3CD6Z

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6Z00
2QA4Z 1KQSY 1YJ91 2OTJZ 3CCRZ 3CD6Z 1K9M1 1N8R2 3CCSZ 3CPWY 3I56Z 1VQLZ 1Q861 1Q812 1QVFZ 1VQ91 1VQ41 1YIJZ 3CCE1 1KD11 1N8R1 1QVGZ 3CCM1 3CCL1 1QVFY 1YJ9Z 1K8A2 3G6E1 1QVGY 1VQ81 3CMA1 1YHQZ 3CCV1 1Q7Y2 1M902 1K8A1 3OW2Z 1VQ9Z 1VQ4Z 2QEX1 3CCEZ 3CC21 1VQ61 3CCMZ 3CCLZ 3OW2Y 3CCJ1 1YJW1 1M901 3G6EZ 3CMAZ 3CC71 1JJ2Z 3G4SZ 1YI21 3CCVZ 1K732 1Q811 1VQK1 1Q822 1VQO1 1K9M2 3G711 1VQ6Z 1K731 3CCJZ 1YJWZ 3CC41 1Q821 3CCQ1 3CC7Z 1YI2Z 1KC82 3CME1 1VQ51 1S721 1Q7Y1 1VQM1 1NJI2 3I551 3CXCZ 1VQKZ 1VQ8Z 3CCU1 1VQOZ 1VQL1 3G71Z 2OTL1 1KC81 3CXCY 3CC4Z 1JJ2Y 1VQ71 1VQP1 1M1K2 3CCQZ 2QEXZ 1YIT1 1Q862 3CC2Z 3CPWZ 1VQN1 3CMEZ 1S72Z 1VQ5Z 1VQMZ 1KD12 1YJN1 3I55Z 2QA41 1YHQ1 1M1K1 3CCUZ 1W2BZ 2OTLZ 2OTJ1 3CCR1 3CD61 1W2BY 3CCS1 1VQ7Z 1VQPZ 3I561 1YITZ 1KQSZ 1VQNZ 1YIJ1 3G4S1 1YJNZ 1NJI1
chains in the Genus database with same CATH superfamily
2G2KA 4A3CI 4HGYA 2RPRA 3EEDA 3K7AI 3CCRZ 5D1PA 3NDIA 5T64A 3PO2I 4E31A 2OOYB 1ML8A 2VPZA 1Q861 1Q812 2B63I 1QVFZ 1VQ91 2Q4ZA 2E2II 1N8R1 3CQZI 1QVGZ 5C4XI 3CCL1 1WCMI 2RHBA 1S7MA 3GKQA 5A2Qb 1N2FA 3GCFA 2OOXB 1P9NA 2GTIA 3GTKI 3CCV1 4A3KI 1Q7Y2 1M902 4QTUA 4Y52I 1VQ9Z 2DE5A 3GTJI 4E2YA 4A3II 3CC21 3IF8A 3IX0A 4DGLA 3CCLZ 2NVQI 3CCJ1 1YJW1 3Q87A 2O4HA 2PM9A 3LUSA 1JJ2Z 1RNIA 3CCVZ 3BG1B 2IV2X 1K732 3RZDI 1WZNA 1Q811 1NUIA 2V3VA 3G711 4A3DI 2JUBA 3M4OI 2KI7B 2E2HI 3CCJZ 1Y1VI 2O53A 1YJWZ 1KRLA 1X3WA 1Q821 4QTTA 3CCQ1 3T4NB 1VQ51 1S721 1Q7Y1 1NJI2 4MD8A 2VPWA 3G71Z 4A3LI 3S2HI 2F4MA 1TFIA 3ESWA 2K3RA 1FDIA 3CCQZ 2WAQA 3J7A4 3EERA 3HOUI 3PO3S 1PFTA 1S72Z 1VQ5Z 1KD12 2JA6I 4NBHA 2RIQA 1YHQ1 2QA41 2R92I 3D6WA 4A3FI 5C4JI 3GTGI 2AYDA 4A3EI 3JAMf 2KPIA 3CCS1 2BJOA 4NB9A 1KQSZ 1K83I 2YU9I 1Z02A 4E2XA 1NJI1 3HOXI 2QA4Z 4NBDA 3NFZA 1YUAA 2RT9A 1K9M1 1N8R2 3IR7A 3NH8A 3CCSZ 3CPWY 3HOYI 1VQLZ 2JIPA 2W03A 2GTHA 1KD11 2JMOA 3CCM1 4A3JI 3S1RI 2Q51A 3G6E1 1VQ81 3CMA1 2V8JA 3VMGA 4BBRI 2R6MA 2HF1A 4RVHA 1TWHI 2DE6A 2JR6A 2NVXI 2OZKA 5C3EI 1VQ61 2VPYA 3CCMZ 1L1OC 3OW2Y 3G6EZ 3CMAZ 2QLVB 2QRDB 3CC71 1NP6A 2AKLA 