5C4XI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4xI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4xI02
4A3CI 4BBRI 3HOYI 2RBLA 4A3II 2JA6I 3HOZI 4NBGA 3GTJI 2JA7I 3S15I 3GTKI 1RO4A 2DE6A 1PFTA 1ML8A 2J6AA 5IP7I 3HOUI 4BBSI 3S1QI 5C4XI 4BXXI 3I07A 1TWFI 1ZB8A 2JR6A 1I6HI 3PO3I 2BJOA 3PO2I 1QYPA 3RZDI 1N2FA 2R92I 4X6AI 2K5RA 1TWCI 4NBCA 4NB8A 3PO3S 5C4JI 2NVYI 1TFIA 1WW9A 4BY7I 2F4MA 1USPA 3H3VJ 3RZOI 3D6WA 4A3GI 2JNYA 2JA5I 3FKII 2E2HI 3S2DI 4NBEA 3S1RI 2DE5A 1USPB 3GKQA 2P3YA 4A3BI 3HOVI 1X3ZA 5CM2M 3M3YI 2R93I 3EERA 2YU9I 4A3JI 2JA8I 1LQLA 4NBBA 4A93I 2E2II 2B63I 3S16I 3S1MI 3M4OI 4Y52I 2E2JI 1X3WA 3H0GI 2F4OA 3HOXI 3Q87A 3GTPI 4A3KI 3GTMI 5IP9I 4NB9A 3VMIA 4A3LI 1DL6A 3VB9A 1I50I 4QTTA 1Y1WI 4BY1I 3VMGA 3GTMS 2DE7A 3GTOI 1R9TI 4NBHA 2JS4A 1TWAI 4NBAA 2R7ZI 2NVQI 1NUIA 3CQZI 3I4NI 3S1NI 3S17I 3U50C 4QTUA 4A3MI 3LUSA 1SFOI 4NBDA 3S14I 3S2HI 4NBFA 2NVTI 4XX2A 4A3EI 3VMHA 5C44I 1TWHI 1YUAA 3GTLI 1L1OC 1VLAA 3ESWA 4A3FI 3GCFA 4NOZA 3GTQI 3GTGI 1Y1VI 1RLYA 2HF1A 1TWGI 5FLMI 4Y7NI 2VUMI 2PK7A 4MH4A 3I4MI 2NVXI 1ZB9A 5C3EI 3HOWI 2AKLA 1WCMI 1K83I 1Y1VS 4A3DI 2KPIA 1I3QI 3K7AI
chains in the Genus database with same CATH superfamily
2RBLA 1VQ7Z 3GTJI 3S15I 2JA7I 3GTKI 1S721 1ZH1A 2W03A 3BG1B 4TNUA 1TWFI 1ZB8A 4DGLA 3CCSZ 1VQNZ 3PO2I 2QR1B 1KQSY 3RZDI 1QXFA 1S7MA 1TWCI 1N8R2 4EWCA 4NB8A 2NVYI 1Z03A 1VQKZ 2QRDB 2GU2A 2F4MA 3NH8A 4RVHA 3RZOI 1WJ2A 3D6WA 3S2DI 4S1TA 3NDJA 3GKQA 1VQK1 3MZKB 2JIMA 2P3YA 2QLVB 3IR7A 3CC41 3M3YI 3NH5A 3EERA 2YU9I 1VQ41 2I3CA 3I56Z 4E30A 2B63I 1KD11 3F3PC 4Y52I 1X0TA 2JIOA 5AN9F 2V8JA 2E2JI 3M4OI 3J80b 3I55Z 4MRIA 3CXCZ 4A3KI 1QVGY 3GTMI 1DL6A 1JJ2Z 2Y0SA 1Y1WI 1VQL1 3GTMS 4E33A 2JMOA 3CMA1 2QREB 3CQZI 4E32A 3I4NI 3S17I 5T6BA 4QTUA 4A3MI 3LUSA 2E7ZA 1SIWA 1Q7Y1 5A2Qf 1YJNZ 4XX2A 1JWHC 4E2YA 3VMHA 1TWHI 3BG0B 1Y8CA 1YUKA 1L1OC 1VLAA 3OW2Z 4A3FI 3GCFA 2PM9A 1VQ61 1Y1VI 5IT9f 1K8A1 1M901 2PMZA 2PK7A 2AYDA 1YJN1 2NVXI 3CCVZ 1WCMI 1Y1VS 3KIHA 2W04A 2YADA 4A3CI 3NFZA 2K3RA 5D1PA 1PFTA 3VTNA 2RHBA 3CCV1 1YI2Z 2JR6A 3CCMZ 2GTHA 1N8R1 1P9NA 2BJOA 3G711 1N2FA 2VPWA 1WW9A 1YI21 4BY7I 3TDHB 3JAMb 1USPA 1NP6A 2JA5I 5FLXf 3IX0A 