5C4XI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4xI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4xI02
2JS4A 1RO4A 2K5RA 2DE6A 4NBEA 3VB9A 1TWAI 2R92I 3EERA 4NOZA 4A3LI 4A3KI 3M3YI 3PO3S 1SFOI 3RZDI 3GTPI 3GTGI 2F4OA 2J6AA 1ML8A 2HF1A 3M4OI 1DL6A 3VMIA 2BJOA 3GCFA 2JA5I 4NBDA 3GTLI 2RBLA 4MH4A 4A3MI 5FLMI 4NB8A 3S1RI 4BY1I 2E2II 4Y52I 3S1QI 4Y7NI 3HOZI 1ZB9A 1R9TI 3Q87A 4A93I 1L1OC 1USPB 1Y1VS 4NBHA 2DE7A 5IP9I 5CM2M 4BXXI 5C4JI 2VUMI 1NUIA 3CQZI 5C44I 2P3YA 5C3EI 2JA7I 2NVTI 1TWHI 1Y1VI 3GTJI 4A3FI 1X3WA 4NBBA 4A3BI 4QTUA 2JR6A 3GKQA 4A3CI 2AKLA 1WCMI 3I07A 1Y1WI 2R93I 1LQLA 1TFIA 3ESWA 3U50C 4NB9A 2JA6I 1PFTA 4A3DI 1I3QI 1USPA 1TWFI 2DE5A 3GTQI 3S16I 1ZB8A 3S14I 1WW9A 2B63I 3FKII 5IP7I 3H0GI 4NBCA 4XX2A 2NVYI 3GTMS 3S2HI 4BBRI 1N2FA 1I6HI 3VMGA 3GTKI 3I4NI 2E2JI 2NVXI 3K7AI 3I4MI 4A3JI 3S2DI 3HOUI 1YUAA 3VMHA 3GTMI 3S17I 1K83I 3HOWI 3PO2I 4BBSI 3RZOI 1TWCI 4NBAA 2YU9I 4BY7I 3H3VJ 2F4MA 1TWGI 3HOYI 2R7ZI 1QYPA 4NBGA 5C4XI 2JA8I 3HOXI 4A3EI 3HOVI 2PK7A 2E2HI 1I50I 3D6WA 1RLYA 4X6AI 3PO3I 4QTTA 1X3ZA 3S1NI 2KPIA 4A3GI 4A3II 3GTOI 3S15I 3S1MI 4NBFA 1VLAA 3LUSA 2NVQI 2JNYA
chains in the Genus database with same CATH superfamily
1VQ5Z 2OOYB 2V3VA 3CCE1 2K5RA 3VB9A 1TWAI 1M902 5T6BA 4NOZA 4A3KI 1SFOI 3RZDI 3GTPI 1VQO1 3GTGI 2PMZA 2H85A 1W2BZ 2JUBA 2V8JA 2BJOA 3CCR1 3CCM1 1WZNA 1Q862 1RNIA 3OW2Y 5FLMI 3I561 1YITZ 5FLXf 4MONA 1VQKZ 3HOZI 2HU9A 4E30A 2JIPA 3IF8A 4A93I 1L1OC 1K9M2 4NH1C 2O53A 2IV2X 1K8A2 1Q812 2DE7A 1Q16A 2VUMI 3CQZI 5C44I 2NVTI 3TE5B 3P5JB 2V8IA 3CC71 1VQ8Z 1YHQ1 2Q51A 2GTHA 1Y1VI 4A3BI 1FDIA 3I07A 1K732 2JA6I 1PFTA 2GTIA 1VQ9Z 1ZB8A 3G71Z 1WW9A 2B63I 3FKII 3H0GI 4XX2A 2NVYI 1VQPZ 1YJW1 3CME1 1KD12 2QEXZ 4BBRI 1I6HI 3EEDA 1N8R2 2E2JI 2VPZA 4TNUA 2QKDA 1JWHC 3CXCZ 3CC41 4RVGA 3HOUI 2OTJZ 3CPWY 1YIJ1 3HOWI 2QR1B 4NBAA 1NJI1 1Q7Y2 2Y0SA 2E7ZA 4RS4A 1VQL1 3CCL1 1Q822 5C4XI 3NH5A 5IT9f 2KI7B 1VQ71 3JAMf 3CMAZ 2G2KA 3OW2Z 1VQ6Z 1RLYA 2KPIA 3S1MI 3BG1B 4NBFA 3CCJZ 2R93I 3G6E1 3NDIA 4MXUA 2JS4A 2NAPA 3J81f 1SIWA 2R92I 4A3LI 3PO3S 2E9HA 1S72Z 3G4SZ 1YJ91 1RO2A 1QF8A 4E31A 3D9XA 1DL6A 3GCFA 3J7A4 4NBDA 2RBLA 4NB8A 3CCEZ 2E2II 2JIQA 