1RLYA 1RQFA 1Q822 1VQO1 3P5JB 3NH4A 1VQ6Z 1USPB 2VPXA 3CC41 5AN9F 3CC7Z 3GTLI 4NBFA 3S2DI 4A93I 3CXCZ 3TDHB 1VQOZ 4HH4A 2ZAEB 1KC81 2JS4A 4DQYB 3CC4Z 3NH5A 2E2JI 2M6NA 1YIT1 3HOZI 3FQMA 3CC2Z 3CPWZ 2JA5I 2V8IA 3VMHA 4CL1A 2QREB 2F4OA 5IT9b 2DE7A 5CM2M 1W2BZ 2J6AA 4MD7A 3QWUA 3D9XA 1Y1VS 5T67A 1RO4A 3S15I 3MZKB 4NBGA 1YITZ 2PMZA 1LQLA 2QR1B 1Z01A 2YADA 3S14I 1YIJ1 5FLMI 1ZB8A 3G4S1 1K9M2 1I6HI 1VLAA 4S1TA 1YJ91 3GTPI 1TWGI 3S1QI 4TNUA 1YIJZ 3CCE1 2VF1A 3I07A 4Y7NI 1RO2A 4NB8A 1QVFY 2E7ZA 1YJ9Z 3NDJA 1DL6A 1QVGY 3MZLB 4NOZA 4RVGA 1QF8A 2JA8I 1YHQZ 2I3CA 1K8A1 2VUMI 4X6AI 2QEX1 2JIRA 3CCEZ 2IZ3A 2HU9A 4NH1C 2JIQA 3F3FC 3GTMI 4MD9A 1ZH1A 1X3ZA 1FDOA 2LFUA 4MONA 1TWFI 3I4MI 3KIHA 2RBLA 4NFRA 2JA7I 3HOWI 4XX2A 4E2ZA 3HKZA 4RVFA 5D1OB 3H3VJ 1JWHC 1Y8CA 1KC82 1VQM1 3S1MI 1VQ8Z 1I3QI 3CCU1 2V8KA 3VB9A 2NVTI 3J81b 3J80b 1TWAI 1Q16A 2GU2A 2OTL1 4E33A 2VUGA 2WB1A 1VQ71 3HOVI 1WIIA 5FLXf 1X0TA 1R9TI 1VQN1 1Z03A 4DK1A 1VQMZ 3I4NI 2V45A 5IT9f 1M1K1 3CCUZ 5IP7I 1QXFA 2OTLZ 2OTJ1 4NBCA 3CD61 3H0GI 2LEXA 1VQ7Z 2P28A 3I561 4BXXI 3GTQI 4A3BI 1VQNZ 1KQSY 1QYPA 4AYBA 5FLXb 3D2LA 4NBBA 2OTJZ 2E9HA 1Y1WI 3CD6Z 3GTOI 2JIOA 5IP9I 3I56Z 2QKDA 1VQ41 3U50C 3M3YI 3F3PC 1K8A2 4A3MI 3BG0B 4RS4A 4MRIA 2K5RA 2P3YA 3S17I 3TE5B 5T6BA 4RV9A 5C44I 1YJNZ 3OW2Z 1RO0A 4MH4A 1VQ4Z 4RVDA 1SFOI 1M901 4E30A 4BY7I 1WW9A 2LIYA 3MONA 3G4SZ 1YI21 3PO3I 2EGTA 1VQK1 1YUKA 1SIWA 3KIFA 4NBAA 2QRCB 3S1NI 1K731 2PK7A 4NBEA 1YI2Z 2M48A 3CME1 2R7ZI 3RZOI 3VMIA 4E32A 2JNYA 3IFUA 2JIMA 3I551 1VQKZ 1AA6A 1TWCI 3J81f 1VQL1 2H85A 3J80f 1ZB9A 2Y0SA 3CXCY 1JJ2Y 3VTNA 2W04A 1VQP1 1M1K2 5D1OA 2QEXZ 1Q862 4EWCA 4A3GI 3CMEZ 3GTMS 3S16I 1YJN1 2NVYI 2NAPA 3FKII 3I55Z 4BY1I 4MXUA 3CCR1 4HGZA 4BBSI 3JAMb 1W2BY 1VQPZ 1I50I 5LL6f 2IZ4A 1WJ2A 5A2Qf 1USPA 3FQQA 2R93I 4E2WA
chains in the Genus database with same CATH topology