2OOYB 2E2HI 3CCUZ 3S1RI 1USPB 4RVFA 4NH1C 1K731 3FQQA 5CM2M 2R93I 2G2KA 1K9M2 4NBBA 4A93I 3CCU1 5D1OB 1VQP1 3CCJZ 3CC4Z 2V8IA 3CC21 3P5JB 3HOXI 2WB1A 2P28A 3Q87A 1VQ4Z 5IP9I 4NB9A 4HH4A 3CC71 3MONA 1I50I 4QTTA 3J7A4 3CCE1 2DE7A 3CCJ1 1RO0A 1YJ9Z 4E2WA 1VQ51 1JJ2Y 2LIYA 1K732 4AYBA 3S1NI 4HGZA 3D2LA 2QEX1 1VQLZ 2QA41 4NBDA 1SFOI 3S14I 3S2HI 2NVTI 3CMAZ 1YJ91 5C44I 2GTIA 1YUAA 4NOZA 3GTQI 1Q862 3GTGI 1QVFZ 1RLYA 5FLMI 4Y7NI 4MH4A 2OOXB 4DK1A 3OW2Y 3K7AI 1NJI1 1VQ6Z 2EGTA 4BBRI 4A3II 2JA6I 3HOZI 2Q51A 1RO4A 2DE6A 3J81b 1ML8A 5IP7I 1M1K1 4BBSI 5C4XI 1I6HI 3PO3I 1W2BZ 1QYPA 3CPWZ 3MZLB 2R92I 2K5RA 2M6NA 1YIJZ 1FDOA 4NBCA 3PO3S 5C4JI 2H85A 1QF8A 1TFIA 3J80f 3G71Z 3HKZA 1KC81 3H3VJ 1VQO1 2V8KA 2HU9A 1YIJ1 3FKII 3CD61 2Q4ZA 3NDIA 1NJI2 3CCR1 4RS4A 4RVGA 1K9M1 1M1K2 2JIPA 2LEXA 2JA8I 1Z01A 3FQMA 3IF8A 2O4HA 2O53A 2E2II 4E2XA 5LL6f 3S16I 3CME1 3S1MI 1X3WA 1YHQ1 2F4OA 2IZ4A 2V45A 3D9XA 1Q822 3GTPI 2OTLZ 3VMIA 1KC82 1VQPZ 4BY1I 3VMGA 3CC2Z 2RIQA 1WZNA 5D1OA 3GTOI 1YIT1 1R9TI 4NBHA 1TWAI 2JUBA 2RPRA 4NBAA 3CC7Z 2OTL1 4E2ZA 1RO2A 3G6E1 1VQ91 3QWUA 3CCEZ 3NH4A 4MXUA 4A3EI 1VQ5Z 1Q861 1VQ81 2IV2X 3GTLI 2QEXZ 2QA4Z 2QKDA 3CXCY 4MD7A 2JIQA 1VQ71 4MD9A 2LFUA 5C3EI 1Q16A 1Q812 3CCS1 1VQN1 3JAMf 1QVFY 1I3QI 3HOYI 4NBGA 1KQSZ 5A2Qb 2J6AA 3HOUI 4HGYA 3S1QI 3CCLZ 4BXXI 2M48A 3I07A 4DQYB 4MD8A 2IZ3A 3TE5B 1RQFA 4X6AI 2ZAEB 5IT9b 2JIRA 2V3VA 3G4SZ 3CCL1 1W2BY 3KIFA 3CPWY 1AA6A 4A3GI 2JNYA 3F3FC 4E31A 4NBEA 1VQMZ 2VF1A 3I561 3G4S1 2DE5A 2VPYA 2VUGA 4A3BI 3HOVI 1X3ZA 3I551 1VQOZ 4A3JI 4RVDA 5T67A 3CD6Z 1LQLA 1QVGZ 3CCRZ 2OZKA 1VQM1 3CCQZ 1Q821 2RT9A 2WAQA 3H0GI 1KRLA 1KD12 2QRCB 4A3LI 1Z02A 5FLXb 2KI7B 3VB9A 2R6MA 3CMEZ 3CCQ1 1YHQZ 4NFRA 4MONA 2JS4A 1YJWZ 2R7ZI 2NVQI 1RNIA 1NUIA 3U50C 4CL1A 4NBFA 1YITZ 4RV9A 3J81f 2OTJZ 5T64A 1YJW1 2VPZA 3G6EZ 1Q7Y2 1VQ9Z 3T4NB 3ESWA 3IFUA 1FDIA 2HF1A 1TWGI 2VUMI 1S72Z 1Q811 3I4MI 2OTJ1 1ZB9A 3HOWI 2AKLA 1VQ8Z 2VPXA 2E9HA 1K83I 1K8A2 1M902 3EEDA 4A3DI 2KPIA 2NAPA 3CCM1 1WIIA
chains in the Genus database with same CATH topology