2R6MA 3S1QI 4Y7NI 1YJN1 1ZB9A 1VQ41 2QLVB 3CC2Z 1VQOZ 3FQQA 4NBHA 4BXXI 5D1PA 1NUIA 4AYBA 3CCRZ 3CCMZ 4NFRA 2P3YA 1WJ2A 2IZ4A 3I56Z 3GTJI 4QTUA 3GKQA 5A2Qf 3CPWZ 2AKLA 3QWUA 3HKZA 1Y1WI 3U50C 3ESWA 3I55Z 1I3QI 1TWFI 3CCS1 2DE5A 3S14I 2M6NA 1YHQZ 2QA41 3GTMS 3CCUZ 2WAQA 4A3JI 3D2LA 3VMHA 1K83I 3PO2I 4BBSI 3RZOI 1TWCI 4HH4A 3FQMA 3J80b 1VQM1 1YJWZ 3CMEZ 2F4MA 4HGYA 2RHBA 4E2WA 4NBGA 2JIMA 2JA8I 2VF1A 5T67A 4A3EI 1NJI2 3CC4Z 2PK7A 2LFUA 3F3PC 4MD9A 3PO3I 4QTTA 1YIJZ 3NDJA 1VQ81 4A3GI 3GTOI 1VQN1 1VLAA 2P28A 3MZKB 1RO4A 1VQLZ 3CCLZ 2DE6A 3IX0A 1VQ7Z 1VQ91 2J6AA 1ML8A 2AYDA 2HF1A 2K3RA 2GU2A 4RVFA 3VMIA 3G6EZ 3GTLI 3KIHA 3T4NB 4BY1I 3F3FC 4DK1A 2OZKA 3KIFA 1X0TA 3Q87A 2W03A 5T64A 1R9TI 1Y1VS 1KD11 5AN9F 5IP9I 5CM2M 5C4JI 2JA7I 1Z02A 4E2ZA 4RVHA 4NBBA 1KC81 2JR6A 1WCMI 1YJNZ 1VQ4Z 2IZ3A 3CMA1 2OTL1 1KQSY 2YADA 1RQFA 5FLXb 1Q821 4A3DI 1USPA 3CCQ1 1QVGY 4MRIA 3GTQI 3S16I 3CD61 1Z01A 3VTNA 2V45A 4NBCA 2I3CA 2ZAEB 3IR7A 3VMGA 2EGTA 3GTKI 3K7AI 2VUGA 3CCSZ 5LL6f 1YUAA 3S17I 5D1OA 4E2XA 1NP6A 2JIOA 2RT9A 1YI21 2M48A 3MZLB 3CCV1 2QA4Z 1VQ51 4HGZA 2YU9I 3CC21 1M1K1 3CC7Z 1ZH1A 4E2YA 3HOVI 2PM9A 3MONA 1I50I 3D6WA 1X3ZA 2O4HA 3BG0B 3S15I 3IFUA 4S1TA 2LIYA 1M901 2JNYA 3I4MI 1VQMZ 1Z03A 4RV9A 1YIT1 4NBEA 1VQK1 4EWCA 4CL1A 3EERA 3I551 3M3YI 1AA6A 1Q861 2F4OA 4DQYB 3M4OI 1YUKA 1VQNZ 5IT9b 1JJ2Y 2JA5I 1KQSZ 3JAMb 4MH4A 4A3MI 1Y8CA 3CCU1 3S1RI 1K9M1 4Y52I 4MD7A 1QVFY 1K8A1 1Q811 1QVGZ 3NFZA 1KRLA 1USPB 3J81b 2JIRA 5C3EI 1K731 3G711 2QRCB 3NH4A 1TWHI 4A3FI 1X3WA 1W2BY 1VQP1 4A3CI 2VPXA 2QEX1 1LQLA 1FDOA 1TFIA 4NB9A 1KC82 3J80f 5D1OB 2OOXB 2OTJ1 1YJ9Z 2JMOA 3NH8A 5IP7I 1N8R1 1QXFA 3S2HI 2RPRA 2OTLZ 2QRDB 1RO0A 2W04A 1N2FA 3I4NI 2NVXI 4E33A 3S2DI 3CCQZ 1S7MA 5A2Qb 1VQ61 1Q7Y1 3GTMI 2WB1A 3CD6Z 1P9NA 3TDHB 4E32A 1WIIA 4DGLA 3CCJ1 4BY7I 2LEXA 3H3VJ 1TWGI 3HOYI 2R7ZI 1QYPA 2VPYA 2QREB 4RVDA 3HOXI 1JJ2Z 2Q4ZA 1S721 3G4S1 1M1K2 2E2HI 4X6AI 3S1NI 1QVFZ 4MD8A 4A3II 2RIQA 1YI2Z 2V8KA 3CCVZ 3LUSA 2VPWA 2NVQI 3CXCY
chains in the Genus database with same CATH topology
