5C4XI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/rna/dna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4xI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4xI02
1Y1WI 2HF1A 3U50C 2B63I 3GTQI 1X3ZA 3S15I 4A3GI 1NUIA 1LQLA 2AKLA 2DE7A 2NVXI 3S1NI 3VMGA 3GTGI 2K5RA 2DE6A 1SFOI 4NBGA 4BBRI 2JA7I 5FLMI 1X3WA 1TFIA 2R93I 1I50I 3CQZI 1WW9A 3VB9A 2F4OA 4Y7NI 3RZOI 2E2II 1Y1VS 2R92I 2JR6A 2DE5A 1TWCI 3EERA 1TWHI 5C44I 2JA6I 4XX2A 1R9TI 3HOXI 4BBSI 2KPIA 1RLYA 1N2FA 2J6AA 3GTMI 3GCFA 5C4JI 3GTMS 4A3DI 1TWFI 4NBCA 2E2HI 1USPB 3FKII 3I4NI 3M3YI 4NBAA 3S1MI 1Y1VI 3GTKI 3S16I 4NBEA 1RO4A 1TWGI 1DL6A 4NBHA 3K7AI 3S1RI 3ESWA 3D6WA 3S2DI 2JA8I 4NB9A 3HOYI 4NBDA 4A3II 4A3FI 4Y52I 1ZB8A 2JNYA 3S2HI 3H3VJ 1I6HI 5CM2M 3GTOI 4A3EI 3VMIA 4A3KI 1ZB9A 3HOVI 4BXXI 3GTLI 2BJOA 3PO3I 1PFTA 4QTUA 1ML8A 1QYPA 2F4MA 3GKQA 2JS4A 4A3MI 2JA5I 4A3LI 4X6AI 1USPA 2PK7A 4NOZA 3GTJI 2R7ZI 4BY7I 2NVYI 3I07A 2P3YA 5C3EI 1YUAA 3VMHA 5IP7I 3S1QI 2NVQI 4A93I 4A3CI 5IP9I 3RZDI 3GTPI 3H0GI 1TWAI 1VLAA 4A3JI 3PO2I 3M4OI 4BY1I 2NVTI 4A3BI 2YU9I 2VUMI 2RBLA 1L1OC 3HOWI 3HOUI 3I4MI 1WCMI 4MH4A 4NB8A 3LUSA 4NBBA 3S17I 4QTTA 1K83I 4NBFA 3S14I 3PO3S 3Q87A 2E2JI 3HOZI 1I3QI 5C4XI
chains in the Genus database with same CATH superfamily
3NFZA 1Y1WI 3U50C 1Q7Y1 1KD11 1NUIA 3VTNA 3J81f 2AKLA 2DE7A 2KI7B 4HGZA 2RT9A 1P9NA 3G6EZ 1WJ2A 3GTGI 2VPYA 1Q821 2K5RA 3G4S1 3CCUZ 2JA7I 5FLMI 3NH4A 4E2ZA 1VQ91 4Y7NI 3VB9A 1QXFA 1Y8CA 4AYBA 3EEDA 2OZKA 3MZLB 1YJ9Z 4MONA 2QEX1 1KC82 3CXCY 4E2XA 3FQMA 2KPIA 1RLYA 2J6AA 2JIRA 1VQOZ 3GTMI 2OTLZ 5C4JI 3CMAZ 2QLVB 1Q861 3CCV1 2GTIA 1Y1VI 3GTKI 3KIFA 1RO2A 2IZ4A 2QEXZ 1TWGI 1DL6A 3K7AI 1YJNZ 2IV2X 4CL1A 2VPXA 3P5JB 2W03A 4NB9A 5T6BA 4EWCA 2JA8I 4A3FI 1K9M2 1VQP1 2YADA 5T67A 4S1TA 1NJI2 4MXUA 1I6HI 4MD8A 1ZH1A 5D1OA 1M902 4A3KI 5IT9f 1ZB9A 4BXXI 2NAPA 2K3RA 3CCR1 1VQ4Z 2JS4A 4X6AI 4TNUA 2RIQA 1VQLZ 2QRDB 4HH4A 2R7ZI 2P3YA 3CCJ1 2V8IA 1VQ6Z 4E31A 3H0GI 3PO2I 2VUMI 1L1OC 2JIPA 1Q811 3HOUI 1YIJZ 1FDOA 4MH4A 2RHBA 3J7A4 3CC7Z 1K83I 3S14I 2VPZA 3MONA 3M3YI 2HF1A 2I3CA 1X3ZA 3CCS1 3CMA1 4RS4A 1NJI1 1N8R2 2LIYA 2DE6A 3I551 2M6NA 1X3WA 2R93I 2F4OA 3RZOI 3D2LA 2AYDA 2E2II 