2RBLA 1VQ7Z 3GTJI 3S15I 2JA7I 3GTKI 1S721 1ZH1A 2W03A 3BG1B 4TNUA 1TWFI 1ZB8A 4DGLA 3CCSZ 1VQNZ 3PO2I 2QR1B 1KQSY 3RZDI 1S7MA 1TWCI 1N8R2 4EWCA 4NB8A 2NVYI 1Z03A 1VQKZ 2QRDB 2GU2A 2F4MA 3NH8A 4RVHA 3RZOI 3D6WA 3S2DI 4S1TA 3NDJA 3GKQA 1VQK1 3MZKB 2P3YA 2QLVB 3CC41 3M3YI 3NH5A 3EERA 2YU9I 1VQ41 2I3CA 3I56Z 4E30A 2B63I 1KD11 3F3PC 4Y52I 1X0TA 3M4OI 5AN9F 2V8JA 2E2JI 3J80b 3I55Z 4MRIA 3CXCZ 4A3KI 1QVGY 3GTMI 1DL6A 1JJ2Z 2Y0SA 1Y1WI 1VQL1 3GTMS 4E33A 2JMOA 3CMA1 2QREB 3CQZI 4E32A 3I4NI 3S17I 5T6BA 4QTUA 4A3MI 3LUSA 1Q7Y1 5A2Qf 1YJNZ 4XX2A 1JWHC 4E2YA 3VMHA 1TWHI 3BG0B 1YUKA 1L1OC 1VLAA 3OW2Z 4A3FI 3GCFA 2PM9A 1VQ61 1Y1VI 5IT9f 1K8A1 1M901 2PMZA 2PK7A 1YJN1 2NVXI 3CCVZ 1WCMI 1Y1VS 3KIHA 2W04A 2YADA 4A3CI 3NFZA 2K3RA 5D1PA 1PFTA 3VTNA 2RHBA 3CCV1 1YI2Z 2JR6A 3CCMZ 2GTHA 1N8R1 1P9NA 2BJOA 3G711 1N2FA 1WW9A 1YI21 4BY7I 3TDHB 3JAMb 1USPA 1NP6A 2JA5I 5FLXf 3IX0A 2OOYB 2E2HI 3CCUZ 3S1RI 1USPB 4RVFA 4NH1C 1K731 3FQQA 5CM2M 2R93I 2G2KA 1K9M2 4NBBA 4A93I 3CCU1 5D1OB 1VQP1 3CCJZ 3CC4Z 2V8IA 3CC21 3P5JB 3HOXI 2WB1A 2P28A 3Q87A 1VQ4Z 5IP9I 4NB9A 4HH4A 3CC71 3MONA 1I50I 4QTTA 3J7A4 3CCE1 2DE7A 3CCJ1 1RO0A 1YJ9Z 4E2WA 1VQ51 1JJ2Y 2LIYA 1K732 4AYBA 3S1NI 4HGZA 2QEX1 1VQLZ 2QA41 4NBDA 1SFOI 3S14I 3S2HI 2NVTI 3CMAZ 1YJ91 5C44I 2GTIA 1YUAA 4NOZA 3GTQI 1Q862 3GTGI 1QVFZ 1RLYA 5FLMI 4Y7NI 4MH4A 2OOXB 4DK1A 3OW2Y 3K7AI 1NJI1 1VQ6Z 2EGTA 4BBRI 4A3II 2JA6I 3HOZI 2Q51A 1RO4A 2DE6A 3J81b 1ML8A 5IP7I 1M1K1 4BBSI 5C4XI 1I6HI 3PO3I 1W2BZ 1QYPA 3CPWZ 3MZLB 2R92I 2K5RA 2M6NA 1YIJZ 4NBCA 3PO3S 5C4JI 2H85A 1QF8A 1TFIA 3J80f 3G71Z 3HKZA 1KC81 3H3VJ 1VQO1 2V8KA 2HU9A 1YIJ1 3FKII 3CD61 2Q4ZA 3NDIA 1NJI2 3CCR1 4RS4A 4RVGA 1K9M1 1M1K2 2JA8I 1Z01A 3FQMA 3IF8A 2O4HA 2O53A 2E2II 4E2XA 5LL6f 3S16I 3CME1 3S1MI 1X3WA 1YHQ1 2F4OA 2IZ4A 3D9XA 1Q822 3GTPI 2OTLZ 3VMIA 1KC82 1VQPZ 4BY1I 3VMGA 3CC2Z 2RIQA 5D1OA 3GTOI 1YIT1 1R9TI 4NBHA 1TWAI 2JUBA 2RPRA 4NBAA 3CC7Z 2OTL1 4E2ZA 1RO2A 3G6E1 1VQ91 3QWUA 3CCEZ 3NH4A 4MXUA 4A3EI 1VQ5Z 1Q861 1VQ81 3GTLI 2QEXZ 2QA4Z 2QKDA 3CXCY 4MD7A 1VQ71 4MD9A 2LFUA 5C3EI 1Q812 3CCS1 1VQN1 3JAMf 1QVFY 1I3QI 3HOYI 4NBGA 1KQSZ 5A2Qb 2J6AA 3HOUI 4HGYA 3S1QI 3CCLZ 4BXXI 2M48A 3I07A 4DQYB 4MD8A 2IZ3A 3TE5B 1RQFA 4X6AI 2ZAEB 5IT9b 3G4SZ 3CCL1 1W2BY 3KIFA 3CPWY 4A3GI 2JNYA 3F3FC 4E31A 4NBEA 1VQMZ 