1VQ5Z 2OOYB 3CCE1 2K5RA 3VB9A 1TWAI 1M902 5T6BA 4NOZA 4A3KI 1SFOI 3RZDI 3GTPI 1VQO1 3GTGI 2PMZA 2H85A 1W2BZ 2JUBA 2V8JA 2BJOA 3CCR1 3CCM1 1Q862 1RNIA 3OW2Y 5FLMI 3I561 1YITZ 5FLXf 4MONA 1VQKZ 3HOZI 2HU9A 4E30A 3IF8A 4A93I 1L1OC 1K9M2 4NH1C 2O53A 1K8A2 1Q812 2DE7A 2VUMI 3CQZI 5C44I 2NVTI 3TE5B 3P5JB 2V8IA 3CC71 1VQ8Z 1YHQ1 2Q51A 2GTHA 1Y1VI 4A3BI 3I07A 1K732 2JA6I 1PFTA 2GTIA 1VQ9Z 1ZB8A 3G71Z 1WW9A 2B63I 3FKII 3H0GI 4XX2A 2NVYI 1VQPZ 1YJW1 3CME1 1KD12 2QEXZ 4BBRI 1I6HI 3EEDA 1N8R2 2E2JI 4TNUA 2QKDA 1JWHC 3CXCZ 3CC41 4RVGA 3HOUI 2OTJZ 3CPWY 1YIJ1 3HOWI 2QR1B 4NBAA 1NJI1 1Q7Y2 2Y0SA 4RS4A 1VQL1 3CCL1 1Q822 5C4XI 3NH5A 5IT9f 2KI7B 1VQ71 3JAMf 3CMAZ 2G2KA 3OW2Z 1VQ6Z 1RLYA 2KPIA 3S1MI 3BG1B 4NBFA 3CCJZ 2R93I 3G6E1 3NDIA 4MXUA 2JS4A 3J81f 2R92I 4A3LI 3PO3S 2E9HA 1S72Z 3G4SZ 1YJ91 1RO2A 1QF8A 4E31A 3D9XA 1DL6A 3GCFA 3J7A4 4NBDA 2RBLA 4NB8A 3CCEZ 2E2II 2R6MA 3S1QI 4Y7NI 1YJN1 1ZB9A 1VQ41 2QLVB 3CC2Z 1VQOZ 3FQQA 4NBHA 4BXXI 5D1PA 1NUIA 4AYBA 3CCRZ 3CCMZ 4NFRA 2P3YA 2IZ4A 3I56Z 3GTJI 4QTUA 3GKQA 5A2Qf 3CPWZ 2AKLA 3QWUA 3HKZA 1Y1WI 3U50C 3ESWA 3I55Z 1I3QI 1TWFI 3CCS1 2DE5A 3S14I 2M6NA 1YHQZ 2QA41 3GTMS 3CCUZ 2WAQA 4A3JI 3VMHA 1K83I 3PO2I 4BBSI 3RZOI 1TWCI 4HH4A 3FQMA 3J80b 1VQM1 1YJWZ 3CMEZ 2F4MA 4HGYA 2RHBA 4E2WA 4NBGA 2JA8I 2VF1A 5T67A 4A3EI 1NJI2 3CC4Z 2PK7A 2LFUA 3F3PC 4MD9A 3PO3I 4QTTA 1YIJZ 3NDJA 1VQ81 4A3GI 3GTOI 1VQN1 1VLAA 2P28A 3MZKB 1RO4A 1VQLZ 3CCLZ 2DE6A 3IX0A 1VQ7Z 1VQ91 2J6AA 1ML8A 2HF1A 2K3RA 2GU2A 4RVFA 3VMIA 3G6EZ 3GTLI 3KIHA 3T4NB 4BY1I 3F3FC 4DK1A 2OZKA 3KIFA 1X0TA 3Q87A 2W03A 5T64A 1R9TI 1Y1VS 1KD11 5AN9F 5IP9I 5CM2M 5C4JI 2JA7I 1Z02A 4E2ZA 4RVHA 4NBBA 1KC81 2JR6A 1WCMI 1YJNZ 1VQ4Z 2IZ3A 3CMA1 2OTL1 1KQSY 2YADA 1RQFA 5FLXb 1Q821 4A3DI 1USPA 3CCQ1 1QVGY 4MRIA 3GTQI 3S16I 3CD61 1Z01A 3VTNA 4NBCA 2I3CA 2ZAEB 3VMGA 2EGTA 3GTKI 3K7AI 2VUGA 3CCSZ 5LL6f 1YUAA 3S17I 5D1OA 4E2XA 1NP6A 2RT9A 1YI21 2M48A 3MZLB 3CCV1 2QA4Z 1VQ51 4HGZA 2YU9I 3CC21 1M1K1 3CC7Z 1ZH1A 4E2YA 3HOVI 2PM9A 3MONA 1I50I 3D6WA 1X3ZA 2O4HA 3BG0B 3S15I 3IFUA 4S1TA 2LIYA 1M901 2JNYA 3I4MI 1VQMZ 1Z03A 4RV9A 1YIT1 4NBEA 1VQK1 4EWCA 4CL1A 3EERA 3I551 3M3YI 1Q861 2F4OA 4DQYB 3M4OI 1YUKA 1VQNZ 5IT9b 1JJ2Y 2JA5I 1KQSZ 3JAMb 4MH4A 4A3MI 3CCU1 3S1RI 1K9M1 4Y52I 4MD7A 1QVFY 1K8A1 1Q811 1QVGZ 1KRLA 3NFZA 1USPB 