2G2KA 4A3CI 4HGYA 2RPRA 3EEDA 3K7AI 3CCRZ 5D1PA 3NDIA 5T64A 3PO2I 4E31A 2OOYB 1ML8A 1Q861 1Q812 2B63I 1QVFZ 1VQ91 2Q4ZA 2E2II 1N8R1 3CQZI 1QVGZ 5C4XI 3CCL1 1WCMI 2RHBA 1S7MA 3GKQA 5A2Qb 1N2FA 3GCFA 2OOXB 1P9NA 2GTIA 3GTKI 3CCV1 4A3KI 1Q7Y2 1M902 4QTUA 4Y52I 1VQ9Z 2DE5A 3GTJI 4E2YA 4A3II 3CC21 3IF8A 3IX0A 4DGLA 3CCLZ 2NVQI 3CCJ1 1YJW1 3Q87A 2O4HA 2PM9A 3LUSA 1JJ2Z 1RNIA 3CCVZ 3BG1B 1K732 3RZDI 1Q811 1NUIA 3G711 4A3DI 2JUBA 3M4OI 2KI7B 2E2HI 3CCJZ 1Y1VI 2O53A 1YJWZ 1KRLA 1X3WA 1Q821 4QTTA 3CCQ1 3T4NB 1VQ51 1S721 1Q7Y1 1NJI2 4MD8A 3G71Z 4A3LI 3S2HI 2F4MA 1TFIA 3ESWA 2K3RA 3CCQZ 2WAQA 3J7A4 3EERA 3HOUI 3PO3S 1PFTA 1S72Z 1VQ5Z 1KD12 2JA6I 4NBHA 2RIQA 1YHQ1 2QA41 2R92I 3D6WA 4A3FI 5C4JI 3GTGI 4A3EI 3JAMf 2KPIA 3CCS1 2BJOA 4NB9A 1KQSZ 1K83I 2YU9I 1Z02A 4E2XA 1NJI1 3HOXI 2QA4Z 4NBDA 3NFZA 1YUAA 2RT9A 1K9M1 1N8R2 3NH8A 3CCSZ 3CPWY 3HOYI 1VQLZ 2W03A 2GTHA 1KD11 2JMOA 3CCM1 4A3JI 3S1RI 2Q51A 3G6E1 1VQ81 3CMA1 2V8JA 3VMGA 4BBRI 2R6MA 2HF1A 4RVHA 1TWHI 2DE6A 2JR6A 2NVXI 2OZKA 5C3EI 1VQ61 3CCMZ 1L1OC 3OW2Y 3G6EZ 3CMAZ 2QLVB 2QRDB 3CC71 1NP6A 2AKLA 1RLYA 1RQFA 1Q822 1VQO1 3P5JB 3NH4A 1VQ6Z 1USPB 3CC41 5AN9F 3CC7Z 3GTLI 4NBFA 3S2DI 4A93I 3CXCZ 3TDHB 1VQOZ 4HH4A 2ZAEB 1KC81 2JS4A 4DQYB 3CC4Z 3NH5A 2E2JI 2M6NA 1YIT1 3HOZI 3FQMA 3CC2Z 3CPWZ 2JA5I 2V8IA 3VMHA 4CL1A 2QREB 2F4OA 5IT9b 2DE7A 5CM2M 1W2BZ 2J6AA 4MD7A 3QWUA 3D9XA 1Y1VS 5T67A 1RO4A 3S15I 3MZKB 4NBGA 1YITZ 2PMZA 1LQLA 2QR1B 1Z01A 2YADA 3S14I 1YIJ1 5FLMI 1ZB8A 3G4S1 1K9M2 1I6HI 1VLAA 4S1TA 1YJ91 3GTPI 1TWGI 3S1QI 4TNUA 1YIJZ 3CCE1 2VF1A 3I07A 4Y7NI 1RO2A 4NB8A 1QVFY 1YJ9Z 3NDJA 1DL6A 1QVGY 3MZLB 4NOZA 4RVGA 1QF8A 2JA8I 1YHQZ 2I3CA 1K8A1 2VUMI 4X6AI 2QEX1 3CCEZ 2IZ3A 2HU9A 4NH1C 3F3FC 3GTMI 4MD9A 1ZH1A 1X3ZA 2LFUA 4MONA 1TWFI 3I4MI 3KIHA 2RBLA 4NFRA 2JA7I 3HOWI 4XX2A 4E2ZA 3HKZA 4RVFA 5D1OB 3H3VJ 1JWHC 1KC82 1VQM1 3S1MI 1VQ8Z 1I3QI 3CCU1 2V8KA 3VB9A 2NVTI 3J81b 3J80b 1TWAI 2OTL1 2GU2A 4E33A 2VUGA 2WB1A 1VQ71 3HOVI 1WIIA 5FLXf 1X0TA 1R9TI 1VQN1 1Z03A 4DK1A 1VQMZ 3I4NI 5IT9f 1M1K1 3CCUZ 5IP7I 2OTLZ 2OTJ1 4NBCA 3CD61 3H0GI 1VQ7Z 2P28A 3I561 4BXXI 3GTQI 4A3BI 1VQNZ 1KQSY 1QYPA 4AYBA 5FLXb 4NBBA 2OTJZ 2E9HA 1Y1WI 3CD6Z 3GTOI 5IP9I 3I56Z 2QKDA 1VQ41 3U50C 3M3YI 3F3PC 1K8A2 4A3MI 3BG0B 4RS4A 4MRIA 2K5RA 2P3YA 3S17I 3TE5B 5T6BA 4RV9A 5C44I 1YJNZ 3OW2Z 1RO0A 4MH4A 1VQ4Z 4RVDA 1SFOI 