4MD8A

Crystal structure of full-length symmetric ck2 holoenzyme with mutated alpha subunit (f121e)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
199
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 199
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md8A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md8A02
4MD8A 3EEDA 4NH1C 2M48A 2JMOA 1JWHC 4DGLA 2R6MA 1RQFA 4MD9A 1QF8A 2RT9A 4MD7A 2M6NA
chains in the Genus database with same CATH superfamily
1Q812 2G2KA 2KPIA 2R92I 2OTL1 5D1PA 2QR1B 1YJN1 2P28A 3S1NI 5C44I 3G711 1VQMZ 4BXXI 3IR7A 3CME1 3I561 4AYBA 1Y1VS 1YUAA 4EWCA 3S14I 3VTNA 1VQ41 1VQ8Z 5T67A 1VQ61 1S721 2IZ4A 1Q811 4Y52I 4A3JI 2YADA 3NDIA 2R93I 4A3KI 3I4NI 4A3CI 2OTJ1 1Y1VI 3D9XA 1DL6A 4A3MI 3GKQA 3LUSA 4NB8A 3GTGI 4MONA 2QA4Z 1N8R2 4RVGA 2JMOA 5C4XI 1NJI2 3GCFA 2E2JI 2NVQI 3M3YI 2NVXI 2YU9I 3K7AI 5C3EI 1I3QI 4BBRI 2F4OA 3MONA 1NUIA 1Q822 1VQO1 3D2LA 3U50C 2Y0SA 3CCL1 3F3PC 4MH4A 1N8R1 3VMGA 4MD9A 2IV2X 1NJI1 1YJWZ 1WZNA 3I07A 1M902 2VF1A 3CD6Z 4MD7A 3I4MI 1VQLZ 3G4SZ 3I55Z 2Q4ZA 1RQFA 5D1OA 2RPRA 2NVYI 3OW2Z 1Q821 3CC4Z 1WIIA 2PK7A 4QTTA 2K5RA 4RVHA 4XX2A 1YHQZ 1SFOI 2JIOA 5LL6f 3GTPI 2IZ3A 1M901 1VQ5Z 2B63I 2LIYA 2VPZA 3CC71 3IX0A 1VQN1 1KRLA 3CMAZ 1ML8A 1KC82 3S2HI 3CPWY 3CCUZ 3Q87A 2K3RA 1X0TA 3GTMS 4NBEA 4MRIA 3P5JB 3CPWZ 2M6NA 5IP9I 1Z02A 2DE6A 4RS4A 2VUMI 1AA6A 3H3VJ 1TWAI 2V8KA 2QEX1 3F3FC 5T64A 1M1K1 1QVFY 4BBSI 3GTMI 1JJ2Z 3NH8A 4MXUA 3CCM1 3S17I 3CCS1 4A3FI 3CCQZ 2V3VA 3EEDA 4NBFA 4BY1I 3PO3I 2NAPA 3GTKI 4Y7NI 2QRDB 4A93I 1RO4A 5IP7I 2GTIA 1Y8CA 3FQQA 4A3GI 3CCE1 1TWFI 1Z01A 2PMZA 4HH4A 4RVFA 2O4HA 1VQ91 4X6AI 2LFUA 3S1RI 4A3EI 3IFUA 3NH5A 3T4NB 1ZH1A 2JA5I 2E7ZA 1Q16A 4A3LI 4NBGA 2VPXA 2VPYA 1YJW1 2I3CA 2RIQA 1QXFA 1VQ7Z 2JNYA 4E2WA 4NH1C 4E2XA 1YJ91 1VQL1 3CCRZ 2W04A 4S1TA 4DK1A 2P3YA 2OTLZ 3CCV1 3CC41 1K732 1YJNZ 2H85A 3S1QI 2KI7B 2JA6I 2QREB 3GTLI 1N2FA 