1Y1VS 1AA6A 1YJW1 1Q862 2JR6A 1VQ8Z 1W2BZ 1TWHI 2JA6I 1KRLA 4XX2A 1YUKA 4DK1A 2Q4ZA 4BBSI 1S7MA 2G2KA 2QRCB 4DQYB 1QVGZ 2WB1A 3I4NI 2OTL1 4NBAA 4E2YA 3S16I 1VQPZ 1YIT1 1RO4A 3F3PC 1Z03A 2OTJZ 1YITZ 1Z01A 3CCQ1 3G711 3D6WA 1JJ2Z 4MD7A 3CD6Z 3IF8A 4NBDA 4A3II 4Y52I 4RVDA 1VQ5Z 3H3VJ 2M48A 5CM2M 1S72Z 3TDHB 1JJ2Y 2JIOA 1N8R1 4A3EI 3VMIA 2V8JA 1SIWA 2OTJ1 3T4NB 1RO0A 3HOVI 1YJWZ 2BJOA 1VQM1 2ZAEB 2O53A 3IFUA 1I3QI 4A3MI 4RV9A 2E7ZA 1QF8A 2RPRA 2VF1A 4NOZA 5AN9F 3J80f 1Q16A 2E9HA 2V3VA 3IR7A 3CCMZ 5IP7I 1FDIA 3I56Z 2NVQI 4A93I 1VQNZ 1VLAA 4BY1I 2QA41 3CC71 1VQ7Z 4RVGA 1VQ81 1K731 5D1OB 3CCU1 4QTTA 5FLXb 3BG1B 2QKDA 2P28A 1VQN1 3G6E1 4NH1C 4DGLA 1LQLA 1Z02A 3MZKB 3CPWY 2NVXI 3CCJZ 3S1NI 1KQSZ 2Q51A 1RNIA 3CC21 2JIMA 4NBGA 1VQO1 4RVFA 1I50I 4E30A 2R6MA 3CCE1 2H85A 1VQ9Z 1VQMZ 1YHQ1 1VQ41 3EERA 3HKZA 5C44I 1VQ51 2JIQA 1R9TI 1N2FA 2LEXA 5T64A 3GCFA 4A3DI 3F3FC 2V45A 4NBCA 3CME1 3FKII 4E32A 3OW2Z 3CCEZ 1X0TA 1YI2Z 1YJN1 4HGYA 4MRIA 3S1RI 5IT9b 3ESWA 2IZ3A 3S2DI 3NDIA 3HOYI 3OW2Y 2GTHA 3CC41 1ZB8A 1KD12 3CCVZ 3IX0A 3GTLI 3PO3I 1PFTA 1ML8A 3I55Z 4A3LI 5A2Qb 2PK7A 1Q812 2QR1B 1YI21 2NVYI 4MD9A 3TE5B 3I07A 5C3EI 5A2Qf 3VMHA 3NDJA 3CCL1 4A3CI 5IP9I 3RZDI 3GTPI 1QVFZ 3CXCZ 1RQFA 3I561 4A3JI 1VQ61 2OOYB 3CCSZ 2YU9I 2EGTA 3CPWZ 3HOWI 3I4MI 2VPWA 4NB8A 3LUSA 2VUGA 1WIIA 2OOXB 4NFRA 3S17I 3JAMb 4NBFA 3PO3S 1WZNA 3HOZI 3FQQA 3D9XA 2HU9A 2B63I 3GTQI 3S15I 4A3GI 1M901 1W2BY 3QWUA 3VMGA 1K9M1 3G4SZ 2O4HA 3NH8A 3CC4Z 4E2WA 1SFOI 2WAQA 4BBRI 2LFUA 3G71Z 1TFIA 1VQL1 3CQZI 1WW9A 2GU2A 1M1K1 2R92I 3J80b 2DE5A 1YIJ1 1TWCI 3JAMf 3HOXI 1VQK1 3CMEZ 3GTMS 1TWFI 3CCLZ 2PM9A 2E2HI 3CCM1 1USPB 1M1K2 1QVFY 1KC81 3S1MI 1K8A1 4NBEA 1JWHC 2JMOA 4NBHA 1K8A2 1KQSY 1K732 1S721 3CC2Z 2QA4Z 1VQ71 2JNYA 2PMZA 2Y0SA 3S2HI 4RVHA 2JUBA 1Q822 3GTOI 4E33A 1QVGY 1NP6A 1YJ91 4QTUA 1QYPA 2F4MA 3GKQA 2JA5I 3J81b 1USPA 3NH5A 3GTJI 4BY7I 1YUAA 1Q7Y2 3S1QI 5FLXf 3BG0B 1TWAI 3M4OI 2NVTI 4A3BI 2W04A 1VQKZ 2RBLA 2V8KA 5D1PA 3CD61 1WCMI 1YHQZ 3CCQZ 5LL6f 4NBBA 3KIHA 3CCRZ 3Q87A 2E2JI 2QREB 5C4XI
chains in the Genus database with same CATH topology