2VF1A 3I561 3G4S1 2DE5A 2VUGA 4A3BI 3HOVI 1X3ZA 3I551 1VQOZ 4A3JI 4RVDA 5T67A 3CD6Z 1LQLA 1QVGZ 3CCRZ 2OZKA 1VQM1 3CCQZ 1Q821 2RT9A 2WAQA 3H0GI 1KRLA 1KD12 2QRCB 4A3LI 1Z02A 5FLXb 2KI7B 3VB9A 2R6MA 3CMEZ 3CCQ1 1YHQZ 4NFRA 4MONA 2JS4A 1YJWZ 2R7ZI 2NVQI 1RNIA 1NUIA 3U50C 4CL1A 4NBFA 1YITZ 4RV9A 3J81f 2OTJZ 5T64A 1YJW1 3G6EZ 1Q7Y2 1VQ9Z 3T4NB 3ESWA 3IFUA 2HF1A 1TWGI 2VUMI 1S72Z 1Q811 3I4MI 2OTJ1 1ZB9A 3HOWI 2AKLA 1VQ8Z 2E9HA 1K83I 1K8A2 1M902 3EEDA 4A3DI 2KPIA 3CCM1 1WIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C I;  4BBR I;  3HOY I;  2RBL A;  4A3I I;  2JA6 I;  3HOZ I;  4NBG A;  3GTJ I;  2JA7 I;  3S15 I;  3GTK I;  1RO4 A;  2DE6 A;  1PFT A;  1ML8 A;  2J6A A;  5IP7 I;  3HOU I;  4BBS I;  3S1Q I;  5C4X I;  4BXX I;  3I07 A;  1TWF I;  1ZB8 A;  2JR6 A;  1I6H I;  3PO3 I;  2BJO A;  3PO2 I;  1QYP A;  3RZD I;  1N2F A;  2R92 I;  4X6A I;  2K5R A;  1TWC I;  4NBC A;  4NB8 A;  3PO3 S;  5C4J I;  2NVY I;  1TFI A;  1WW9 A;  4BY7 I;  2F4M A;  1USP A;  3H3V J;  3RZO I;  3D6W A;  4A3G I;  2JNY A;  2JA5 I;  3FKI I;  2E2H I;  3S2D I;  4NBE A;  3S1R I;  2DE5 A;  1USP B;  3GKQ A;  2P3Y A;  4A3B I;  3HOV I;  1X3Z A;  5CM2 M;  3M3Y I;  2R93 I;  3EER A;  2YU9 I;  4A3J I;  2JA8 I;  1LQL A;  4NBB A;  4A93 I;  2E2I I;  2B63 I;  3S16 I;  3S1M I;  3M4O I;  4Y52 I;  2E2J I;  1X3W A;  3H0G I;  2F4O A;  3HOX I;  3Q87 A;  3GTP I;  4A3K I;  3GTM I;  5IP9 I;  4NB9 A;  3VMI A;  4A3L I;  1DL6 A;  3VB9 A;  1I50 I;  4QTT A;  1Y1W I;  4BY1 I;  3VMG A;  3GTM S;  2DE7 A;  3GTO I;  1R9T I;  4NBH A;  2JS4 A;  1TWA I;  4NBA A;  2R7Z I;  2NVQ I;  1NUI A;  3CQZ I;  3I4N I;  3S1N I;  3S17 I;  3U50 C;  4QTU A;  4A3M I;  3LUS A;  1SFO I;  4NBD A;  3S14 I;  3S2H I;  4NBF A;  2NVT I;  4XX2 A;  4A3E I;  3VMH A;  5C44 I;  1TWH I;  1YUA A;  3GTL I;  1L1O C;  1VLA A;  3ESW A;  4A3F I;  3GCF A;  4NOZ A;  3GTQ I;  3GTG I;  1Y1V I;  1RLY A;  2HF1 A;  1TWG I;  5FLM I;  4Y7N I;  2VUM I;  2PK7 A;  4MH4 A;  3I4M I;  2NVX I;  1ZB9 A;  5C3E I;  3HOW I;  2AKL A;  1WCM I;  1K83 I;  1Y1V S;  4A3D I;  2KPI A;  1I3Q I;  3K7A I; 
#chains in the Genus database with same CATH topology