1M901 4E30A 4BY7I 1WW9A 2LIYA 3MONA 3G4SZ 1YI21 3PO3I 2EGTA 1VQK1 1YUKA 3KIFA 4NBAA 2QRCB 3S1NI 1K731 2PK7A 4NBEA 1YI2Z 2M48A 3CME1 2R7ZI 3RZOI 3VMIA 4E32A 2JNYA 3IFUA 3I551 1VQKZ 1TWCI 3J81f 1VQL1 2H85A 3J80f 1ZB9A 2Y0SA 3CXCY 1JJ2Y 3VTNA 2W04A 1VQP1 1M1K2 5D1OA 2QEXZ 1Q862 4EWCA 4A3GI 3CMEZ 3GTMS 3S16I 1YJN1 2NVYI 3FKII 3I55Z 4BY1I 4MXUA 3CCR1 4HGZA 4BBSI 3JAMb 1W2BY 1VQPZ 1I50I 5LL6f 2IZ4A 5A2Qf 1USPA 3FQQA 2R93I 4E2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  1KQS Y;  1YJ9 1;  2OTJ Z;  3CCR Z;  3CD6 Z;  1K9M 1;  1N8R 2;  3CCS Z;  3CPW Y;  3I56 Z;  1VQL Z;  1Q86 1;  1Q81 2;  1QVF Z;  1VQ9 1;  1VQ4 1;  1YIJ Z;  3CCE 1;  1KD1 1;  1N8R 1;  1QVG Z;  3CCM 1;  3CCL 1;  1QVF Y;  1YJ9 Z;  1K8A 2;  3G6E 1;  1QVG Y;  1VQ8 1;  3CMA 1;  1YHQ Z;  3CCV 1;  1Q7Y 2;  1M90 2;  1K8A 1;  3OW2 Z;  1VQ9 Z;  1VQ4 Z;  2QEX 1;  3CCE Z;  3CC2 1;  1VQ6 1;  3CCM Z;  3CCL Z;  3OW2 Y;  3CCJ 1;  1YJW 1;  1M90 1;  3G6E Z;  3CMA Z;  3CC7 1;  1JJ2 Z;  3G4S Z;  1YI2 1;  3CCV Z;  1K73 2;  1Q81 1;  1VQK 1;  1Q82 2;  1VQO 1;  1K9M 2;  3G71 1;  1VQ6 Z;  1K73 1;  3CCJ Z;  1YJW Z;  3CC4 1;  1Q82 1;  3CCQ 1;  3CC7 Z;  1YI2 Z;  1KC8 2;  3CME 1;  1VQ5 1;  1S72 1;  1Q7Y 1;  1VQM 1;  1NJI 2;  3I55 1;  3CXC Z;  1VQK Z;  1VQ8 Z;  3CCU 1;  1VQO Z;  1VQL 1;  3G71 Z;  2OTL 1;  1KC8 1;  3CXC Y;  3CC4 Z;  1JJ2 Y;  1VQ7 1;  1VQP 1;  1M1K 2;  3CCQ Z;  2QEX Z;  1YIT 1;  1Q86 2;  3CC2 Z;  3CPW Z;  1VQN 1;  3CME Z;  1S72 Z;  1VQ5 Z;  1VQM Z;  1KD1 2;  1YJN 1;  3I55 Z;  2QA4 1;  1YHQ 1;  1M1K 1;  3CCU Z;  1W2B Z;  2OTL Z;  2OTJ 1;  3CCR 1;  3CD6 1;  1W2B Y;  3CCS 1;  1VQ7 Z;  1VQP Z;  3I56 1;  1YIT Z;  1KQS Z;  1VQN Z;  1YIJ 1;  3G4S 1;  1YJN Z;  1NJI 1; 
#chains in the Genus database with same CATH topology
 2G2K A;  4A3C I;  4HGY A;  2RPR A;  3EED A;  3K7A I;  3CCR Z;  5D1P A;  3NDI A;  5T64 A;  3PO2 I;  4E31 A;  2OOY B;  1ML8 A;  2VPZ A;  1Q86 1;  1Q81 2;  2B63 I;  1QVF Z;  1VQ9 1;  2Q4Z A;  2E2I I;  1N8R 1;  3CQZ I;  1QVG Z;  5C4X I;  3CCL 1;  1WCM I;  2RHB A;  1S7M A;  3GKQ A;  5A2Q b;  1N2F A;  3GCF A;  2OOX B;  1P9N