3NFZA 1Y1WI 3U50C 1Q7Y1 1KD11 1NUIA 3VTNA 3J81f 2AKLA 2DE7A 2KI7B 4HGZA 2RT9A 1P9NA 3G6EZ 3GTGI 1Q821 2K5RA 3G4S1 3CCUZ 2JA7I 5FLMI 3NH4A 4E2ZA 1VQ91 4Y7NI 3VB9A 4AYBA 3EEDA 2OZKA 3MZLB 1YJ9Z 4MONA 2QEX1 1KC82 3CXCY 4E2XA 3FQMA 2KPIA 1RLYA 2J6AA 1VQOZ 3GTMI 2OTLZ 5C4JI 3CMAZ 2QLVB 1Q861 3CCV1 2GTIA 1Y1VI 3GTKI 3KIFA 1RO2A 2IZ4A 2QEXZ 1TWGI 1DL6A 3K7AI 1YJNZ 4CL1A 3P5JB 2W03A 4NB9A 5T6BA 4EWCA 2JA8I 4A3FI 1K9M2 1VQP1 2YADA 5T67A 4S1TA 1NJI2 4MXUA 1I6HI 4MD8A 1ZH1A 5D1OA 1M902 4A3KI 5IT9f 1ZB9A 4BXXI 2K3RA 3CCR1 1VQ4Z 2JS4A 4X6AI 4TNUA 2RIQA 1VQLZ 2QRDB 4HH4A 2R7ZI 2P3YA 3CCJ1 2V8IA 1VQ6Z 4E31A 3H0GI 3PO2I 2VUMI 1L1OC 1Q811 3HOUI 1YIJZ 4MH4A 2RHBA 3J7A4 3CC7Z 1K83I 3S14I 3MONA 3M3YI 2HF1A 2I3CA 1X3ZA 3CCS1 3CMA1 4RS4A 1NJI1 1N8R2 2LIYA 2DE6A 3I551 2M6NA 1X3WA 2R93I 2F4OA 3RZOI 2E2II 1Y1VS 1YJW1 1Q862 2JR6A 1VQ8Z 1W2BZ 1TWHI 2JA6I 1KRLA 4XX2A 1YUKA 4DK1A 2Q4ZA 4BBSI 1S7MA 2G2KA 2QRCB 4DQYB 1QVGZ 2WB1A 3I4NI 2OTL1 4NBAA 4E2YA 3S16I 1VQPZ 1YIT1 1RO4A 3F3PC 1Z03A 2OTJZ 1YITZ 1Z01A 3CCQ1 3G711 3D6WA 1JJ2Z 4MD7A 3CD6Z 3IF8A 4NBDA 4A3II 4Y52I 4RVDA 1VQ5Z 3H3VJ 2M48A 5CM2M 1S72Z 3TDHB 1JJ2Y 1N8R1 4A3EI 3VMIA 2V8JA 2OTJ1 3T4NB 1RO0A 3HOVI 1YJWZ 2BJOA 1VQM1 2ZAEB 2O53A 3IFUA 1I3QI 4A3MI 4RV9A 1QF8A 2RPRA 2VF1A 4NOZA 5AN9F 3J80f 2E9HA 3CCMZ 5IP7I 3I56Z 2NVQI 4A93I 1VQNZ 1VLAA 4BY1I 2QA41 3CC71 1VQ7Z 4RVGA 1VQ81 1K731 5D1OB 3CCU1 4QTTA 5FLXb 3BG1B 2QKDA 2P28A 1VQN1 3G6E1 4NH1C 4DGLA 1LQLA 1Z02A 3MZKB 3CPWY 2NVXI 3CCJZ 3S1NI 1KQSZ 2Q51A 1RNIA 3CC21 4NBGA 1VQO1 4RVFA 1I50I 4E30A 2R6MA 3CCE1 2H85A 1VQ9Z 1VQMZ 1YHQ1 1VQ41 3EERA 3HKZA 5C44I 1VQ51 1R9TI 1N2FA 5T64A 3GCFA 4A3DI 3F3FC 4NBCA 3CME1 3FKII 4E32A 3OW2Z 3CCEZ 1X0TA 1YI2Z 1YJN1 4HGYA 4MRIA 3S1RI 5IT9b 3ESWA 2IZ3A 3S2DI 3NDIA 3HOYI 3OW2Y 2GTHA 3CC41 1ZB8A 1KD12 3CCVZ 3IX0A 3GTLI 3PO3I 1PFTA 1ML8A 3I55Z 4A3LI 5A2Qb 2PK7A 1Q812 2QR1B 1YI21 2NVYI 4MD9A 3TE5B 3I07A 5C3EI 5A2Qf 3VMHA 3NDJA 3CCL1 4A3CI 5IP9I 3RZDI 3GTPI 1QVFZ 3CXCZ 1RQFA 3I561 4A3JI 1VQ61 2OOYB 3CCSZ 2YU9I 2EGTA 3CPWZ 3HOWI 3I4MI 4NB8A 3LUSA 2VUGA 1WIIA 2OOXB 4NFRA 3S17I 3JAMb 4NBFA 3PO3S 3HOZI 3FQQA 3D9XA 2HU9A 2B63I 3GTQI 3S15I 4A3GI 1M901 1W2BY 3QWUA 3VMGA 1K9M1 3G4SZ 2O4HA 3NH8A 3CC4Z 4E2WA 1SFOI 2WAQA 4BBRI 2LFUA 3G71Z 1TFIA 