 2RBL A;  1VQ7 Z;  3GTJ I;  3S15 I;  2JA7 I;  3GTK I;  1S72 1;  1ZH1 A;  2W03 A;  3BG1 B;  4TNU A;  1TWF I;  1ZB8 A;  4DGL A;  3CCS Z;  1VQN Z;  3PO2 I;  2QR1 B;  1KQS Y;  3RZD I;  1QXF A;  1S7M A;  1TWC I;  1N8R 2;  4EWC A;  4NB8 A;  2NVY I;  1Z03 A;  1VQK Z;  2QRD B;  2GU2 A;  2F4M A;  3NH8 A;  4RVH A;  3RZO I;  1WJ2 A;  3D6W A;  3S2D I;  4S1T A;  3NDJ A;  3GKQ A;  1VQK 1;  3MZK B;  2JIM A;  2P3Y A;  2QLV B;  3IR7 A;  3CC4 1;  3M3Y I;  3NH5 A;  3EER A;  2YU9 I;  1VQ4 1;  2I3C A;  3I56 Z;  4E30 A;  2B63 I;  1KD1 1;  3F3P C;  4Y52 I;  1X0T A;  2JIO A;  5AN9 F;  2V8J A;  2E2J I;  3M4O I;  3J80 b;  3I55 Z;  4MRI A;  3CXC Z;  4A3K I;  1QVG Y;  3GTM I;  1DL6 A;  1JJ2 Z;  2Y0S A;  1Y1W I;  1VQL 1;  3GTM S;  4E33 A;  2JMO A;  3CMA 1;  2QRE B;  3CQZ I;  4E32 A;  3I4N I;  3S17 I;  5T6B A;  4QTU A;  4A3M I;  3LUS A;  2E7Z A;  1SIW A;  1Q7Y 1;  5A2Q f;  1YJN Z;  4XX2 A;  1JWH C;  4E2Y A;  3VMH A;  1TWH I;  3BG0 B;  1Y8C A;  1YUK A;  1L1O C;  1VLA A;  3OW2 Z;  4A3F I;  3GCF A;  2PM9 A;  1VQ6 1;  1Y1V I;  5IT9 f;  1K8A 1;  1M90 1;  2PMZ A;  2PK7 A;  2AYD A;  1YJN 1;  2NVX I;  3CCV Z;  1WCM I;  1Y1V S;  3KIH A;  2W04 A;  2YAD A;  4A3C I;  3NFZ A;  2K3R A;  5D1P A;  1PFT A;  3VTN A;  2RHB A;  3CCV 1;  1YI2 Z;  2JR6 A;  3CCM Z;  2GTH A;  1N8R 1;  1P9N A;  2BJO A;  3G71 1;  1N2F A;  2VPW A;  1WW9 A;  1YI2 1;  4BY7 I;  3TDH B;  3JAM b;  1USP A;  1NP6 A;  2JA5 I;  5FLX f;  3IX0 A;  2OOY B;  2E2H I;  3CCU Z;  3S1R I;  1USP B;  4RVF A;  4NH1 C;  1K73 1;  3FQQ A;  5CM2 M;  2R93 I;  2G2K A;  1K9M 2;  4NBB A;  4A93 I;  3CCU 1;  5D1O B;  1VQP 1;  3CCJ Z;  3CC4 Z;  2V8I A;  3CC2 1;  3P5J B;  3HOX I;  2WB1 A;  2P28 A;  3Q87 A;  1VQ4 Z;  5IP9 I;  4NB9 A;  4HH4 A;  3CC7 1;  3MON A;  1I50 I;  4QTT A;  3J7A 4;  3CCE 1;  2DE7 A;  3CCJ 1;  1RO0 A;  1YJ9 Z;  4E2W A;  1VQ5 1;  1JJ2 Y;  2LIY A;  1K73 2;  4AYB A;  3S1N I;  4HGZ A;  3D2L A;  2QEX 1;  1VQL Z;  2QA4 1;  4NBD A;  1SFO I;  3S14 I;  3S2H I;  2NVT I;  3CMA Z;  1YJ9 1;  5C44 I;  2GTI A;  1YUA A;  4NOZ A;  3GTQ I;  1Q86 2;  3GTG I;  1QVF Z;  1RLY A;  5FLM I;  4Y7N I;  4MH4 A;  2OOX B;  4DK1 A;  3OW2 Y;  3K7A I;  1NJI 1;  1VQ6 Z;  2EGT A;  4BBR I;  4A3I I;  2JA6 