3CMEZ 3KIFA 1P9NA 3I56Z 1K8A2 2E2HI 1VQ51 1SIWA 1VQ4Z 3G6E1 1VQP1 1VQ6Z 1S72Z 4A3BI 2R7ZI 3CXCY 3OW2Y 3VB9A 2NVTI 3CC21 1K731 1K83I 3CXCZ 3CCU1 2DE5A 2E2II 3EERA 1K8A1 3GTJI 4E31A 3RZDI 1S7MA 2V45A 1KQSY 3S1MI 1TWGI 3CCJ1 1RO2A 1KQSZ 3FKII 3BG1B 1X3ZA 5C4JI 2QLVB 5IT9f 1YI21 3J7A4 1ZB9A 1QF8A 3J80f 2J6AA 3TDHB 1M1K2 1YIJ1 1VQOZ 1YIT1 3CCLZ 5AN9F 3HOUI 1RLYA 3HOXI 5FLXb 1VQM1 4NB9A 3PO3S 1RO0A 2VUGA 4HGZA 1VQKZ 5IT9b 4RVDA 2R6MA 2AYDA 2JIRA 2WB1A 1VQ81 1JJ2Y 2JS4A 3J80b 1RNIA 4TNUA 1QVGZ 2JA7I 1FDOA 1VLAA 2HU9A 4NFRA 4QTUA 2V8JA 3VMIA 2JUBA 1TWCI 3BG0B 4NOZA 4NBCA 2QA41 3CC7Z 3KIHA 1VQ71 1LQLA 3RZOI 3ESWA 3S2DI 1WCMI 2DE7A 1L1OC 1TWHI 3J81b 2OOXB 1WW9A 5CM2M 1Y1WI 2QEXZ 2JIQA 1Q862 3GTOI 2QKDA 2VPWA 2RHBA 3CD61 3G4S1 3I551 3IF8A 3HOYI 2QRCB 1YUKA 3TE5B 1I50I 3FQMA 3CCMZ 3CCSZ 3CQZI 1KD12 1USPB 1YHQ1 1Q861 2E9HA 3G71Z 2LEXA 2WAQA 4E2YA 3CCEZ 1K9M2 1Z03A 2BJOA 1W2BY 4E30A 1X3WA 1TFIA 1W2BZ 3D6WA 1FDIA 3CMA1 2RT9A 3VMHA 1WJ2A 1VQ9Z 2Q51A 4NBHA 1KD11 2JA8I 1NP6A 1R9TI 2EGTA 2OTJZ 4E33A 4E2ZA 3JAMf 1K9M1 1PFTA 2PM9A 1ZB8A 5FLXf 1QYPA 1I6HI 2AKLA 1YJ9Z 3M4OI 4NBAA 1VQK1 3NDJA 4DGLA 2HF1A 3HOWI 3QWUA 4NBBA 5T6BA 3CCVZ 2ZAEB 5FLMI 3S16I 3NFZA 2W03A 4A3DI 2JIPA 4E32A 3CCQ1 3HOVI 3JAMb 4MD8A 2OOYB 4BY7I 2F4MA 5A2Qf 3G6EZ 4DQYB 1VQPZ 4CL1A 2JR6A 4HGYA 4RV9A 1Q7Y2 3CC2Z 3MZKB 1QVGY 3NH4A 2RBLA 3PO2I 3HOZI 3MZLB 2V8IA 3S15I 4NBDA 3J81f 2OZKA 3H0GI 5D1OB 2M48A 3CCJZ 3HKZA 5A2Qb 1Q7Y1 2GTHA 1USPA 3GTQI 1VQNZ 2GU2A 1YI2Z 1KC81 1JWHC 2JIMA 2O53A 1QVFZ 3CCR1 1YIJZ 4A3II 1YITZ
chains in the Genus database with same CATH topology
1Q812 2G2KA 2KPIA 2R92I 2OTL1 5D1PA 2QR1B 1YJN1 2P28A 3S1NI 5C44I 3G711 1VQMZ 4BXXI 3CME1 3I561 4AYBA 1Y1VS 1YUAA 4EWCA 3S14I 3VTNA 1VQ41 1VQ8Z 5T67A 1VQ61 1S721 2IZ4A 1Q811 4Y52I 4A3JI 2YADA 3NDIA 2R93I 4A3KI 3I4NI 4A3CI 2OTJ1 1Y1VI 3D9XA 1DL6A 4A3MI 3GKQA 3LUSA 4NB8A 3GTGI 4MONA 2QA4Z 1N8R2 4RVGA 