3J81b 5C3EI 1K731 3G711 2QRCB 3NH4A 1TWHI 4A3FI 1X3WA 1W2BY 1VQP1 4A3CI 2QEX1 1LQLA 1TFIA 4NB9A 1KC82 3J80f 5D1OB 2OOXB 2OTJ1 1YJ9Z 2JMOA 3NH8A 5IP7I 1N8R1 3S2HI 2RPRA 2OTLZ 2QRDB 1RO0A 2W04A 1N2FA 3I4NI 2NVXI 4E33A 3S2DI 3CCQZ 1S7MA 5A2Qb 1VQ61 1Q7Y1 3GTMI 2WB1A 3CD6Z 1P9NA 3TDHB 4E32A 1WIIA 4DGLA 3CCJ1 4BY7I 3H3VJ 1TWGI 3HOYI 2R7ZI 1QYPA 2QREB 4RVDA 3HOXI 1JJ2Z 2Q4ZA 1S721 3G4S1 1M1K2 2E2HI 4X6AI 3S1NI 1QVFZ 4MD8A 4A3II 2RIQA 1YI2Z 2V8KA 3CCVZ 3LUSA 2NVQI 3CXCY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS4 A;  1RO4 A;  2K5R A;  2DE6 A;  4NBE A;  3VB9 A;  1TWA I;  2R92 I;  3EER A;  4NOZ A;  4A3L I;  4A3K I;  3M3Y I;  3PO3 S;  1SFO I;  3RZD I;  3GTP I;  3GTG I;  2F4O A;  2J6A A;  1ML8 A;  2HF1 A;  3M4O I;  1DL6 A;  3VMI A;  2BJO A;  3GCF A;  2JA5 I;  4NBD A;  3GTL I;  2RBL A;  4MH4 A;  4A3M I;  5FLM I;  4NB8 A;  3S1R I;  4BY1 I;  2E2I I;  4Y52 I;  3S1Q I;  4Y7N I;  3HOZ I;  1ZB9 A;  1R9T I;  3Q87 A;  4A93 I;  1L1O C;  1USP B;  1Y1V S;  4NBH A;  2DE7 A;  5IP9 I;  5CM2 M;  4BXX I;  5C4J I;  2VUM I;  1NUI A;  3CQZ I;  5C44 I;  2P3Y A;  5C3E I;  2JA7 I;  2NVT I;  1TWH I;  1Y1V I;  3GTJ I;  4A3F I;  1X3W A;  4NBB A;  4A3B I;  4QTU A;  2JR6 A;  3GKQ A;  4A3C I;  2AKL A;  1WCM I;  3I07 A;  1Y1W I;  2R93 I;  1LQL A;  1TFI A;  3ESW A;  3U50 C;  4NB9 A;  2JA6 I;  1PFT A;  4A3D I;  1I3Q I;  1USP A;  1TWF I;  2DE5 A;  3GTQ I;  3S16 I;  1ZB8 A;  3S14 I;  1WW9 A;  2B63 I;  3FKI I;  5IP7 I;  3H0G I;  4NBC A;  4XX2 A;  2NVY I;  3GTM S;  3S2H I;  4BBR I;  1N2F A;  1I6H I;  3VMG A;  3GTK I;  3I4N I;  2E2J I;  2NVX I;  3K7A I;  3I4M I;  4A3J I;  3S2D I;  3HOU I;  1YUA A;  3VMH A;  3GTM I;  3S17 I;  1K83 I;  3HOW I;  3PO2 I;  4BBS I;  3RZO I;  1TWC I;  4NBA A;  2YU9 I;  4BY7 I;  3H3V J;  2F4M A;  1TWG I;  3HOY I;  2R7Z I;  1QYP A;  4NBG A;  5C4X I;  2JA8 I;  3HOX I;  4A3E I;  3HOV I;  2PK7 A;  2E2H I;  1I50 I;  3D6W A;  1RLY A;  4X6A I;  3PO3 I;  4QTT A;  1X3Z A;  3S1N I;  2KPI A;  4A3G I;  4A3I I;  3GTO I;  3S15 I;  3S1M I;  4NBF A;  1VLA A;  3LUS A;  2NVQ I;  2JNY A; 
#chains in the Genus database with same CATH topology