1VQL1 3CQZI 1WW9A 2GU2A 1M1K1 2R92I 3J80b 2DE5A 1YIJ1 1TWCI 3JAMf 3HOXI 1VQK1 3CMEZ 3GTMS 1TWFI 3CCLZ 2PM9A 2E2HI 3CCM1 1USPB 1M1K2 1QVFY 1KC81 3S1MI 1K8A1 4NBEA 1JWHC 2JMOA 4NBHA 1K8A2 1KQSY 1K732 1S721 3CC2Z 2QA4Z 1VQ71 2JNYA 2PMZA 2Y0SA 3S2HI 4RVHA 2JUBA 1Q822 3GTOI 4E33A 1QVGY 1NP6A 1YJ91 4QTUA 1QYPA 2F4MA 3GKQA 2JA5I 3J81b 1USPA 3NH5A 3GTJI 4BY7I 1YUAA 1Q7Y2 3S1QI 5FLXf 3BG0B 1TWAI 3M4OI 2NVTI 4A3BI 2W04A 1VQKZ 2RBLA 2V8KA 5D1PA 3CD61 1WCMI 1YHQZ 3CCQZ 5LL6f 4NBBA 3KIHA 3CCRZ 3Q87A 2E2JI 2QREB 5C4XI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W I;  2HF1 A;  3U50 C;  2B63 I;  3GTQ I;  1X3Z A;  3S15 I;  4A3G I;  1NUI A;  1LQL A;  2AKL A;  2DE7 A;  2NVX I;  3S1N I;  3VMG A;  3GTG I;  2K5R A;  2DE6 A;  1SFO I;  4NBG A;  4BBR I;  2JA7 I;  5FLM I;  1X3W A;  1TFI A;  2R93 I;  1I50 I;  3CQZ I;  1WW9 A;  3VB9 A;  2F4O A;  4Y7N I;  3RZO I;  2E2I I;  1Y1V S;  2R92 I;  2JR6 A;  2DE5 A;  1TWC I;  3EER A;  1TWH I;  5C44 I;  2JA6 I;  4XX2 A;  1R9T I;  3HOX I;  4BBS I;  2KPI A;  1RLY A;  1N2F A;  2J6A A;  3GTM I;  3GCF A;  5C4J I;  3GTM S;  4A3D I;  1TWF I;  4NBC A;  2E2H I;  1USP B;  3FKI I;  3I4N I;  3M3Y I;  4NBA A;  3S1M I;  1Y1V I;  3GTK I;  3S16 I;  4NBE A;  1RO4 A;  1TWG I;  1DL6 A;  4NBH A;  3K7A I;  3S1R I;  3ESW A;  3D6W A;  3S2D I;  2JA8 I;  4NB9 A;  3HOY I;  4NBD A;  4A3I I;  4A3F I;  4Y52 I;  1ZB8 A;  2JNY A;  3S2H I;  3H3V J;  1I6H I;  5CM2 M;  3GTO I;  4A3E I;  3VMI A;  4A3K I;  1ZB9 A;  3HOV I;  4BXX I;  3GTL I;  2BJO A;  3PO3 I;  1PFT A;  4QTU A;  1ML8 A;  1QYP A;  2F4M A;  3GKQ A;  2JS4 A;  4A3M I;  2JA5 I;  4A3L I;  4X6A I;  1USP A;  2PK7 A;  4NOZ A;  3GTJ I;  2R7Z I;  4BY7 I;  2NVY I;  3I07 A;  2P3Y A;  5C3E I;  1YUA A;  3VMH A;  5IP7 I;  3S1Q I;  2NVQ I;  4A93 I;  4A3C I;  5IP9 I;  3RZD I;  3GTP I;  3H0G I;  1TWA I;  1VLA A;  4A3J I;  3PO2 I;  3M4O I;  4BY1 I;  2NVT I;  4A3B I;  2YU9 I;  2VUM I;  2RBL A;  1L1O C;  3HOW I;  3HOU I;  3I4M I;  1WCM I;  4MH4 A;  4NB8 A;  3LUS A;  4NBB A;  3S17 I;  4QTT A;  1K83 I;  4NBF A;  3S14 I;  3PO3 S;  3Q87 A;  2E2J I;  3HOZ I;  1I3Q I;  5C4X I; 
#chains in the Genus database with same CATH topology