I;  3HOZ I;  2Q51 A;  1RO4 A;  2DE6 A;  3J81 b;  1ML8 A;  5IP7 I;  1M1K 1;  4BBS I;  5C4X I;  1I6H I;  3PO3 I;  1W2B Z;  1QYP A;  3CPW Z;  3MZL B;  2R92 I;  2K5R A;  2M6N A;  1YIJ Z;  1FDO A;  4NBC A;  3PO3 S;  5C4J I;  2H85 A;  1QF8 A;  1TFI A;  3J80 f;  3G71 Z;  3HKZ A;  1KC8 1;  3H3V J;  1VQO 1;  2V8K A;  2HU9 A;  1YIJ 1;  3FKI I;  3CD6 1;  2Q4Z A;  3NDI A;  1NJI 2;  3CCR 1;  4RS4 A;  4RVG A;  1K9M 1;  1M1K 2;  2JIP A;  2LEX A;  2JA8 I;  1Z01 A;  3FQM A;  3IF8 A;  2O4H A;  2O53 A;  2E2I I;  4E2X A;  5LL6 f;  3S16 I;  3CME 1;  3S1M I;  1X3W A;  1YHQ 1;  2F4O A;  2IZ4 A;  2V45 A;  3D9X A;  1Q82 2;  3GTP I;  2OTL Z;  3VMI A;  1KC8 2;  1VQP Z;  4BY1 I;  3VMG A;  3CC2 Z;  2RIQ A;  1WZN A;  5D1O A;  3GTO I;  1YIT 1;  1R9T I;  4NBH A;  1TWA I;  2JUB A;  2RPR A;  4NBA A;  3CC7 Z;  2OTL 1;  4E2Z A;  1RO2 A;  3G6E 1;  1VQ9 1;  3QWU A;  3CCE Z;  3NH4 A;  4MXU A;  4A3E I;  1VQ5 Z;  1Q86 1;  1VQ8 1;  2IV2 X;  3GTL I;  2QEX Z;  2QA4 Z;  2QKD A;  3CXC Y;  4MD7 A;  2JIQ A;  1VQ7 1;  4MD9 A;  2LFU A;  5C3E I;  1Q16 A;  1Q81 2;  3CCS 1;  1VQN 1;  3JAM f;  1QVF Y;  1I3Q I;  3HOY I;  4NBG A;  1KQS Z;  5A2Q b;  2J6A A;  3HOU I;  4HGY A;  3S1Q I;  3CCL Z;  4BXX I;  2M48 A;  3I07 A;  4DQY B;  4MD8 A;  2IZ3 A;  3TE5 B;  1RQF A;  4X6A I;  2ZAE B;  5IT9 b;  2JIR A;  2V3V A;  3G4S Z;  3CCL 1;  1W2B Y;  3KIF A;  3CPW Y;  1AA6 A;  4A3G I;  2JNY A;  3F3F C;  4E31 A;  4NBE A;  1VQM Z;  2VF1 A;  3I56 1;  3G4S 1;  2DE5 A;  2VPY A;  2VUG A;  4A3B I;  3HOV I;  1X3Z A;  3I55 1;  1VQO Z;  4A3J I;  4RVD A;  5T67 A;  3CD6 Z;  1LQL A;  1QVG Z;  3CCR Z;  2OZK A;  1VQM 1;  3CCQ Z;  1Q82 1;  2RT9 A;  2WAQ A;  3H0G I;  1KRL A;  1KD1 2;  2QRC B;  4A3L I;  1Z02 A;  5FLX b;  2KI7 B;  3VB9 A;  2R6M A;  3CME Z;  3CCQ 1;  1YHQ Z;  4NFR A;  4MON A;  2JS4 A;  1YJW Z;  2R7Z I;  2NVQ I;  1RNI A;  1NUI A;  3U50 C;  4CL1 A;  4NBF A;  1YIT Z;  4RV9 A;  3J81 f;  2OTJ Z;  5T64 A;  1YJW 1;  2VPZ A;  3G6E Z;  1Q7Y 2;  1VQ9 Z;  3T4N B;  3ESW A;  3IFU A;  1FDI A;  2HF1 A;  1TWG I;  2VUM I;  1S72 Z;  1Q81 1;  3I4M I;  2OTJ 1;  1ZB9 A;  3HOW I;  2AKL A;  1VQ8 Z;  2VPX A;  2E9H A;  1K83 I;  1K8A 2;  1M90 2;  3EED A;  4A3D I;  2KPI A;  2NAP A;  3CCM 1;  1WII A; 
