3CD6Z

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6Z00
3CMEZ 3CCE1 1VQPZ 1VQ61 3CC4Z 3CCJ1 3CCQ1 1K732 1K8A2 1KC81 1Q811 2QEXZ 1Q862 1KD12 2OTL1 1YI2Z 3G71Z 1JJ2Z 3CCUZ 1NJI2 1YHQ1 1W2BY 1KQSY 1VQ5Z 1VQMZ 2QA41 1Q822 1Q861 3CME1 3CCRZ 1YITZ 1VQP1 3G6E1 3CC41 3OW2Z 1YIJZ 1YJNZ 3CPWY 3CC7Z 1VQNZ 2QEX1 3G4SZ 3CC2Z 1M1K1 3CCMZ 1QVGZ 1Q821 3CMAZ 3CCLZ 1VQ8Z 3I56Z 1YJ9Z 3CCU1 1K731 1K8A1 1K9M2 1VQKZ 1VQLZ 3CD6Z 2OTJZ 3CCSZ 3CCEZ 1VQM1 1VQOZ 1VQ4Z 3CCV1 1KD11 3CXCY 3CCJZ 1Q7Y2 1QVFY 1VQ9Z 1VQ7Z 1YIJ1 1M902 1NJI1 1K9M1 1VQN1 1W2BZ 1KQSZ 3CCM1 1S72Z 1Q7Y1 1YI21 3G711 3I55Z 1YHQZ 1VQ81 3I561 1VQK1 1YJWZ 3CD61 1VQ51 2OTJ1 3CCS1 3CPWZ 1VQO1 1JJ2Y 1N8R2 1VQ41 3G6EZ 3CCR1 1VQ6Z 1YIT1 3CCQZ 1VQ91 1VQ71 1YJN1 3CC71 3G4S1 3CC21 1S721 2OTLZ 1N8R1 3OW2Y 3CXCZ 3CMA1 3I551 3CCL1 1KC82 1Q812 1QVGY 1QVFZ 1YJ91 1M901 1YJW1 1M1K2 2QA4Z 1VQL1 3CCVZ
chains in the Genus database with same CATH superfamily
2NAPA 3EERA 3GCFA 2V8JA 4A3EI 3VMIA 2GTHA 5IP7I 3FQQA 4E32A 4A3DI 1VQ61 1K8A2 1KC81 4NBAA 1Q811 3RZDI 2QRDB 2JMOA 2NVQI 3G71Z 3P5JB 3NH5A 2DE6A 4BBRI 2H85A 3VTNA 3MZLB 3KIHA 3S1NI 2NVXI 1VLAA 3J81b 5A2Qf 3ESWA 2QLVB 5AN9F 1KQSY 2JIRA 4Y52I 3S17I 1YITZ 4NB8A 2K5RA 3EEDA 2YU9I 2M48A 3G6E1 2E2JI 2I3CA 2B63I 4MD7A 1FDIA 3S1MI 2F4MA 1Z03A 4MD8A 3H0GI 3NDIA 3J7A4 3GKQA 2RBLA 1YJ9Z 1PFTA 1X3ZA 3CCU1 4A3KI 2OOYB 2W03A 4NBCA 2M6NA 2BJOA 2VPWA 3S1RI 2ZAEB 4NBGA 3CXCY 3CCJZ 3NFZA 3HOYI 2E2HI 3U50C 5C4XI 3LUSA 2JS4A 2O4HA 4RVFA 1KQSZ 3CCM1 5T6BA 3HOXI 3GTMS 4E2ZA 5C44I 3I561 2JA7I 3TDHB 1QF8A 1QYPA 3CD61 4E2WA 1VQ51 2R7ZI 2RIQA 3CCS1 2OTJ1 4NBBA 1WIIA 1VQ41 2PK7A 1AA6A 1Q16A 3GTMI 1YUAA 4A3BI 2QREB 2J6AA 4MRIA 4HGZA 3VB9A 3CC71 3FKII 4RS4A 3G4S1 4HH4A 1Z02A 2OTLZ 3I4MI 3OW2Y 3J81f 4A3LI 5LL6f 3CXCZ 3CMA1 4A93I 2VUGA 3CCL1 3F3FC 1QVGY 1WZNA 1YJW1 1WJ2A 2QA4Z 3JAMb 1VQK1 3CCVZ 3F3PC 2E2II 3BG0B 3I4NI 2KPIA 