2JMOA 5C4XI 1NJI2 3GCFA 2E2JI 2NVQI 3M3YI 2NVXI 2YU9I 3K7AI 5C3EI 1I3QI 4BBRI 2F4OA 3MONA 1NUIA 1Q822 1VQO1 3U50C 2Y0SA 3CCL1 3F3PC 4MH4A 1N8R1 3VMGA 4MD9A 1NJI1 1YJWZ 3I07A 1M902 2VF1A 3CD6Z 4MD7A 3I4MI 1VQLZ 3G4SZ 3I55Z 2Q4ZA 1RQFA 5D1OA 2RPRA 2NVYI 3OW2Z 1Q821 3CC4Z 1WIIA 2PK7A 4QTTA 2K5RA 4RVHA 4XX2A 1YHQZ 1SFOI 5LL6f 3GTPI 2IZ3A 1M901 1VQ5Z 2B63I 2LIYA 3CC71 3IX0A 1VQN1 1KRLA 3CMAZ 1ML8A 1KC82 3S2HI 3CPWY 3CCUZ 3Q87A 2K3RA 1X0TA 3GTMS 4NBEA 4MRIA 3P5JB 3CPWZ 2M6NA 5IP9I 1Z02A 2DE6A 4RS4A 2VUMI 3H3VJ 1TWAI 2V8KA 2QEX1 3F3FC 5T64A 1M1K1 1QVFY 4BBSI 3GTMI 1JJ2Z 3NH8A 4MXUA 3CCM1 3S17I 3CCS1 4A3FI 3CCQZ 3EEDA 4NBFA 4BY1I 3PO3I 3GTKI 4Y7NI 2QRDB 4A93I 1RO4A 5IP7I 2GTIA 3FQQA 4A3GI 3CCE1 1TWFI 1Z01A 2PMZA 4HH4A 4RVFA 2O4HA 1VQ91 4X6AI 2LFUA 3S1RI 4A3EI 3IFUA 3NH5A 3T4NB 1ZH1A 2JA5I 4A3LI 4NBGA 1YJW1 2I3CA 2RIQA 1VQ7Z 2JNYA 4E2WA 4NH1C 4E2XA 1YJ91 1VQL1 3CCRZ 2W04A 4S1TA 4DK1A 2P3YA 2OTLZ 3CCV1 3CC41 1K732 1YJNZ 2H85A 3S1QI 2KI7B 2JA6I 2QREB 3GTLI 1N2FA 3CMEZ 3KIFA 1P9NA 3I56Z 1K8A2 2E2HI 1VQ51 1VQ4Z 3G6E1 1VQP1 1VQ6Z 1S72Z 4A3BI 2R7ZI 3CXCY 3OW2Y 3VB9A 2NVTI 3CC21 1K731 1K83I 3CXCZ 3CCU1 2DE5A 2E2II 3EERA 1K8A1 3GTJI 4E31A 3RZDI 1S7MA 1KQSY 3S1MI 1TWGI 3CCJ1 1RO2A 1KQSZ 3FKII 3BG1B 1X3ZA 5C4JI 2QLVB 5IT9f 1YI21 3J7A4 1ZB9A 1QF8A 3J80f 2J6AA 3TDHB 1M1K2 1YIJ1 1VQOZ 1YIT1 3CCLZ 5AN9F 3HOUI 1RLYA 3HOXI 5FLXb 1VQM1 4NB9A 3PO3S 1RO0A 2VUGA 4HGZA 1VQKZ 5IT9b 4RVDA 2R6MA 2WB1A 1VQ81 1JJ2Y 2JS4A 3J80b 1RNIA 4TNUA 1QVGZ 2JA7I 1VLAA 2HU9A 4NFRA 4QTUA 2V8JA 3VMIA 2JUBA 1TWCI 3BG0B 4NOZA 4NBCA 2QA41 3CC7Z 3KIHA 1VQ71 1LQLA 3RZOI 3ESWA 3S2DI 1WCMI 2DE7A 1L1OC 1TWHI 3J81b 2OOXB 1WW9A 5CM2M 1Y1WI 2QEXZ 1Q862 3GTOI 2QKDA 2RHBA 3CD61 3G4S1 3I551 3IF8A 3HOYI 2QRCB 1YUKA 3TE5B 1I50I 3FQMA 3CCMZ 3CCSZ 3CQZI 1KD12 1USPB 1YHQ1 1Q861 2E9HA 3G71Z 2WAQA 4E2YA 3CCEZ 1K9M2 1Z03A 2BJOA 1W2BY 4E30A 1X3WA 1TFIA 1W2BZ 3D6WA 3CMA1 