#chains in the Genus database with same CATH homology
 2RBL A;  1VQ7 Z;  3GTJ I;  3S15 I;  2JA7 I;  3GTK I;  1S72 1;  1ZH1 A;  2W03 A;  3BG1 B;  4TNU A;  1TWF I;  1ZB8 A;  4DGL A;  3CCS Z;  1VQN Z;  3PO2 I;  2QR1 B;  1KQS Y;  3RZD I;  1S7M A;  1TWC I;  1N8R 2;  4EWC A;  4NB8 A;  2NVY I;  1Z03 A;  1VQK Z;  2QRD B;  2GU2 A;  2F4M A;  3NH8 A;  4RVH A;  3RZO I;  3D6W A;  3S2D I;  4S1T A;  3NDJ A;  3GKQ A;  1VQK 1;  3MZK B;  2P3Y A;  2QLV B;  3CC4 1;  3M3Y I;  3NH5 A;  3EER A;  2YU9 I;  1VQ4 1;  2I3C A;  3I56 Z;  4E30 A;  2B63 I;  1KD1 1;  3F3P C;  4Y52 I;  1X0T A;  3M4O I;  5AN9 F;  2V8J A;  2E2J I;  3J80 b;  3I55 Z;  4MRI A;  3CXC Z;  4A3K I;  1QVG Y;  3GTM I;  1DL6 A;  1JJ2 Z;  2Y0S A;  1Y1W I;  1VQL 1;  3GTM S;  4E33 A;  2JMO A;  3CMA 1;  2QRE B;  3CQZ I;  4E32 A;  3I4N I;  3S17 I;  5T6B A;  4QTU A;  4A3M I;  3LUS A;  1Q7Y 1;  5A2Q f;  1YJN Z;  4XX2 A;  1JWH C;  4E2Y A;  3VMH A;  1TWH I;  3BG0 B;  1YUK A;  1L1O C;  1VLA A;  3OW2 Z;  4A3F I;  3GCF A;  2PM9 A;  1VQ6 1;  1Y1V I;  5IT9 f;  1K8A 1;  1M90 1;  2PMZ A;  2PK7 A;  1YJN 1;  2NVX I;  3CCV Z;  1WCM I;  1Y1V S;  3KIH A;  2W04 A;  2YAD A;  4A3C I;  3NFZ A;  2K3R A;  5D1P A;  1PFT A;  3VTN A;  2RHB A;  3CCV 1;  1YI2 Z;  2JR6 A;  3CCM Z;  2GTH A;  1N8R 1;  1P9N A;  2BJO A;  3G71 1;  1N2F A;  1WW9 A;  1YI2 1;  4BY7 I;  3TDH B;  3JAM b;  1USP A;  1NP6 A;  2JA5 I;  5FLX f;  3IX0 A;  2OOY B;  2E2H I;  3CCU Z;  3S1R I;  1USP B;  4RVF A;  4NH1 C;  1K73 1;  3FQQ A;  5CM2 M;  2R93 I;  2G2K A;  1K9M 2;  4NBB A;  4A93 I;  3CCU 1;  5D1O B;  1VQP 1;  3CCJ Z;  3CC4 Z;  2V8I A;  3CC2 1;  3P5J B;  3HOX I;  2WB1 A;  2P28 A;  3Q87 A;  1VQ4 Z;  5IP9 I;  4NB9 A;  4HH4 A;  3CC7 1;  3MON A;  1I50 I;  4QTT A;  3J7A 4;  3CCE 1;  2DE7 A;  3CCJ 1;  1RO0 A;  1YJ9 Z;  4E2W A;  1VQ5 1;  1JJ2 Y;  2LIY A;  1K73 2;  4AYB A;  3S1N I;  4HGZ A;  2QEX 1;  1VQL Z;  2QA4 1;  4NBD A;  1SFO I;  3S14 I;  3S2H I;  2NVT I;  3CMA Z;  1YJ9 1;  5C44 I;  2GTI A;  1YUA A;  4NOZ A;  3GTQ I;  1Q86 2;  3GTG I;  1QVF Z;  1RLY A;  5FLM I;  4Y7N I;  4MH4 A;  2OOX B;  4DK1 A;  3OW2 Y;  3K7A I;  1NJI 1;  