 1VQ5 Z;  2OOY B;  2V3V A;  3CCE 1;  2K5R A;  3VB9 A;  1TWA I;  1M90 2;  5T6B A;  4NOZ A;  4A3K I;  1SFO I;  3RZD I;  3GTP I;  1VQO 1;  3GTG I;  2PMZ A;  2H85 A;  1W2B Z;  2JUB A;  2V8J A;  2BJO A;  3CCR 1;  3CCM 1;  1WZN A;  1Q86 2;  1RNI A;  3OW2 Y;  5FLM I;  3I56 1;  1YIT Z;  5FLX f;  4MON A;  1VQK Z;  3HOZ I;  2HU9 A;  4E30 A;  2JIP A;  3IF8 A;  4A93 I;  1L1O C;  1K9M 2;  4NH1 C;  2O53 A;  2IV2 X;  1K8A 2;  1Q81 2;  2DE7 A;  1Q16 A;  2VUM I;  3CQZ I;  5C44 I;  2NVT I;  3TE5 B;  3P5J B;  2V8I A;  3CC7 1;  1VQ8 Z;  1YHQ 1;  2Q51 A;  2GTH A;  1Y1V I;  4A3B I;  1FDI A;  3I07 A;  1K73 2;  2JA6 I;  1PFT A;  2GTI A;  1VQ9 Z;  1ZB8 A;  3G71 Z;  1WW9 A;  2B63 I;  3FKI I;  3H0G I;  4XX2 A;  2NVY I;  1VQP Z;  1YJW 1;  3CME 1;  1KD1 2;  2QEX Z;  4BBR I;  1I6H I;  3EED A;  1N8R 2;  2E2J I;  2VPZ A;  4TNU A;  2QKD A;  1JWH C;  3CXC Z;  3CC4 1;  4RVG A;  3HOU I;  2OTJ Z;  3CPW Y;  1YIJ 1;  3HOW I;  2QR1 B;  4NBA A;  1NJI 1;  1Q7Y 2;  2Y0S A;  2E7Z A;  4RS4 A;  1VQL 1;  3CCL 1;  1Q82 2;  5C4X I;  3NH5 A;  5IT9 f;  2KI7 B;  1VQ7 1;  3JAM f;  3CMA Z;  2G2K A;  3OW2 Z;  1VQ6 Z;  1RLY A;  2KPI A;  3S1M I;  3BG1 B;  4NBF A;  3CCJ Z;  2R93 I;  3G6E 1;  3NDI A;  4MXU A;  2JS4 A;  2NAP A;  3J81 f;  1SIW A;  2R92 I;  4A3L I;  3PO3 S;  2E9H A;  1S72 Z;  3G4S Z;  1YJ9 1;  1RO2 A;  1QF8 A;  4E31 A;  3D9X A;  1DL6 A;  3GCF A;  3J7A 4;  4NBD A;  2RBL A;  4NB8 A;  3CCE Z;  2E2I I;  2JIQ A;  2R6M A;  3S1Q I;  4Y7N I;  1YJN 1;  1ZB9 A;  1VQ4 1;  2QLV B;  3CC2 Z;  1VQO Z;  3FQQ A;  4NBH A;  4BXX I;  5D1P A;  1NUI A;  4AYB A;  3CCR Z;  3CCM Z;  4NFR A;  2P3Y A;  1WJ2 A;  2IZ4 A;  3I56 Z;  3GTJ I;  4QTU A;  3GKQ A;  5A2Q f;  3CPW Z;  2AKL A;  3QWU A;  3HKZ A;  1Y1W I;  3U50 C;  3ESW A;  3I55 Z;  1I3Q I;  1TWF I;  3CCS 1;  2DE5 A;  3S14 I;  2M6N A;  1YHQ Z;  2QA4 1;  3GTM S;  3CCU Z;  2WAQ A;  4A3J I;  3D2L A;  3VMH A;  1K83 I;  3PO2 I;  4BBS I;  3RZO I;  1TWC I;  4HH4 A;  3FQM A;  3J80 b;  1VQM 1;  1YJW Z;  3CME Z;  2F4M A;  4HGY A;  2RHB A;  4E2W A;  4NBG A;  2JIM A;  2JA8 I;  2VF1 A;  5T67 A;  4A3E I;  1NJI 2;  3CC4 Z;  2PK7 A;  2LFU A;  3F3P C;  4MD9 A;  3PO3 I;  4QTT A;  1YIJ Z;  3NDJ A;  1VQ8 1;  4A3G I;  3GTO