2RT9A 3VMHA 1VQ9Z 2Q51A 4NBHA 1KD11 2JA8I 1NP6A 1R9TI 2EGTA 2OTJZ 4E33A 4E2ZA 3JAMf 1K9M1 1PFTA 2PM9A 1ZB8A 5FLXf 1QYPA 1I6HI 2AKLA 1YJ9Z 3M4OI 4NBAA 1VQK1 3NDJA 4DGLA 2HF1A 3HOWI 3QWUA 4NBBA 5T6BA 3CCVZ 2ZAEB 5FLMI 3S16I 3NFZA 2W03A 4A3DI 4E32A 3CCQ1 3HOVI 3JAMb 4MD8A 2OOYB 4BY7I 2F4MA 5A2Qf 3G6EZ 4DQYB 1VQPZ 4CL1A 2JR6A 4HGYA 4RV9A 1Q7Y2 3CC2Z 3MZKB 1QVGY 3NH4A 2RBLA 3PO2I 3HOZI 3MZLB 2V8IA 3S15I 4NBDA 3J81f 2OZKA 3H0GI 5D1OB 2M48A 3CCJZ 3HKZA 5A2Qb 1Q7Y1 2GTHA 1USPA 3GTQI 1VQNZ 2GU2A 1YI2Z 1KC81 1JWHC 2O53A 1QVFZ 3CCR1 1YIJZ 4A3II 1YITZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD8 A;  3EED A;  4NH1 C;  2M48 A;  2JMO A;  1JWH C;  4DGL A;  2R6M A;  1RQF A;  4MD9 A;  1QF8 A;  2RT9 A;  4MD7 A;  2M6N A; 
#chains in the Genus database with same CATH topology
 1Q81 2;  2G2K A;  2KPI A;  2R92 I;  2OTL 1;  5D1P A;  2QR1 B;  1YJN 1;  2P28 A;  3S1N I;  5C44 I;  3G71 1;  1VQM Z;  4BXX I;  3IR7 A;  3CME 1;  3I56 1;  4AYB A;  1Y1V S;  1YUA A;  4EWC A;  3S14 I;  3VTN A;  1VQ4 1;  1VQ8 Z;  5T67 A;  1VQ6 1;  1S72 1;  2IZ4 A;  1Q81 1;  4Y52 I;  4A3J I;  2YAD A;  3NDI A;  2R93 I;  4A3K I;  3I4N I;  4A3C I;  2OTJ 1;  1Y1V I;  3D9X A;  1DL6 A;  4A3M I;  3GKQ A;  3LUS A;  4NB8 A;  3GTG I;  4MON A;  2QA4 Z;  1N8R 2;  4RVG A;  2JMO A;  5C4X I;  1NJI 2;  3GCF A;  2E2J I;  2NVQ I;  3M3Y I;  2NVX I;  2YU9 I;  3K7A I;  5C3E I;  1I3Q I;  4BBR I;  2F4O A;  3MON A;  1NUI A;  1Q82 2;  1VQO 1;  3D2L A;  3U50 C;  2Y0S A;  3CCL 1;  3F3P C;  4MH4 A;  1N8R 1;  3VMG A;  4MD9 A;  2IV2 X;  1NJI 1;  1YJW Z;  1WZN A;  3I07 A;  1M90 2;  2VF1 A;  3CD6 Z;  4MD7 A;  3I4M I;  1VQL Z;  3G4S Z;  3I55 Z;  2Q4Z A;  1RQF A;  5D1O A;  2RPR A;  2NVY I;  3OW2 Z;  1Q82 1;  3CC4 Z;  1WII A;  2PK7 A;  4QTT A;  2K5R A;  4RVH A;  4XX2 A;  1YHQ Z;  1SFO I;  2JIO A;  5LL6 f;  3GTP I;  2IZ3 A;  1M90 1;  1VQ5 Z;  2B63 I;  2LIY A;  2VPZ A;  3CC7 1;  