1VQ6 Z;  2EGT A;  4BBR I;  4A3I I;  2JA6 I;  3HOZ I;  2Q51 A;  1RO4 A;  2DE6 A;  3J81 b;  1ML8 A;  5IP7 I;  1M1K 1;  4BBS I;  5C4X I;  1I6H I;  3PO3 I;  1W2B Z;  1QYP A;  3CPW Z;  3MZL B;  2R92 I;  2K5R A;  2M6N A;  1YIJ Z;  4NBC A;  3PO3 S;  5C4J I;  2H85 A;  1QF8 A;  1TFI A;  3J80 f;  3G71 Z;  3HKZ A;  1KC8 1;  3H3V J;  1VQO 1;  2V8K A;  2HU9 A;  1YIJ 1;  3FKI I;  3CD6 1;  2Q4Z A;  3NDI A;  1NJI 2;  3CCR 1;  4RS4 A;  4RVG A;  1K9M 1;  1M1K 2;  2JA8 I;  1Z01 A;  3FQM A;  3IF8 A;  2O4H A;  2O53 A;  2E2I I;  4E2X A;  5LL6 f;  3S16 I;  3CME 1;  3S1M I;  1X3W A;  1YHQ 1;  2F4O A;  2IZ4 A;  3D9X A;  1Q82 2;  3GTP I;  2OTL Z;  3VMI A;  1KC8 2;  1VQP Z;  4BY1 I;  3VMG A;  3CC2 Z;  2RIQ A;  5D1O A;  3GTO I;  1YIT 1;  1R9T I;  4NBH A;  1TWA I;  2JUB A;  2RPR A;  4NBA A;  3CC7 Z;  2OTL 1;  4E2Z A;  1RO2 A;  3G6E 1;  1VQ9 1;  3QWU A;  3CCE Z;  3NH4 A;  4MXU A;  4A3E I;  1VQ5 Z;  1Q86 1;  1VQ8 1;  3GTL I;  2QEX Z;  2QA4 Z;  2QKD A;  3CXC Y;  4MD7 A;  1VQ7 1;  4MD9 A;  2LFU A;  5C3E I;  1Q81 2;  3CCS 1;  1VQN 1;  3JAM f;  1QVF Y;  1I3Q I;  3HOY I;  4NBG A;  1KQS Z;  5A2Q b;  2J6A A;  3HOU I;  4HGY A;  3S1Q I;  3CCL Z;  4BXX I;  2M48 A;  3I07 A;  4DQY B;  4MD8 A;  2IZ3 A;  3TE5 B;  1RQF A;  4X6A I;  2ZAE B;  5IT9 b;  3G4S Z;  3CCL 1;  1W2B Y;  3KIF A;  3CPW Y;  4A3G I;  2JNY A;  3F3F C;  4E31 A;  4NBE A;  1VQM Z;  2VF1 A;  3I56 1;  3G4S 1;  2DE5 A;  2VUG A;  4A3B I;  3HOV I;  1X3Z A;  3I55 1;  1VQO Z;  4A3J I;  4RVD A;  5T67 A;  3CD6 Z;  1LQL A;  1QVG Z;  3CCR Z;  2OZK A;  1VQM 1;  3CCQ Z;  1Q82 1;  2RT9 A;  2WAQ A;  3H0G I;  1KRL A;  1KD1 2;  2QRC B;  4A3L I;  1Z02 A;  5FLX b;  2KI7 B;  3VB9 A;  2R6M A;  3CME Z;  3CCQ 1;  1YHQ Z;  4NFR A;  4MON A;  2JS4 A;  1YJW Z;  2R7Z I;  2NVQ I;  1RNI A;  1NUI A;  3U50 C;  4CL1 A;  4NBF A;  1YIT Z;  4RV9 A;  3J81 f;  2OTJ Z;  5T64 A;  1YJW 1;  3G6E Z;  1Q7Y 2;  1VQ9 Z;  3T4N B;  3ESW A;  3IFU A;  2HF1 A;  1TWG I;  2VUM I;  1S72 Z;  1Q81 1;  3I4M I;  2OTJ 1;  1ZB9 A;  3HOW I;  2AKL A;  1VQ8 Z;  2E9H A;  1K83 I;  1K8A 2;  1M90 2;  3EED A;  4A3D I;  2KPI A;  3CCM 1;  1WII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...