I;  1VQN 1;  1VLA A;  2P28 A;  3MZK B;  1RO4 A;  1VQL Z;  3CCL Z;  2DE6 A;  3IX0 A;  1VQ7 Z;  1VQ9 1;  2J6A A;  1ML8 A;  2AYD A;  2HF1 A;  2K3R A;  2GU2 A;  4RVF A;  3VMI A;  3G6E Z;  3GTL I;  3KIH A;  3T4N B;  4BY1 I;  3F3F C;  4DK1 A;  2OZK A;  3KIF A;  1X0T A;  3Q87 A;  2W03 A;  5T64 A;  1R9T I;  1Y1V S;  1KD1 1;  5AN9 F;  5IP9 I;  5CM2 M;  5C4J I;  2JA7 I;  1Z02 A;  4E2Z A;  4RVH A;  4NBB A;  1KC8 1;  2JR6 A;  1WCM I;  1YJN Z;  1VQ4 Z;  2IZ3 A;  3CMA 1;  2OTL 1;  1KQS Y;  2YAD A;  1RQF A;  5FLX b;  1Q82 1;  4A3D I;  1USP A;  3CCQ 1;  1QVG Y;  4MRI A;  3GTQ I;  3S16 I;  3CD6 1;  1Z01 A;  3VTN A;  2V45 A;  4NBC A;  2I3C A;  2ZAE B;  3IR7 A;  3VMG A;  2EGT A;  3GTK I;  3K7A I;  2VUG A;  3CCS Z;  5LL6 f;  1YUA A;  3S17 I;  5D1O A;  4E2X A;  1NP6 A;  2JIO A;  2RT9 A;  1YI2 1;  2M48 A;  3MZL B;  3CCV 1;  2QA4 Z;  1VQ5 1;  4HGZ A;  2YU9 I;  3CC2 1;  1M1K 1;  3CC7 Z;  1ZH1 A;  4E2Y A;  3HOV I;  2PM9 A;  3MON A;  1I50 I;  3D6W A;  1X3Z A;  2O4H A;  3BG0 B;  3S15 I;  3IFU A;  4S1T A;  2LIY A;  1M90 1;  2JNY A;  3I4M I;  1VQM Z;  1Z03 A;  4RV9 A;  1YIT 1;  4NBE A;  1VQK 1;  4EWC A;  4CL1 A;  3EER A;  3I55 1;  3M3Y I;  1AA6 A;  1Q86 1;  2F4O A;  4DQY B;  3M4O I;  1YUK A;  1VQN Z;  5IT9 b;  1JJ2 Y;  2JA5 I;  1KQS Z;  3JAM b;  4MH4 A;  4A3M I;  1Y8C A;  3CCU 1;  3S1R I;  1K9M 1;  4Y52 I;  4MD7 A;  1QVF Y;  1K8A 1;  1Q81 1;  1QVG Z;  3NFZ A;  1KRL A;  1USP B;  3J81 b;  2JIR A;  5C3E I;  1K73 1;  3G71 1;  2QRC B;  3NH4 A;  1TWH I;  4A3F I;  1X3W A;  1W2B Y;  1VQP 1;  4A3C I;  2VPX A;  2QEX 1;  1LQL A;  1FDO A;  1TFI A;  4NB9 A;  1KC8 2;  3J80 f;  5D1O B;  2OOX B;  2OTJ 1;  1YJ9 Z;  2JMO A;  3NH8 A;  5IP7 I;  1N8R 1;  1QXF A;  3S2H I;  2RPR A;  2OTL Z;  2QRD B;  1RO0 A;  2W04 A;  1N2F A;  3I4N I;  2NVX I;  4E33 A;  3S2D I;  3CCQ Z;  1S7M A;  5A2Q b;  1VQ6 1;  1Q7Y 1;  3GTM I;  2WB1 A;  3CD6 Z;  1P9N A;  3TDH B;  4E32 A;  1WII A;  4DGL A;  3CCJ 1;  4BY7 I;  2LEX A;  3H3V J;  1TWG I;  3HOY I;  2R7Z I;  1QYP A;  2VPY A;  2QRE B;  4RVD A;  3HOX I;  1JJ2 Z;  2Q4Z A;  1S72 1;  3G4S 1;  1M1K 2;  2E2H I;  4X6A I;  3S1N I;  1QVF Z;  4MD8 A;  4A3I I;  2RIQ A;  1YI2 Z;  2V8K A;  3CCV Z;  3LUS A;  2VPW A;  2NVQ I;  3CXC Y; 