3J80b 4NH1C 1VQPZ 4QTTA 3CC4Z 1Y1VS 1K732 3CCQ1 2Q51A 2LFUA 4RV9A 4BBSI 2P28A 2VF1A 3NDJA 1KD12 4A3II 1YI2Z 5D1OB 2LIYA 1I6HI 2R6MA 3NH4A 3T4NB 1Y1VI 2G2KA 1W2BY 2PMZA 2JUBA 3OW2Z 1TWCI 3VMHA 2VPZA 3CPWY 2JA8I 5FLMI 3D6WA 3GTJI 1I3QI 1M1K1 1QVGZ 2RT9A 3M4OI 1TWGI 1SFOI 2E9HA 3M3YI 3PO2I 4RVGA 4BY1I 1Q7Y2 4E2XA 1VQ9Z 3MZKB 1VQ7Z 1M902 1NJI1 1P9NA 4NB9A 1S7MA 1W2BZ 1WW9A 2JIQA 2KI7B 3I55Z 1TFIA 2VUMI 3JAMf 2OOXB 2QR1B 1TWHI 3J80f 3CPWZ 1USPB 2V8KA 1JJ2Y 5IP9I 3G6EZ 3CCR1 5CM2M 1FDOA 3S14I 2R92I 2O53A 2JIPA 1YJN1 4MD9A 3Q87A 3GTGI 1JWHC 3CC21 2QKDA 3IX0A 3FQMA 4E33A 2OZKA 3IR7A 1VQL1 3CMEZ 3CCE1 2JIOA 4QTUA 4A3GI 4A3CI 3K7AI 2QEXZ 4RVDA 2EGTA 2WAQA 2YADA 1KRLA 4AYBA 1Q862 3IF8A 2OTL1 4MH4A 4EWCA 1JJ2Z 1RO0A 2GU2A 1YHQ1 1VQ5Z 1VQMZ 2QA41 2NVYI 1Q822 1ZH1A 2QRCB 4NBFA 2IZ3A 1VQP1 4Y7NI 2VPXA 3CC41 1YIJZ 1R9TI 4E31A 3CC7Z 1Y1WI 1VQNZ 3G4SZ 4NBDA 2K3RA 3PO3S 4BY7I 4TNUA 1X3WA 2HF1A 3S16I 3CMAZ 3S1QI 4E30A 3CCLZ 1VQ8Z 3HOWI 1L1OC 1LQLA 1K8A1 1K9M2 1VQKZ 2V3VA 1ZB9A 4RVHA 3GTOI 2JNYA 4S1TA 1VQOZ 3PO3I 2P3YA 1TWFI 3HOUI 2W04A 4MONA 1DL6A 3IFUA 3GTPI 2JA5I 1NP6A 2AYDA 1S72Z 3HKZA 4DK1A 3RZOI 3MONA 4E2YA 4BXXI 1Q7Y1 3H3VJ 3G711 3HOVI 2Y0SA 1TWAI 1N8R2 2F4OA 1VQ6Z 3S2DI 1YIT1 3NH8A 5D1PA 1N2FA 1VQ91 1VQ71 4MXUA 3QWUA 2RHBA 3CQZI 5T67A 1ML8A 1X0TA 1ZB8A 3I551 1KC82 1Q812 2VPYA 4DQYB 1YJ91 2E7ZA 1M1K2 5IT9b 4XX2A 4NBHA 2DE7A 4NOZA 3CCJ1 2R93I 3TE5B 5C4JI 5D1OA 4CL1A 4NFRA 1YUKA 3CCUZ 1NJI2 4DGLA 3BG1B 1Q861 3CME1 5C3EI 3CCRZ 2V8IA 2GTIA 3GTLI 1YJNZ 1NUIA 1Z01A 2QEX1 3CC2Z 3CCMZ 1Q821 1RQFA 5T64A 1K83I 5FLXf 2AKLA 2JIMA 2HU9A 2WB1A 3I56Z 1RO4A 1K731 1VQLZ 3CD6Z 2OTJZ 3CCEZ 3CCSZ 1VQM1 1RLYA 5A2Qb 1I50I 1VQ4Z 3CCV1 1KD11 3GTQI 3S15I 1QVFY 3HOZI 1RNIA 1YIJ1 4A3MI 1K9M1 3D2LA 3S2HI 1VQN1 1SIWA 2JR6A 2NVTI 4NBEA 2DE5A 1RO2A 1YI21 1YHQZ 1VQ81 2V45A 5IT9f 1YJWZ 1USPA 2Q4ZA 4X6AI 4HGYA 1VQO1 3D9XA 3GTKI 2IZ4A 3CCQZ 3VMGA 1QXFA 3KIFA 2LEXA 3I07A 1Y8CA 4A3JI 4A3FI 1S721 2RPRA 1N8R1 1WCMI 2IV2X 5FLXb 1QVFZ 1M901 2JA6I 2PM9A
