WW9 A;  1ML8 A;  4A93 I;  2OTJ 1;  1JJ2 Z;  3CCM Z;  3GTJ I;  3J80 f;  1VQ9 Z;  1Q86 2;  4MD7 A;  1VQ7 Z;  4A3E I;  1WCM I;  3P5J B;  3J81 f;  1VQL Z;  3S1M I;  1M90 1;  1TWF I;  3CCS 1;  3S1N I;  2WAQ A;  3M3Y I;  3CCU 1;  4A3I I;  2E2H I;  1ZB8 A;  2PMZ A;  1YIT 1;  3G71 1;  3S17 I;  2F4M A;  3EER A;  5D1O A;  5C44 I;  4Y52 I;  1X0T A;  2Y0S A;  3HOY I;  2QA4 Z;  4NB8 A;  3FQM A;  2W04 A;  2J6A A;  3GTM S;  3CME Z;  1YHQ 1;  1RO0 A;  3HOU I;  2O53 A;  3CCV 1;  4A3F I;  4E2Y A;  2YAD A;  4MXU A;  4S1T A;  2VUG A;  2O4H A;  3HOX I;  2F4O A;  2ZAE B;  3VB9 A;  4BXX I;  2OOX B;  3GTK I;  5T64 A;  2W03 A;  1VQ8 Z;  2VUM I;  3D6W A;  1VQM Z;  4HGZ A;  3PO2 I;  3F3F C;  1VQ6 1;  3CC4 Z;  3HOW I;  3HOZ I;  3OW2 Y;  2NVT I;  4A3G I;  1VQ5 1;  2NVX I;  1NJI 2;  2M6N A;  3CCL Z;  5LL6 f;  3CMA 1;  3M4O I;  2GTI A;  1QVG Y;  2RHB A;  3I56 1;  3CCJ Z;  3G6E 1;  4A3M I;  1KRL A;  4NH1 C;  3G71 Z;  3TDH B;  5C3E I;  2B63 I;  1VQ4 1;  2H85 A;  1YJ9 1;  1Q81 1;  2HF1 A;  1YJN Z;  2V8J A;  5T67 A;  1RNI A;  1ZB9 A;  3J7A 4;  3VMH A;  1Z03 A;  1YHQ Z;  5D1P A;  1M1K 1;  1VQN Z;  1Y1V S;  3KIH A;  1KD1 1;  1KQS Z;  4A3B I;  1USP B;  2GTH A;  2WB1 A;  2Q4Z A;  1TWC I;  2P28 A;  1X3W A;  3F3P C;  1L1O C;  2RPR A;  1SFO I;  3I55 1;  4NOZ A;  1RO2 A;  4MON A;  1VQ6 Z;  3TE5 B;  4XX2 A;  1WII A;  1PFT A;  1VQP Z;  3CPW Y;  3J80 b;  3G4S 1;  3CQZ I;  2NVY I;  4A3J I;  3I4N I;  4E30 A;  1K8A 2;  3J81 b;  2QEX 1;  1RO4 A;  2E2I I;  2V8I A;  1Q7Y 1;  2LIY A;  4E2Z A;  1I6H I;  3IF8 A;  3I56 Z;  3G6E Z;  4A3K I;  1KC8 2;  3I07 A;  1VQ4 Z;  1S7M A;  2JA7 I;  3K7A I;  5C4X I;  1QVF Z;  3QWU A;  2I3C A;  1YJW 1;  1NUI A;  3OW2 Z;  3CC2 1;  1S72 1;  3HKZ A;  3BG1 B;  2R93 I;  4NBD A;  1I3Q I;  3CC7 1;  2KI7 B;  1W2B Z;  1Q82 1;  3D9X A;  5T6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...