#chains in the Genus database with same CATH homology
 1VQ5 Z;  2OOY B;  3CCE 1;  2K5R A;  3VB9 A;  1TWA I;  1M90 2;  5T6B A;  4NOZ A;  4A3K I;  1SFO I;  3RZD I;  3GTP I;  1VQO 1;  3GTG I;  2PMZ A;  2H85 A;  1W2B Z;  2JUB A;  2V8J A;  2BJO A;  3CCR 1;  3CCM 1;  1Q86 2;  1RNI A;  3OW2 Y;  5FLM I;  3I56 1;  1YIT Z;  5FLX f;  4MON A;  1VQK Z;  3HOZ I;  2HU9 A;  4E30 A;  3IF8 A;  4A93 I;  1L1O C;  1K9M 2;  4NH1 C;  2O53 A;  1K8A 2;  1Q81 2;  2DE7 A;  2VUM I;  3CQZ I;  5C44 I;  2NVT I;  3TE5 B;  3P5J B;  2V8I A;  3CC7 1;  1VQ8 Z;  1YHQ 1;  2Q51 A;  2GTH A;  1Y1V I;  4A3B I;  3I07 A;  1K73 2;  2JA6 I;  1PFT A;  2GTI A;  1VQ9 Z;  1ZB8 A;  3G71 Z;  1WW9 A;  2B63 I;  3FKI I;  3H0G I;  4XX2 A;  2NVY I;  1VQP Z;  1YJW 1;  3CME 1;  1KD1 2;  2QEX Z;  4BBR I;  1I6H I;  3EED A;  1N8R 2;  2E2J I;  4TNU A;  2QKD A;  1JWH C;  3CXC Z;  3CC4 1;  4RVG A;  3HOU I;  2OTJ Z;  3CPW Y;  1YIJ 1;  3HOW I;  2QR1 B;  4NBA A;  1NJI 1;  1Q7Y 2;  2Y0S A;  4RS4 A;  1VQL 1;  3CCL 1;  1Q82 2;  5C4X I;  3NH5 A;  5IT9 f;  2KI7 B;  1VQ7 1;  3JAM f;  3CMA Z;  2G2K A;  3OW2 Z;  1VQ6 Z;  1RLY A;  2KPI A;  3S1M I;  3BG1 B;  4NBF A;  3CCJ Z;  2R93 I;  3G6E 1;  3NDI A;  4MXU A;  2JS4 A;  3J81 f;  2R92 I;  4A3L I;  3PO3 S;  2E9H A;  1S72 Z;  3G4S Z;  1YJ9 1;  1RO2 A;  1QF8 A;  4E31 A;  3D9X A;  1DL6 A;  3GCF A;  3J7A 4;  4NBD A;  2RBL A;  4NB8 A;  3CCE Z;  2E2I I;  2R6M A;  3S1Q I;  4Y7N I;  1YJN 1;  1ZB9 A;  1VQ4 1;  2QLV B;  3CC2 Z;  1VQO Z;  3FQQ A;  4NBH A;  4BXX I;  5D1P A;  1NUI A;  4AYB A;  3CCR Z;  3CCM Z;  4NFR A;  2P3Y A;  2IZ4 A;  3I56 Z;  3GTJ I;  4QTU A;  3GKQ A;  5A2Q f;  3CPW Z;  2AKL A;  3QWU A;  3HKZ A;  1Y1W I;  3U50 C;  3ESW A;  3I55 Z;  1I3Q I;  1TWF I;  3CCS 1;  2DE5 A;  3S14 I;  2M6N A;  1YHQ Z;  2QA4 1;  3GTM S;  3CCU Z;  2WAQ A;  4A3J I;  3VMH A;  1K83 I;  3PO2 I;  4BBS I;  3RZO I;  1TWC I;  4HH4 A;  3FQM A;  3J80 b;  1VQM 1;  1YJW Z;  3CME Z;  2F4M A;  4HGY A;  2RHB A;  4E2W A;  4NBG A;  2JA8 I;  2VF1 A;  5T67 A;  4A3E I;  1NJI 2;  3CC4 Z;  2PK7 A;  2LFU A;  3F3P C;  4MD9 A;  3PO3 I;  4QTT A;  1YIJ Z;  3NDJ A;  1VQ8 1;  