A;  2GTI A;  3GTK I;  3CCV 1;  4A3K I;  1Q7Y 2;  1M90 2;  4QTU A;  4Y52 I;  1VQ9 Z;  2DE5 A;  3GTJ I;  4E2Y A;  4A3I I;  3CC2 1;  3IF8 A;  3IX0 A;  4DGL A;  3CCL Z;  2NVQ I;  3CCJ 1;  1YJW 1;  3Q87 A;  2O4H A;  2PM9 A;  3LUS A;  1JJ2 Z;  1RNI A;  3CCV Z;  3BG1 B;  2IV2 X;  1K73 2;  3RZD I;  1WZN A;  1Q81 1;  1NUI A;  2V3V A;  3G71 1;  4A3D I;  2JUB A;  3M4O I;  2KI7 B;  2E2H I;  3CCJ Z;  1Y1V I;  2O53 A;  1YJW Z;  1KRL A;  1X3W A;  1Q82 1;  4QTT A;  3CCQ 1;  3T4N B;  1VQ5 1;  1S72 1;  1Q7Y 1;  1NJI 2;  4MD8 A;  2VPW A;  3G71 Z;  4A3L I;  3S2H I;  2F4M A;  1TFI A;  3ESW A;  2K3R A;  1FDI A;  3CCQ Z;  2WAQ A;  3J7A 4;  3EER A;  3HOU I;  3PO3 S;  1PFT A;  1S72 Z;  1VQ5 Z;  1KD1 2;  2JA6 I;  4NBH A;  2RIQ A;  1YHQ 1;  2QA4 1;  2R92 I;  3D6W A;  4A3F I;  5C4J I;  3GTG I;  2AYD A;  4A3E I;  3JAM f;  2KPI A;  3CCS 1;  2BJO A;  4NB9 A;  1KQS Z;  1K83 I;  2YU9 I;  1Z02 A;  4E2X A;  1NJI 1;  3HOX I;  2QA4 Z;  4NBD A;  3NFZ A;  1YUA A;  2RT9 A;  1K9M 1;  1N8R 2;  3IR7 A;  3NH8 A;  3CCS Z;  3CPW Y;  3HOY I;  1VQL Z;  2JIP A;  2W03 A;  2GTH A;  1KD1 1;  2JMO A;  3CCM 1;  4A3J I;  3S1R I;  2Q51 A;  3G6E 1;  1VQ8 1;  3CMA 1;  2V8J A;  3VMG A;  4BBR I;  2R6M A;  2HF1 A;  4RVH A;  1TWH I;  2DE6 A;  2JR6 A;  2NVX I;  2OZK A;  5C3E I;  1VQ6 1;  2VPY A;  3CCM Z;  1L1O C;  3OW2 Y;  3G6E Z;  3CMA Z;  2QLV B;  2QRD B;  3CC7 1;  1NP6 A;  2AKL A;  1RLY A;  1RQF A;  1Q82 2;  1VQO 1;  3P5J B;  3NH4 A;  1VQ6 Z;  1USP B;  2VPX A;  3CC4 1;  5AN9 F;  3CC7 Z;  3GTL I;  4NBF A;  3S2D I;  4A93 I;  3CXC Z;  3TDH B;  1VQO Z;  4HH4 A;  2ZAE B;  1KC8 1;  2JS4 A;  4DQY B;  3CC4 Z;  3NH5 A;  2E2J I;  2M6N A;  1YIT 1;  3HOZ I;  3FQM A;  3CC2 Z;  3CPW Z;  2JA5 I;  2V8I A;  3VMH A;  4CL1 A;  2QRE B;  2F4O A;  5IT9 b;  2DE7 A;  5CM2 M;  1W2B Z;  2J6A A;  4MD7 A;  3QWU A;  3D9X A;  1Y1V S;  5T67 A;  1RO4 A;  3S15 I;  3MZK B;  4NBG A;  1YIT Z;  2PMZ A;  1LQL A;  2QR1 B;  1Z01 A;  2YAD A;  3S14 I;  1YIJ 1;  5FLM I;  1ZB8 A;  3G4S 1;  1K9M 2;  1I6H I;  1VLA A;  4S1T A;  1YJ9 1;  3GTP I;  1TWG I;  3S1Q I;  4TNU A;  1YIJ Z;  3CCE 