chains in the Genus database with same CATH topology
3EERA 3GCFA 2V8JA 4A3EI 3VMIA 2GTHA 5IP7I 3FQQA 4E32A 4A3DI 1VQ61 1K8A2 1KC81 4NBAA 1Q811 3RZDI 2QRDB 2JMOA 2NVQI 3G71Z 3P5JB 3NH5A 2DE6A 4BBRI 2H85A 3VTNA 3MZLB 3KIHA 3S1NI 2NVXI 1VLAA 3J81b 5A2Qf 3ESWA 2QLVB 5AN9F 1KQSY 4Y52I 3S17I 1YITZ 4NB8A 2K5RA 3EEDA 2YU9I 2M48A 3G6E1 2E2JI 2I3CA 2B63I 4MD7A 3S1MI 2F4MA 1Z03A 4MD8A 3H0GI 3NDIA 3J7A4 3GKQA 2RBLA 1YJ9Z 1PFTA 1X3ZA 3CCU1 4A3KI 2OOYB 2W03A 4NBCA 2M6NA 2BJOA 3S1RI 2ZAEB 4NBGA 3CXCY 3CCJZ 3NFZA 3HOYI 2E2HI 3U50C 5C4XI 3LUSA 2JS4A 2O4HA 4RVFA 1KQSZ 3CCM1 5T6BA 3HOXI 3GTMS 4E2ZA 5C44I 3I561 2JA7I 3TDHB 1QF8A 1QYPA 3CD61 4E2WA 1VQ51 2R7ZI 2RIQA 3CCS1 2OTJ1 4NBBA 1WIIA 1VQ41 2PK7A 3GTMI 1YUAA 4A3BI 2QREB 2J6AA 4MRIA 4HGZA 3VB9A 3CC71 3FKII 4RS4A 3G4S1 4HH4A 1Z02A 2OTLZ 3I4MI 3OW2Y 3J81f 4A3LI 5LL6f 3CXCZ 3CMA1 4A93I 2VUGA 3CCL1 3F3FC 1QVGY 1YJW1 2QA4Z 3JAMb 1VQK1 3CCVZ 3F3PC 2E2II 3BG0B 3I4NI 2KPIA 3J80b 4NH1C 1VQPZ 4QTTA 3CC4Z 1Y1VS 1K732 3CCQ1 2Q51A 2LFUA 4RV9A 4BBSI 2P28A 2VF1A 3NDJA 1KD12 4A3II 1YI2Z 5D1OB 2LIYA 1I6HI 2R6MA 3NH4A 3T4NB 1Y1VI 2G2KA 1W2BY 2PMZA 2JUBA 3OW2Z 1TWCI 3VMHA 3CPWY 2JA8I 5FLMI 3D6WA 3GTJI 1I3QI 1M1K1 1QVGZ 2RT9A 3M4OI 1TWGI 1SFOI 2E9HA 3M3YI 3PO2I 4RVGA 4BY1I 1Q7Y2 4E2XA 1VQ9Z 3MZKB 1VQ7Z 1M902 1NJI1 1P9NA 4NB9A 1S7MA 1W2BZ 1WW9A 2KI7B 3I55Z 1TFIA 2VUMI 3JAMf 2OOXB 2QR1B 1TWHI 3J80f 3CPWZ 1USPB 2V8KA 1JJ2Y 5IP9I 3G6EZ 3CCR1 5CM2M 3S14I 2R92I 2O53A 1YJN1 4MD9A 3Q87A 3GTGI 1JWHC 3CC21 2QKDA 3IX0A 3FQMA 4E33A 2OZKA 1VQL1 3CMEZ 3CCE1 4QTUA 4A3GI 4A3CI 3K7AI 2QEXZ 4RVDA 2EGTA 2WAQA 2YADA 1KRLA 4AYBA 1Q862 3IF8A 2OTL1 4MH4A 4EWCA 1JJ2Z 1RO0A 2GU2A 1YHQ1 1VQ5Z 1VQMZ 2QA41 2NVYI 1Q822 1ZH1A 2QRCB 4NBFA 2IZ3A 1VQP1 4Y7NI 3CC41 1YIJZ 1R9TI 