4A3G I;  3GTO I;  1VQN 1;  1VLA A;  2P28 A;  3MZK B;  1RO4 A;  1VQL Z;  3CCL Z;  2DE6 A;  3IX0 A;  1VQ7 Z;  1VQ9 1;  2J6A A;  1ML8 A;  2HF1 A;  2K3R A;  2GU2 A;  4RVF A;  3VMI A;  3G6E Z;  3GTL I;  3KIH A;  3T4N B;  4BY1 I;  3F3F C;  4DK1 A;  2OZK A;  3KIF A;  1X0T A;  3Q87 A;  2W03 A;  5T64 A;  1R9T I;  1Y1V S;  1KD1 1;  5AN9 F;  5IP9 I;  5CM2 M;  5C4J I;  2JA7 I;  1Z02 A;  4E2Z A;  4RVH A;  4NBB A;  1KC8 1;  2JR6 A;  1WCM I;  1YJN Z;  1VQ4 Z;  2IZ3 A;  3CMA 1;  2OTL 1;  1KQS Y;  2YAD A;  1RQF A;  5FLX b;  1Q82 1;  4A3D I;  1USP A;  3CCQ 1;  1QVG Y;  4MRI A;  3GTQ I;  3S16 I;  3CD6 1;  1Z01 A;  3VTN A;  4NBC A;  2I3C A;  2ZAE B;  3VMG A;  2EGT A;  3GTK I;  3K7A I;  2VUG A;  3CCS Z;  5LL6 f;  1YUA A;  3S17 I;  5D1O A;  4E2X A;  1NP6 A;  2RT9 A;  1YI2 1;  2M48 A;  3MZL B;  3CCV 1;  2QA4 Z;  1VQ5 1;  4HGZ A;  2YU9 I;  3CC2 1;  1M1K 1;  3CC7 Z;  1ZH1 A;  4E2Y A;  3HOV I;  2PM9 A;  3MON A;  1I50 I;  3D6W A;  1X3Z A;  2O4H A;  3BG0 B;  3S15 I;  3IFU A;  4S1T A;  2LIY A;  1M90 1;  2JNY A;  3I4M I;  1VQM Z;  1Z03 A;  4RV9 A;  1YIT 1;  4NBE A;  1VQK 1;  4EWC A;  4CL1 A;  3EER A;  3I55 1;  3M3Y I;  1Q86 1;  2F4O A;  4DQY B;  3M4O I;  1YUK A;  1VQN Z;  5IT9 b;  1JJ2 Y;  2JA5 I;  1KQS Z;  3JAM b;  4MH4 A;  4A3M I;  3CCU 1;  3S1R I;  1K9M 1;  4Y52 I;  4MD7 A;  1QVF Y;  1K8A 1;  1Q81 1;  1QVG Z;  1KRL A;  3NFZ A;  1USP B;  3J81 b;  5C3E I;  1K73 1;  3G71 1;  2QRC B;  3NH4 A;  1TWH I;  4A3F I;  1X3W A;  1W2B Y;  1VQP 1;  4A3C I;  2QEX 1;  1LQL A;  1TFI A;  4NB9 A;  1KC8 2;  3J80 f;  5D1O B;  2OOX B;  2OTJ 1;  1YJ9 Z;  2JMO A;  3NH8 A;  5IP7 I;  1N8R 1;  3S2H I;  2RPR A;  2OTL Z;  2QRD B;  1RO0 A;  2W04 A;  1N2F A;  3I4N I;  2NVX I;  4E33 A;  3S2D I;  3CCQ Z;  1S7M A;  5A2Q b;  1VQ6 1;  1Q7Y 1;  3GTM I;  2WB1 A;  3CD6 Z;  1P9N A;  3TDH B;  4E32 A;  1WII A;  4DGL A;  3CCJ 1;  4BY7 I;  3H3V J;  1TWG I;  3HOY I;  2R7Z I;  1QYP A;  2QRE B;  4RVD A;  3HOX I;  1JJ2 Z;  2Q4Z A;  1S72 1;  3G4S 1;  1M1K 2;  2E2H I;  4X6A I;  3S1N I;  1QVF Z;  4MD8 A;  4A3I I;  2RIQ A;  1YI2 Z;  2V8K A;  3CCV Z;  3LUS A;  2NVQ I;  3CXC Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...