1;  2VF1 A;  3I07 A;  4Y7N I;  1RO2 A;  4NB8 A;  1QVF Y;  2E7Z A;  1YJ9 Z;  3NDJ A;  1DL6 A;  1QVG Y;  3MZL B;  4NOZ A;  4RVG A;  1QF8 A;  2JA8 I;  1YHQ Z;  2I3C A;  1K8A 1;  2VUM I;  4X6A I;  2QEX 1;  2JIR A;  3CCE Z;  2IZ3 A;  2HU9 A;  4NH1 C;  2JIQ A;  3F3F C;  3GTM I;  4MD9 A;  1ZH1 A;  1X3Z A;  1FDO A;  2LFU A;  4MON A;  1TWF I;  3I4M I;  3KIH A;  2RBL A;  4NFR A;  2JA7 I;  3HOW I;  4XX2 A;  4E2Z A;  3HKZ A;  4RVF A;  5D1O B;  3H3V J;  1JWH C;  1Y8C A;  1KC8 2;  1VQM 1;  3S1M I;  1VQ8 Z;  1I3Q I;  3CCU 1;  2V8K A;  3VB9 A;  2NVT I;  3J81 b;  3J80 b;  1TWA I;  1Q16 A;  2GU2 A;  2OTL 1;  4E33 A;  2VUG A;  2WB1 A;  1VQ7 1;  3HOV I;  1WII A;  5FLX f;  1X0T A;  1R9T I;  1VQN 1;  1Z03 A;  4DK1 A;  1VQM Z;  3I4N I;  2V45 A;  5IT9 f;  1M1K 1;  3CCU Z;  5IP7 I;  1QXF A;  2OTL Z;  2OTJ 1;  4NBC A;  3CD6 1;  3H0G I;  2LEX A;  1VQ7 Z;  2P28 A;  3I56 1;  4BXX I;  3GTQ I;  4A3B I;  1VQN Z;  1KQS Y;  1QYP A;  4AYB A;  5FLX b;  3D2L A;  4NBB A;  2OTJ Z;  2E9H A;  1Y1W I;  3CD6 Z;  3GTO I;  2JIO A;  5IP9 I;  3I56 Z;  2QKD A;  1VQ4 1;  3U50 C;  3M3Y I;  3F3P C;  1K8A 2;  4A3M I;  3BG0 B;  4RS4 A;  4MRI A;  2K5R A;  2P3Y A;  3S17 I;  3TE5 B;  5T6B A;  4RV9 A;  5C44 I;  1YJN Z;  3OW2 Z;  1RO0 A;  4MH4 A;  1VQ4 Z;  4RVD A;  1SFO I;  1M90 1;  4E30 A;  4BY7 I;  1WW9 A;  2LIY A;  3MON A;  3G4S Z;  1YI2 1;  3PO3 I;  2EGT A;  1VQK 1;  1YUK A;  1SIW A;  3KIF A;  4NBA A;  2QRC B;  3S1N I;  1K73 1;  2PK7 A;  4NBE A;  1YI2 Z;  2M48 A;  3CME 1;  2R7Z I;  3RZO I;  3VMI A;  4E32 A;  2JNY A;  3IFU A;  2JIM A;  3I55 1;  1VQK Z;  1AA6 A;  1TWC I;  3J81 f;  1VQL 1;  2H85 A;  3J80 f;  1ZB9 A;  2Y0S A;  3CXC Y;  1JJ2 Y;  3VTN A;  2W04 A;  1VQP 1;  1M1K 2;  5D1O A;  2QEX Z;  1Q86 2;  4EWC A;  4A3G I;  3CME Z;  3GTM S;  3S16 I;  1YJN 1;  2NVY I;  2NAP A;  3FKI I;  3I55 Z;  4BY1 I;  4MXU A;  3CCR 1;  4HGZ A;  4BBS I;  3JAM b;  1W2B Y;  1VQP Z;  1I50 I;  5LL6 f;  2IZ4 A;  1WJ2 A;  5A2Q f;  1USP A;  3FQQ A;  2R93 I;  4E2W A; 
#chains in the Genus database with same CATH homology