 3NFZ A;  1Y1W I;  3U50 C;  1Q7Y 1;  1KD1 1;  1NUI A;  3VTN A;  3J81 f;  2AKL A;  2DE7 A;  2KI7 B;  4HGZ A;  2RT9 A;  1P9N A;  3G6E Z;  1WJ2 A;  3GTG I;  2VPY A;  1Q82 1;  2K5R A;  3G4S 1;  3CCU Z;  2JA7 I;  5FLM I;  3NH4 A;  4E2Z A;  1VQ9 1;  4Y7N I;  3VB9 A;  1QXF A;  1Y8C A;  4AYB A;  3EED A;  2OZK A;  3MZL B;  1YJ9 Z;  4MON A;  2QEX 1;  1KC8 2;  3CXC Y;  4E2X A;  3FQM A;  2KPI A;  1RLY A;  2J6A A;  2JIR A;  1VQO Z;  3GTM I;  2OTL Z;  5C4J I;  3CMA Z;  2QLV B;  1Q86 1;  3CCV 1;  2GTI A;  1Y1V I;  3GTK I;  3KIF A;  1RO2 A;  2IZ4 A;  2QEX Z;  1TWG I;  1DL6 A;  3K7A I;  1YJN Z;  2IV2 X;  4CL1 A;  2VPX A;  3P5J B;  2W03 A;  4NB9 A;  5T6B A;  4EWC A;  2JA8 I;  4A3F I;  1K9M 2;  1VQP 1;  2YAD A;  5T67 A;  4S1T A;  1NJI 2;  4MXU A;  1I6H I;  4MD8 A;  1ZH1 A;  5D1O A;  1M90 2;  4A3K I;  5IT9 f;  1ZB9 A;  4BXX I;  2NAP A;  2K3R A;  3CCR 1;  1VQ4 Z;  2JS4 A;  4X6A I;  4TNU A;  2RIQ A;  1VQL Z;  2QRD B;  4HH4 A;  2R7Z I;  2P3Y A;  3CCJ 1;  2V8I A;  1VQ6 Z;  4E31 A;  3H0G I;  3PO2 I;  2VUM I;  1L1O C;  2JIP A;  1Q81 1;  3HOU I;  1YIJ Z;  1FDO A;  4MH4 A;  2RHB A;  3J7A 4;  3CC7 Z;  1K83 I;  3S14 I;  2VPZ A;  3MON A;  3M3Y I;  2HF1 A;  2I3C A;  1X3Z A;  3CCS 1;  3CMA 1;  4RS4 A;  1NJI 1;  1N8R 2;  2LIY A;  2DE6 A;  3I55 1;  2M6N A;  1X3W A;  2R93 I;  2F4O A;  3RZO I;  3D2L A;  2AYD A;  2E2I I;  1Y1V S;  1AA6 A;  1YJW 1;  1Q86 2;  2JR6 A;  1VQ8 Z;  1W2B Z;  1TWH I;  2JA6 I;  1KRL A;  4XX2 A;  1YUK A;  4DK1 A;  2Q4Z A;  4BBS I;  1S7M A;  2G2K A;  2QRC B;  4DQY B;  1QVG Z;  2WB1 A;  3I4N I;  2OTL 1;  4NBA A;  4E2Y A;  3S16 I;  1VQP Z;  1YIT 1;  1RO4 A;  3F3P C;  1Z03 A;  2OTJ Z;  1YIT Z;  1Z01 A;  3CCQ 1;  3G71 1;  3D6W A;  1JJ2 Z;  4MD7 A;  3CD6 Z;  3IF8 A;  4NBD A;  4A3I I;  4Y52 I;  4RVD A;  1VQ5 Z;  3H3V J;  2M48 A;  5CM2 M;  1S72 Z;  3TDH B;  1JJ2 Y;  2JIO A;  1N8R 1;  4A3E I;  3VMI A;  2V8J A;  1SIW A;  2OTJ 1;  3T4N B;  1RO0 A;  3HOV I;  1YJW Z;  2BJO A;  1VQM 1;  2ZAE B;  2O53 A;  3IFU A;  1I3Q I;  4A3M I;  4RV9 A;  2E7Z A;  1QF8 A;  2RPR A;  2VF1 A;  4NOZ A;  5AN9 F;  3J80 f;  1Q16 A;  2E9H A;  2V3V A;  3IR7 A;  3CCM Z;  5IP7 I;  1FDI A;  3I56 Z;  2NVQ I;  4A93 I;  