3IX0 A;  1VQN 1;  1KRL A;  3CMA Z;  1ML8 A;  1KC8 2;  3S2H I;  3CPW Y;  3CCU Z;  3Q87 A;  2K3R A;  1X0T A;  3GTM S;  4NBE A;  4MRI A;  3P5J B;  3CPW Z;  2M6N A;  5IP9 I;  1Z02 A;  2DE6 A;  4RS4 A;  2VUM I;  1AA6 A;  3H3V J;  1TWA I;  2V8K A;  2QEX 1;  3F3F C;  5T64 A;  1M1K 1;  1QVF Y;  4BBS I;  3GTM I;  1JJ2 Z;  3NH8 A;  4MXU A;  3CCM 1;  3S17 I;  3CCS 1;  4A3F I;  3CCQ Z;  2V3V A;  3EED A;  4NBF A;  4BY1 I;  3PO3 I;  2NAP A;  3GTK I;  4Y7N I;  2QRD B;  4A93 I;  1RO4 A;  5IP7 I;  2GTI A;  1Y8C A;  3FQQ A;  4A3G I;  3CCE 1;  1TWF I;  1Z01 A;  2PMZ A;  4HH4 A;  4RVF A;  2O4H A;  1VQ9 1;  4X6A I;  2LFU A;  3S1R I;  4A3E I;  3IFU A;  3NH5 A;  3T4N B;  1ZH1 A;  2JA5 I;  2E7Z A;  1Q16 A;  4A3L I;  4NBG A;  2VPX A;  2VPY A;  1YJW 1;  2I3C A;  2RIQ A;  1QXF A;  1VQ7 Z;  2JNY A;  4E2W A;  4NH1 C;  4E2X A;  1YJ9 1;  1VQL 1;  3CCR Z;  2W04 A;  4S1T A;  4DK1 A;  2P3Y A;  2OTL Z;  3CCV 1;  3CC4 1;  1K73 2;  1YJN Z;  2H85 A;  3S1Q I;  2KI7 B;  2JA6 I;  2QRE B;  3GTL I;  1N2F A;  3CME Z;  3KIF A;  1P9N A;  3I56 Z;  1K8A 2;  2E2H I;  1VQ5 1;  1SIW A;  1VQ4 Z;  3G6E 1;  1VQP 1;  1VQ6 Z;  1S72 Z;  4A3B I;  2R7Z I;  3CXC Y;  3OW2 Y;  3VB9 A;  2NVT I;  3CC2 1;  1K73 1;  1K83 I;  3CXC Z;  3CCU 1;  2DE5 A;  2E2I I;  3EER A;  1K8A 1;  3GTJ I;  4E31 A;  3RZD I;  1S7M A;  2V45 A;  1KQS Y;  3S1M I;  1TWG I;  3CCJ 1;  1RO2 A;  1KQS Z;  3FKI I;  3BG1 B;  1X3Z A;  5C4J I;  2QLV B;  5IT9 f;  1YI2 1;  3J7A 4;  1ZB9 A;  1QF8 A;  3J80 f;  2J6A A;  3TDH B;  1M1K 2;  1YIJ 1;  1VQO Z;  1YIT 1;  3CCL Z;  5AN9 F;  3HOU I;  1RLY A;  3HOX I;  5FLX b;  1VQM 1;  4NB9 A;  3PO3 S;  1RO0 A;  2VUG A;  4HGZ A;  1VQK Z;  5IT9 b;  4RVD A;  2R6M A;  2AYD A;  2JIR A;  2WB1 A;  1VQ8 1;  1JJ2 Y;  2JS4 A;  3J80 b;  1RNI A;  4TNU A;  1QVG Z;  2JA7 I;  1FDO A;  1VLA A;  2HU9 A;  4NFR A;  4QTU A;  2V8J A;  3VMI A;  2JUB A;  1TWC I;  3BG0 B;  4NOZ A;  4NBC