 2G2K A;  4A3C I;  4HGY A;  2RPR A;  3EED A;  3K7A I;  3CCR Z;  5D1P A;  3NDI A;  5T64 A;  3PO2 I;  4E31 A;  2OOY B;  1ML8 A;  1Q86 1;  1Q81 2;  2B63 I;  1QVF Z;  1VQ9 1;  2Q4Z A;  2E2I I;  1N8R 1;  3CQZ I;  1QVG Z;  5C4X I;  3CCL 1;  1WCM I;  2RHB A;  1S7M A;  3GKQ A;  5A2Q b;  1N2F A;  3GCF A;  2OOX B;  1P9N A;  2GTI A;  3GTK I;  3CCV 1;  4A3K I;  1Q7Y 2;  1M90 2;  4QTU A;  4Y52 I;  1VQ9 Z;  2DE5 A;  3GTJ I;  4E2Y A;  4A3I I;  3CC2 1;  3IF8 A;  3IX0 A;  4DGL A;  3CCL Z;  2NVQ I;  3CCJ 1;  1YJW 1;  3Q87 A;  2O4H A;  2PM9 A;  3LUS A;  1JJ2 Z;  1RNI A;  3CCV Z;  3BG1 B;  1K73 2;  3RZD I;  1Q81 1;  1NUI A;  3G71 1;  4A3D I;  2JUB A;  3M4O I;  2KI7 B;  2E2H I;  3CCJ Z;  1Y1V I;  2O53 A;  1YJW Z;  1KRL A;  1X3W A;  1Q82 1;  4QTT A;  3CCQ 1;  3T4N B;  1VQ5 1;  1S72 1;  1Q7Y 1;  1NJI 2;  4MD8 A;  3G71 Z;  4A3L I;  3S2H I;  2F4M A;  1TFI A;  3ESW A;  2K3R A;  3CCQ Z;  2WAQ A;  3J7A 4;  3EER A;  3HOU I;  3PO3 S;  1PFT A;  1S72 Z;  1VQ5 Z;  1KD1 2;  2JA6 I;  4NBH A;  2RIQ A;  1YHQ 1;  2QA4 1;  2R92 I;  3D6W A;  4A3F I;  5C4J I;  3GTG I;  4A3E I;  3JAM f;  2KPI A;  3CCS 1;  2BJO A;  4NB9 A;  1KQS Z;  1K83 I;  2YU9 I;  1Z02 A;  4E2X A;  1NJI 1;  3HOX I;  2QA4 Z;  4NBD A;  3NFZ A;  1YUA A;  2RT9 A;  1K9M 1;  1N8R 2;  3NH8 A;  3CCS Z;  3CPW Y;  3HOY I;  1VQL Z;  2W03 A;  2GTH A;  1KD1 1;  2JMO A;  3CCM 1;  4A3J I;  3S1R I;  2Q51 A;  3G6E 1;  1VQ8 1;  3CMA 1;  2V8J A;  3VMG A;  4BBR I;  2R6M A;  2HF1 A;  4RVH A;  1TWH I;  2DE6 A;  2JR6 A;  2NVX I;  2OZK A;  5C3E I;  1VQ6 1;  3CCM Z;  1L1O C;  3OW2 Y;  3G6E Z;  3CMA Z;  2QLV B;  2QRD B;  3CC7 1;  1NP6 A;  2AKL A;  1RLY A;  1RQF A;  1Q82 2;  1VQO 1;  3P5J B;  3NH4 A;  1VQ6 Z;  1USP B;  3CC4 1;  5AN9 F;  3CC7 Z;  3GTL I;  4NBF A;  3S2D I;  4A93 I;  3CXC Z;  3TDH B;  1VQO Z;  4HH4 A;  2ZAE B;  1KC8 1;  2JS4 A;  4DQY B;  3CC4 Z;  3NH5 A;  2E2J I;  2M6N A;  1YIT 1;  3HOZ I;  3FQM A;  3CC2 Z;  3CPW Z;  2JA5 I;  2V8I A;  3VMH A;  4CL1 A;  2QRE B;  2F4O A;  5IT9 b;  2DE7 A;  5CM2 M;  1W2B Z;  2J6A A;  4MD7 A;  3QWU A;  3D9X A;  1Y1V S;  5T67 A;  1RO4 A;  3S15 I;  3MZK B;  4NBG A;  1YIT