1VQN Z;  1VLA A;  4BY1 I;  2QA4 1;  3CC7 1;  1VQ7 Z;  4RVG A;  1VQ8 1;  1K73 1;  5D1O B;  3CCU 1;  4QTT A;  5FLX b;  3BG1 B;  2QKD A;  2P28 A;  1VQN 1;  3G6E 1;  4NH1 C;  4DGL A;  1LQL A;  1Z02 A;  3MZK B;  3CPW Y;  2NVX I;  3CCJ Z;  3S1N I;  1KQS Z;  2Q51 A;  1RNI A;  3CC2 1;  2JIM A;  4NBG A;  1VQO 1;  4RVF A;  1I50 I;  4E30 A;  2R6M A;  3CCE 1;  2H85 A;  1VQ9 Z;  1VQM Z;  1YHQ 1;  1VQ4 1;  3EER A;  3HKZ A;  5C44 I;  1VQ5 1;  2JIQ A;  1R9T I;  1N2F A;  2LEX A;  5T64 A;  3GCF A;  4A3D I;  3F3F C;  2V45 A;  4NBC A;  3CME 1;  3FKI I;  4E32 A;  3OW2 Z;  3CCE Z;  1X0T A;  1YI2 Z;  1YJN 1;  4HGY A;  4MRI A;  3S1R I;  5IT9 b;  3ESW A;  2IZ3 A;  3S2D I;  3NDI A;  3HOY I;  3OW2 Y;  2GTH A;  3CC4 1;  1ZB8 A;  1KD1 2;  3CCV Z;  3IX0 A;  3GTL I;  3PO3 I;  1PFT A;  1ML8 A;  3I55 Z;  4A3L I;  5A2Q b;  2PK7 A;  1Q81 2;  2QR1 B;  1YI2 1;  2NVY I;  4MD9 A;  3TE5 B;  3I07 A;  5C3E I;  5A2Q f;  3VMH A;  3NDJ A;  3CCL 1;  4A3C I;  5IP9 I;  3RZD I;  3GTP I;  1QVF Z;  3CXC Z;  1RQF A;  3I56 1;  4A3J I;  1VQ6 1;  2OOY B;  3CCS Z;  2YU9 I;  2EGT A;  3CPW Z;  3HOW I;  3I4M I;  2VPW A;  4NB8 A;  3LUS A;  2VUG A;  1WII A;  2OOX B;  4NFR A;  3S17 I;  3JAM b;  4NBF A;  3PO3 S;  1WZN A;  3HOZ I;  3FQQ A;  3D9X A;  2HU9 A;  2B63 I;  3GTQ I;  3S15 I;  4A3G I;  1M90 1;  1W2B Y;  3QWU A;  3VMG A;  1K9M 1;  3G4S Z;  2O4H A;  3NH8 A;  3CC4 Z;  4E2W A;  1SFO I;  2WAQ A;  4BBR I;  2LFU A;  3G71 Z;  1TFI A;  1VQL 1;  3CQZ I;  1WW9 A;  2GU2 A;  1M1K 1;  2R92 I;  3J80 b;  2DE5 A;  1YIJ 1;  1TWC I;  3JAM f;  3HOX I;  1VQK 1;  3CME Z;  3GTM S;  1TWF I;  3CCL Z;  2PM9 A;  2E2H I;  3CCM 1;  1USP B;  1M1K 2;  1QVF Y;  1KC8 1;  3S1M I;  1K8A 1;  4NBE A;  1JWH C;  2JMO A;  4NBH A;  1K8A 2;  1KQS Y;  1K73 2;  1S72 1;  3CC2 Z;  2QA4 Z;  1VQ7 1;  2JNY A;  2PMZ A;  2Y0S A;  3S2H I;  4RVH A;  2JUB A;  1Q82 2;  3GTO I;  4E33 A;  1QVG Y;  1NP6 A;  1YJ9 1;  4QTU A;  1QYP A;  2F4M A;  3GKQ A;  2JA5 I;  3J81 b;  1USP A;  3NH5 A;  3GTJ I;  4BY7 I;  1YUA A;  1Q7Y 2;  3S1Q I;  5FLX f;  3BG0 B;  1TWA I;  3M4O I;  2NVT I;  4A3B I;  2W04 A;  1VQK Z;  2RBL A;  2V8K A;  5D1P A;  3CD6 1;  1WCM I;  1YHQ Z;  3CCQ Z;  5LL6 f;  4NBB A;  3KIH A;  3CCR Z;  3Q87 A;  2E2J I;  2QRE B;  5C4X I; 