4E31A 3CC7Z 1Y1WI 1VQNZ 3G4SZ 4NBDA 2K3RA 3PO3S 4BY7I 4TNUA 1X3WA 2HF1A 3S16I 3CMAZ 3S1QI 4E30A 3CCLZ 1VQ8Z 3HOWI 1L1OC 1LQLA 1K8A1 1K9M2 1VQKZ 1ZB9A 4RVHA 3GTOI 2JNYA 4S1TA 1VQOZ 3PO3I 2P3YA 1TWFI 3HOUI 2W04A 4MONA 1DL6A 3IFUA 3GTPI 2JA5I 1NP6A 1S72Z 3HKZA 4DK1A 3RZOI 3MONA 4E2YA 4BXXI 1Q7Y1 3H3VJ 3G711 3HOVI 2Y0SA 1TWAI 1N8R2 2F4OA 1VQ6Z 3S2DI 1YIT1 3NH8A 5D1PA 1N2FA 1VQ91 1VQ71 4MXUA 3QWUA 2RHBA 3CQZI 5T67A 1ML8A 1X0TA 1ZB8A 3I551 1KC82 1Q812 4DQYB 1YJ91 1M1K2 5IT9b 4XX2A 4NBHA 2DE7A 4NOZA 3CCJ1 2R93I 3TE5B 5C4JI 5D1OA 4CL1A 4NFRA 1YUKA 3CCUZ 1NJI2 4DGLA 3BG1B 1Q861 3CME1 5C3EI 3CCRZ 2V8IA 2GTIA 3GTLI 1YJNZ 1NUIA 1Z01A 2QEX1 3CC2Z 3CCMZ 1Q821 1RQFA 5T64A 1K83I 5FLXf 2AKLA 2HU9A 2WB1A 3I56Z 1RO4A 1K731 1VQLZ 3CD6Z 2OTJZ 3CCEZ 3CCSZ 1VQM1 1RLYA 5A2Qb 1I50I 1VQ4Z 3CCV1 1KD11 3GTQI 3S15I 1QVFY 3HOZI 1RNIA 1YIJ1 4A3MI 1K9M1 3S2HI 1VQN1 2JR6A 2NVTI 4NBEA 2DE5A 1RO2A 1YI21 1YHQZ 1VQ81 5IT9f 1YJWZ 1USPA 2Q4ZA 4X6AI 4HGYA 1VQO1 3D9XA 3GTKI 2IZ4A 3CCQZ 3VMGA 3KIFA 3I07A 4A3JI 4A3FI 1S721 2RPRA 1N8R1 1WCMI 5FLXb 1QVFZ 1M901 2JA6I 2PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Z;  3CCE 1;  1VQP Z;  1VQ6 1;  3CC4 Z;  3CCJ 1;  3CCQ 1;  1K73 2;  1K8A 2;  1KC8 1;  1Q81 1;  2QEX Z;  1Q86 2;  1KD1 2;  2OTL 1;  1YI2 Z;  3G71 Z;  1JJ2 Z;  3CCU Z;  1NJI 2;  1YHQ 1;  1W2B Y;  1KQS Y;  1VQ5 Z;  1VQM Z;  2QA4 1;  1Q82 2;  1Q86 1;  3CME 1;  3CCR Z;  1YIT Z;  1VQP 1;  3G6E 1;  3CC4 1;  3OW2 Z;  1YIJ Z;  1YJN Z;  3CPW Y;  3CC7 Z;  1VQN Z;  2QEX 1;  3G4S Z;  3CC2 Z;  1M1K 1;  3CCM Z;  1QVG Z;  1Q82 1;  3CMA Z;  3CCL Z;  1VQ8 Z;  3I56 Z;  1YJ9 Z;  3CCU 1;  1K73 1;  1K8A 1;  1K9M 2;  1VQK Z;  1VQL Z;  3CD6 Z;  2OTJ Z;  3CCS Z;  3CCE Z;  1VQM 1;  1VQO Z;  1VQ4 Z;  3CCV 1;  1KD1 1;  3CXC Y;  3CCJ Z;  1Q7Y 2;  1QVF Y;  1VQ9 Z;  1VQ7 Z;  1YIJ 1;  1M90 2;  1NJI 1;  1K9M 1;  1VQN 1;  1W2B Z;  1KQS Z;  