Z;  2PMZ A;  1LQL A;  2QR1 B;  1Z01 A;  2YAD A;  3S14 I;  1YIJ 1;  5FLM I;  1ZB8 A;  3G4S 1;  1K9M 2;  1I6H I;  1VLA A;  4S1T A;  1YJ9 1;  3GTP I;  1TWG I;  3S1Q I;  4TNU A;  1YIJ Z;  3CCE 1;  2VF1 A;  3I07 A;  4Y7N I;  1RO2 A;  4NB8 A;  1QVF Y;  1YJ9 Z;  3NDJ A;  1DL6 A;  1QVG Y;  3MZL B;  4NOZ A;  4RVG A;  1QF8 A;  2JA8 I;  1YHQ Z;  2I3C A;  1K8A 1;  2VUM I;  4X6A I;  2QEX 1;  3CCE Z;  2IZ3 A;  2HU9 A;  4NH1 C;  3F3F C;  3GTM I;  4MD9 A;  1ZH1 A;  1X3Z A;  2LFU A;  4MON A;  1TWF I;  3I4M I;  3KIH A;  2RBL A;  4NFR A;  2JA7 I;  3HOW I;  4XX2 A;  4E2Z A;  3HKZ A;  4RVF A;  5D1O B;  3H3V J;  1JWH C;  1KC8 2;  1VQM 1;  3S1M I;  1VQ8 Z;  1I3Q I;  3CCU 1;  2V8K A;  3VB9 A;  2NVT I;  3J81 b;  3J80 b;  1TWA I;  2OTL 1;  2GU2 A;  4E33 A;  2VUG A;  2WB1 A;  1VQ7 1;  3HOV I;  1WII A;  5FLX f;  1X0T A;  1R9T I;  1VQN 1;  1Z03 A;  4DK1 A;  1VQM Z;  3I4N I;  5IT9 f;  1M1K 1;  3CCU Z;  5IP7 I;  2OTL Z;  2OTJ 1;  4NBC A;  3CD6 1;  3H0G I;  1VQ7 Z;  2P28 A;  3I56 1;  4BXX I;  3GTQ I;  4A3B I;  1VQN Z;  1KQS Y;  1QYP A;  4AYB A;  5FLX b;  4NBB A;  2OTJ Z;  2E9H A;  1Y1W I;  3CD6 Z;  3GTO I;  5IP9 I;  3I56 Z;  2QKD A;  1VQ4 1;  3U50 C;  3M3Y I;  3F3P C;  1K8A 2;  4A3M I;  3BG0 B;  4RS4 A;  4MRI A;  2K5R A;  2P3Y A;  3S17 I;  3TE5 B;  5T6B A;  4RV9 A;  5C44 I;  1YJN Z;  3OW2 Z;  1RO0 A;  4MH4 A;  1VQ4 Z;  4RVD A;  1SFO I;  1M90 1;  4E30 A;  4BY7 I;  1WW9 A;  2LIY A;  3MON A;  3G4S Z;  1YI2 1;  3PO3 I;  2EGT A;  1VQK 1;  1YUK A;  3KIF A;  4NBA A;  2QRC B;  3S1N I;  1K73 1;  2PK7 A;  4NBE A;  1YI2 Z;  2M48 A;  3CME 1;  2R7Z I;  3RZO I;  3VMI A;  4E32 A;  2JNY A;  3IFU A;  3I55 1;  1VQK Z;  1TWC I;  3J81 f;  1VQL 1;  2H85 A;  3J80 f;  1ZB9 A;  2Y0S A;  3CXC Y;  1JJ2 Y;  3VTN A;  2W04 A;  1VQP 1;  1M1K 2;  5D1O A;  2QEX Z;  1Q86 2;  4EWC A;  4A3G I;  3CME Z;  3GTM S;  3S16 I;  1YJN 1;  2NVY I;  3FKI I;  3I55 Z;  4BY1 I;  4MXU A;  3CCR 1;  4HGZ A;  4BBS I;  3JAM b;  1W2B Y;  1VQP Z;  1I50 I;  5LL6 f;  2IZ4 A;  5A2Q f;  1USP A;  3FQQ A;  2R93 I;  4E2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...