#chains in the Genus database with same CATH homology
 3NFZ A;  1Y1W I;  3U50 C;  1Q7Y 1;  1KD1 1;  1NUI A;  3VTN A;  3J81 f;  2AKL A;  2DE7 A;  2KI7 B;  4HGZ A;  2RT9 A;  1P9N A;  3G6E Z;  3GTG I;  1Q82 1;  2K5R A;  3G4S 1;  3CCU Z;  2JA7 I;  5FLM I;  3NH4 A;  4E2Z A;  1VQ9 1;  4Y7N I;  3VB9 A;  4AYB A;  3EED A;  2OZK A;  3MZL B;  1YJ9 Z;  4MON A;  2QEX 1;  1KC8 2;  3CXC Y;  4E2X A;  3FQM A;  2KPI A;  1RLY A;  2J6A A;  1VQO Z;  3GTM I;  2OTL Z;  5C4J I;  3CMA Z;  2QLV B;  1Q86 1;  3CCV 1;  2GTI A;  1Y1V I;  3GTK I;  3KIF A;  1RO2 A;  2IZ4 A;  2QEX Z;  1TWG I;  1DL6 A;  3K7A I;  1YJN Z;  4CL1 A;  3P5J B;  2W03 A;  4NB9 A;  5T6B A;  4EWC A;  2JA8 I;  4A3F I;  1K9M 2;  1VQP 1;  2YAD A;  5T67 A;  4S1T A;  1NJI 2;  4MXU A;  1I6H I;  4MD8 A;  1ZH1 A;  5D1O A;  1M90 2;  4A3K I;  5IT9 f;  1ZB9 A;  4BXX I;  2K3R A;  3CCR 1;  1VQ4 Z;  2JS4 A;  4X6A I;  4TNU A;  2RIQ A;  1VQL Z;  2QRD B;  4HH4 A;  2R7Z I;  2P3Y A;  3CCJ 1;  2V8I A;  1VQ6 Z;  4E31 A;  3H0G I;  3PO2 I;  2VUM I;  1L1O C;  1Q81 1;  3HOU I;  1YIJ Z;  4MH4 A;  2RHB A;  3J7A 4;  3CC7 Z;  1K83 I;  3S14 I;  3MON A;  3M3Y I;  2HF1 A;  2I3C A;  1X3Z A;  3CCS 1;  3CMA 1;  4RS4 A;  1NJI 1;  1N8R 2;  2LIY A;  2DE6 A;  3I55 1;  2M6N A;  1X3W A;  2R93 I;  2F4O A;  3RZO I;  2E2I I;  1Y1V S;  1YJW 1;  1Q86 2;  2JR6 A;  1VQ8 Z;  1W2B Z;  1TWH I;  2JA6 I;  1KRL A;  4XX2 A;  1YUK A;  4DK1 A;  2Q4Z A;  4BBS I;  1S7M A;  2G2K A;  2QRC B;  4DQY B;  1QVG Z;  2WB1 A;  3I4N I;  2OTL 1;  4NBA A;  4E2Y A;  3S16 I;  1VQP Z;  1YIT 1;  1RO4 A;  3F3P C;  1Z03 A;  2OTJ Z;  1YIT Z;  1Z01 A;  3CCQ 1;  3G71 1;  3D6W A;  1JJ2 Z;  4MD7 A;  3CD6 Z;  3IF8 A;  4NBD A;  4A3I I;  4Y52 I;  4RVD A;  1VQ5 Z;  3H3V J;  2M48 A;  5CM2 M;  1S72 Z;  3TDH B;  1JJ2 Y;  1N8R 1;  4A3E I;  3VMI A;  2V8J A;  2OTJ 1;  3T4N B;  1RO0 A;  3HOV I;  1YJW Z;  2BJO A;  1VQM 1;  2ZAE B;  2O53 A;  3IFU A;  1I3Q I;  4A3M I;  4RV9 A;  1QF8 A;  2RPR A;  2VF1 A;  4NOZ A;  5AN9 F;  3J80 f;  2E9H A;  3CCM Z;  5IP7 I;  3I56 Z;  2NVQ I;  4A93 I;  1VQN Z;  1VLA A;  4BY1 I;  2QA4 1;  3CC7 1;  1VQ7 Z;  4RVG A;  1VQ8 