A;  2QA4 1;  3CC7 Z;  3KIH A;  1VQ7 1;  1LQL A;  3RZO I;  3ESW A;  3S2D I;  1WCM I;  2DE7 A;  1L1O C;  1TWH I;  3J81 b;  2OOX B;  1WW9 A;  5CM2 M;  1Y1W I;  2QEX Z;  2JIQ A;  1Q86 2;  3GTO I;  2QKD A;  2VPW A;  2RHB A;  3CD6 1;  3G4S 1;  3I55 1;  3IF8 A;  3HOY I;  2QRC B;  1YUK A;  3TE5 B;  1I50 I;  3FQM A;  3CCM Z;  3CCS Z;  3CQZ I;  1KD1 2;  1USP B;  1YHQ 1;  1Q86 1;  2E9H A;  3G71 Z;  2LEX A;  2WAQ A;  4E2Y A;  3CCE Z;  1K9M 2;  1Z03 A;  2BJO A;  1W2B Y;  4E30 A;  1X3W A;  1TFI A;  1W2B Z;  3D6W A;  1FDI A;  3CMA 1;  2RT9 A;  3VMH A;  1WJ2 A;  1VQ9 Z;  2Q51 A;  4NBH A;  1KD1 1;  2JA8 I;  1NP6 A;  1R9T I;  2EGT A;  2OTJ Z;  4E33 A;  4E2Z A;  3JAM f;  1K9M 1;  1PFT A;  2PM9 A;  1ZB8 A;  5FLX f;  1QYP A;  1I6H I;  2AKL A;  1YJ9 Z;  3M4O I;  4NBA A;  1VQK 1;  3NDJ A;  4DGL A;  2HF1 A;  3HOW I;  3QWU A;  4NBB A;  5T6B A;  3CCV Z;  2ZAE B;  5FLM I;  3S16 I;  3NFZ A;  2W03 A;  4A3D I;  2JIP A;  4E32 A;  3CCQ 1;  3HOV I;  3JAM b;  4MD8 A;  2OOY B;  4BY7 I;  2F4M A;  5A2Q f;  3G6E Z;  4DQY B;  1VQP Z;  4CL1 A;  2JR6 A;  4HGY A;  4RV9 A;  1Q7Y 2;  3CC2 Z;  3MZK B;  1QVG Y;  3NH4 A;  2RBL A;  3PO2 I;  3HOZ I;  3MZL B;  2V8I A;  3S15 I;  4NBD A;  3J81 f;  2OZK A;  3H0G I;  5D1O B;  2M48 A;  3CCJ Z;  3HKZ A;  5A2Q b;  1Q7Y 1;  2GTH A;  1USP A;  3GTQ I;  1VQN Z;  2GU2 A;  1YI2 Z;  1KC8 1;  1JWH C;  2JIM A;  2O53 A;  1QVF Z;  3CCR 1;  1YIJ Z;  4A3I I;  1YIT Z; 
#chains in the Genus database with same CATH homology
 1Q81 2;  2G2K A;  2KPI A;  2R92 I;  2OTL 1;  5D1P A;  2QR1 B;  1YJN 1;  2P28 A;  3S1N I;  5C44 I;  3G71 1;  1VQM Z;  4BXX I;  3CME 1;  3I56 1;  4AYB A;  1Y1V S;  1YUA A;  4EWC A;  3S14 I;  3VTN A;  1VQ4 1;  1VQ8 Z;  5T67 A;  1VQ6 1;  1S72 1;  2IZ4 A;  1Q81 1;  4Y52 I;  4A3J I;  2YAD A;  3NDI A;  2R93 I;  4A3K I;  3I4N I;  4A3C I;  2OTJ 1;  1Y1V I;  3D9X A;  1DL6 A;  4A3M I;  3GKQ A;  3LUS A;  4NB8 A;  3GTG I;  4MON A;  2QA4 Z;  1N8R 2;  4RVG A;  2JMO A;  5C4X I;  1NJI 2;  3GCF A;  2E2J I;  2NVQ I;  3M3Y I;  2NVX I;  2YU9 I;  3K7A I;  5C3E I;  1I3Q I;  4BBR I;  2F4O A;  3MON A;  1NUI A;  1Q82 2;  1VQO 1;  3U50 C;  2Y0S A;  3CCL 1;  3F3P C;  4MH4 A;  1N8R 1;  3VMG A;  4MD9 A;  1NJI 1;  1YJW Z;  3I07 A;  1M90 2;  2VF1 A;  3CD6 Z;  4MD7 A;  3I4M I;  1VQL Z;  3G4S Z;  3I55 Z;  2Q4Z A;  1RQF A;  5D1O A;  2RPR A;  2NVY I;  3OW2 Z;  1Q82 1;  3CC4 Z;  1WII A;  2PK7 A;  4QTT A;  2K5R A;  4RVH A;  4XX2 A;  1YHQ Z;  1SFO I;  5LL6 f;  3GTP I;  2IZ3 A;  1M90 1;  1VQ5 Z;  2B63 I;  2LIY A;  3CC7 1;  3IX0 A;  1VQN 1;  1KRL A;  3CMA Z;  1ML8 A;  1KC8 2;  3S2H I;  3CPW Y;  3CCU Z;  3Q87 A;  2K3R A;  1X0T A;  3GTM S;  4NBE A;  4MRI A;  3P5J B;  3CPW Z;  2M6N A;  5IP9 I;  1Z02 A;  2DE6 A;  4RS4 A;  2VUM I;  3H3V J;  1TWA I;  2V8K A;  2QEX 1;  3F3F C;  5T64 A;  1M1K 1;  1QVF Y;  4BBS I;  3GTM I;  1JJ2 Z;  3NH8 A;  4MXU A;  3CCM 1;  3S17 I;  3CCS 1;  4A3F I;  3CCQ Z;  3EED A;  4NBF A;  4BY1 I;  3PO3 I;  3GTK I;  4Y7N I;  2QRD B;  4A93 I;  1RO4 A;  5IP7 I;  2GTI A;  3FQQ A;  4A3G I;  3CCE 1;  1TWF I;  1Z01 A;  2PMZ A;  4HH4 A;  4RVF A;  2O4H A;  1VQ9 1;  4X6A I;  2LFU A;  3S1R I;  4A3E I;  3IFU A;  3NH5 A;  3T4N B;  1ZH1 A;  2JA5 I;  4A3L I;  4NBG A;  1YJW 1;  2I3C A;  2RIQ A;  1VQ7 Z;  2JNY A;  4E2W A;  4NH1 C;  4E2X A;  1YJ9 1;  1VQL 1;  3CCR Z;  2W04 A;  4S1T A;  4DK1 A;  2P3Y A;  2OTL Z;  3CCV 1;  3CC4 1;  1K73 2;  1YJN Z;  2H85 A;  3S1Q I;  2KI7 B;  2JA6 I;  2QRE B;  3GTL I;  1N2F A;  3CME Z;  3KIF A;  1P9N A;  3I56 Z;  1K8A 2;  2E2H I;  1VQ5 1;  1VQ4 Z;  3G6E 1;  1VQP 1;  1VQ6 Z;  1S72 Z;  4A3B I;  2R7Z I;  3CXC Y;  3OW2 Y;  3VB9 A;  2NVT I;  3CC2 1;  1K73 1;  1K83 I;  3CXC Z;  3CCU 1;  2DE5 A;  2E2I I;  3EER A;  1K8A 1;  3GTJ I;  4E31 A;  3RZD I;  1S7M A;  1KQS Y;  3S1M I;  1TWG I;  3CCJ 1;  1RO2 A;  1KQS Z;  