1;  1K73 1;  5D1O B;  3CCU 1;  4QTT A;  5FLX b;  3BG1 B;  2QKD A;  2P28 A;  1VQN 1;  3G6E 1;  4NH1 C;  4DGL A;  1LQL A;  1Z02 A;  3MZK B;  3CPW Y;  2NVX I;  3CCJ Z;  3S1N I;  1KQS Z;  2Q51 A;  1RNI A;  3CC2 1;  4NBG A;  1VQO 1;  4RVF A;  1I50 I;  4E30 A;  2R6M A;  3CCE 1;  2H85 A;  1VQ9 Z;  1VQM Z;  1YHQ 1;  1VQ4 1;  3EER A;  3HKZ A;  5C44 I;  1VQ5 1;  1R9T I;  1N2F A;  5T64 A;  3GCF A;  4A3D I;  3F3F C;  4NBC A;  3CME 1;  3FKI I;  4E32 A;  3OW2 Z;  3CCE Z;  1X0T A;  1YI2 Z;  1YJN 1;  4HGY A;  4MRI A;  3S1R I;  5IT9 b;  3ESW A;  2IZ3 A;  3S2D I;  3NDI A;  3HOY I;  3OW2 Y;  2GTH A;  3CC4 1;  1ZB8 A;  1KD1 2;  3CCV Z;  3IX0 A;  3GTL I;  3PO3 I;  1PFT A;  1ML8 A;  3I55 Z;  4A3L I;  5A2Q b;  2PK7 A;  1Q81 2;  2QR1 B;  1YI2 1;  2NVY I;  4MD9 A;  3TE5 B;  3I07 A;  5C3E I;  5A2Q f;  3VMH A;  3NDJ A;  3CCL 1;  4A3C I;  5IP9 I;  3RZD I;  3GTP I;  1QVF Z;  3CXC Z;  1RQF A;  3I56 1;  4A3J I;  1VQ6 1;  2OOY B;  3CCS Z;  2YU9 I;  2EGT A;  3CPW Z;  3HOW I;  3I4M I;  4NB8 A;  3LUS A;  2VUG A;  1WII A;  2OOX B;  4NFR A;  3S17 I;  3JAM b;  4NBF A;  3PO3 S;  3HOZ I;  3FQQ A;  3D9X A;  2HU9 A;  2B63 I;  3GTQ I;  3S15 I;  4A3G I;  1M90 1;  1W2B Y;  3QWU A;  3VMG A;  1K9M 1;  3G4S Z;  2O4H A;  3NH8 A;  3CC4 Z;  4E2W A;  1SFO I;  2WAQ A;  4BBR I;  2LFU A;  3G71 Z;  1TFI A;  1VQL 1;  3CQZ I;  1WW9 A;  2GU2 A;  1M1K 1;  2R92 I;  3J80 b;  2DE5 A;  1YIJ 1;  1TWC I;  3JAM f;  3HOX I;  1VQK 1;  3CME Z;  3GTM S;  1TWF I;  3CCL Z;  2PM9 A;  2E2H I;  3CCM 1;  1USP B;  1M1K 2;  1QVF Y;  1KC8 1;  3S1M I;  1K8A 1;  4NBE A;  1JWH C;  2JMO A;  4NBH A;  1K8A 2;  1KQS Y;  1K73 2;  1S72 1;  3CC2 Z;  2QA4 Z;  1VQ7 1;  2JNY A;  2PMZ A;  2Y0S A;  3S2H I;  4RVH A;  2JUB A;  1Q82 2;  3GTO I;  4E33 A;  1QVG Y;  1NP6 A;  1YJ9 1;  4QTU A;  1QYP A;  2F4M A;  3GKQ A;  2JA5 I;  3J81 b;  1USP A;  3NH5 A;  3GTJ I;  4BY7 I;  1YUA A;  1Q7Y 2;  3S1Q I;  5FLX f;  3BG0 B;  1TWA I;  3M4O I;  2NVT I;  4A3B I;  2W04 A;  1VQK Z;  2RBL A;  2V8K A;  5D1P A;  3CD6 1;  1WCM I;  1YHQ Z;  3CCQ Z;  5LL6 f;  4NBB A;  3KIH A;  3CCR Z;  3Q87 A;  2E2J I;  2QRE B;  5C4X I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...