3FKI I;  3BG1 B;  1X3Z A;  5C4J I;  2QLV B;  5IT9 f;  1YI2 1;  3J7A 4;  1ZB9 A;  1QF8 A;  3J80 f;  2J6A A;  3TDH B;  1M1K 2;  1YIJ 1;  1VQO Z;  1YIT 1;  3CCL Z;  5AN9 F;  3HOU I;  1RLY A;  3HOX I;  5FLX b;  1VQM 1;  4NB9 A;  3PO3 S;  1RO0 A;  2VUG A;  4HGZ A;  1VQK Z;  5IT9 b;  4RVD A;  2R6M A;  2WB1 A;  1VQ8 1;  1JJ2 Y;  2JS4 A;  3J80 b;  1RNI A;  4TNU A;  1QVG Z;  2JA7 I;  1VLA A;  2HU9 A;  4NFR A;  4QTU A;  2V8J A;  3VMI A;  2JUB A;  1TWC I;  3BG0 B;  4NOZ A;  4NBC A;  2QA4 1;  3CC7 Z;  3KIH A;  1VQ7 1;  1LQL A;  3RZO I;  3ESW A;  3S2D I;  1WCM I;  2DE7 A;  1L1O C;  1TWH I;  3J81 b;  2OOX B;  1WW9 A;  5CM2 M;  1Y1W I;  2QEX Z;  1Q86 2;  3GTO I;  2QKD A;  2RHB A;  3CD6 1;  3G4S 1;  3I55 1;  3IF8 A;  3HOY I;  2QRC B;  1YUK A;  3TE5 B;  1I50 I;  3FQM A;  3CCM Z;  3CCS Z;  3CQZ I;  1KD1 2;  1USP B;  1YHQ 1;  1Q86 1;  2E9H A;  3G71 Z;  2WAQ A;  4E2Y A;  3CCE Z;  1K9M 2;  1Z03 A;  2BJO A;  1W2B Y;  4E30 A;  1X3W A;  1TFI A;  1W2B Z;  3D6W A;  3CMA 1;  2RT9 A;  3VMH A;  1VQ9 Z;  2Q51 A;  4NBH A;  1KD1 1;  2JA8 I;  1NP6 A;  1R9T I;  2EGT A;  2OTJ Z;  4E33 A;  4E2Z A;  3JAM f;  1K9M 1;  1PFT A;  2PM9 A;  1ZB8 A;  5FLX f;  1QYP A;  1I6H I;  2AKL A;  1YJ9 Z;  3M4O I;  4NBA A;  1VQK 1;  3NDJ A;  4DGL A;  2HF1 A;  3HOW I;  3QWU A;  4NBB A;  5T6B A;  3CCV Z;  2ZAE B;  5FLM I;  3S16 I;  3NFZ A;  2W03 A;  4A3D I;  4E32 A;  3CCQ 1;  3HOV I;  3JAM b;  4MD8 A;  2OOY B;  4BY7 I;  2F4M A;  5A2Q f;  3G6E Z;  4DQY B;  1VQP Z;  4CL1 A;  2JR6 A;  4HGY A;  4RV9 A;  1Q7Y 2;  3CC2 Z;  3MZK B;  1QVG Y;  3NH4 A;  2RBL A;  3PO2 I;  3HOZ I;  3MZL B;  2V8I A;  3S15 I;  4NBD A;  3J81 f;  2OZK A;  3H0G I;  5D1O B;  2M48 A;  3CCJ Z;  3HKZ A;  5A2Q b;  1Q7Y 1;  2GTH A;  1USP A;  3GTQ I;  1VQN Z;  2GU2 A;  1YI2 Z;  1KC8 1;  1JWH C;  2O53 A;  1QVF Z;  3CCR 1;  1YIJ Z;  4A3I I;  1YIT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...