3CCM 1;  1S72 Z;  1Q7Y 1;  1YI2 1;  3G71 1;  3I55 Z;  1YHQ Z;  1VQ8 1;  3I56 1;  1VQK 1;  1YJW Z;  3CD6 1;  1VQ5 1;  2OTJ 1;  3CCS 1;  3CPW Z;  1VQO 1;  1JJ2 Y;  1N8R 2;  1VQ4 1;  3G6E Z;  3CCR 1;  1VQ6 Z;  1YIT 1;  3CCQ Z;  1VQ9 1;  1VQ7 1;  1YJN 1;  3CC7 1;  3G4S 1;  3CC2 1;  1S72 1;  2OTL Z;  1N8R 1;  3OW2 Y;  3CXC Z;  3CMA 1;  3I55 1;  3CCL 1;  1KC8 2;  1Q81 2;  1QVG Y;  1QVF Z;  1YJ9 1;  1M90 1;  1YJW 1;  1M1K 2;  2QA4 Z;  1VQL 1;  3CCV Z; 
#chains in the Genus database with same CATH topology
 2NAP A;  3EER A;  3GCF A;  2V8J A;  4A3E I;  3VMI A;  2GTH A;  5IP7 I;  3FQQ A;  4E32 A;  4A3D I;  1VQ6 1;  1K8A 2;  1KC8 1;  4NBA A;  1Q81 1;  3RZD I;  2QRD B;  2JMO A;  2NVQ I;  3G71 Z;  3P5J B;  3NH5 A;  2DE6 A;  4BBR I;  2H85 A;  3VTN A;  3MZL B;  3KIH A;  3S1N I;  2NVX I;  1VLA A;  3J81 b;  5A2Q f;  3ESW A;  2QLV B;  5AN9 F;  1KQS Y;  2JIR A;  4Y52 I;  3S17 I;  1YIT Z;  4NB8 A;  2K5R A;  3EED A;  2YU9 I;  2M48 A;  3G6E 1;  2E2J I;  2I3C A;  2B63 I;  4MD7 A;  1FDI A;  3S1M I;  2F4M A;  1Z03 A;  4MD8 A;  3H0G I;  3NDI A;  3J7A 4;  3GKQ A;  2RBL A;  1YJ9 Z;  1PFT A;  1X3Z A;  3CCU 1;  4A3K I;  2OOY B;  2W03 A;  4NBC A;  2M6N A;  2BJO A;  2VPW A;  3S1R I;  2ZAE B;  4NBG A;  3CXC Y;  3CCJ Z;  3NFZ A;  3HOY I;  2E2H I;  3U50 C;  5C4X I;  3LUS A;  2JS4 A;  2O4H A;  4RVF A;  1KQS Z;  3CCM 1;  5T6B A;  3HOX I;  3GTM S;  4E2Z A;  5C44 I;  3I56 1;  2JA7 I;  3TDH B;  1QF8 A;  1QYP A;  3CD6 1;  4E2W A;  1VQ5 1;  2R7Z I;  2RIQ A;  3CCS 1;  2OTJ 1;  4NBB A;  1WII A;  1VQ4 1;  2PK7 A;  1AA6 A;  1Q16 A;  3GTM I;  1YUA A;  4A3B I;  2QRE B;  2J6A A;  4MRI A;  4HGZ A;  3VB9 A;  3CC7 1;  3FKI I;  4RS4 A;  3G4S 1;  4HH4 A;  1Z02 A;  2OTL Z;  3I4M I;  3OW2 Y;  3J81 f;  4A3L I;  5LL6 f;  3CXC Z;  3CMA 1;  4A93 I;  2VUG A;  3CCL 1;  3F3F C;  1QVG Y;  1WZN A;  1YJW 1;  1WJ2 A;  2QA4 Z;  3JAM b;  1VQK 1;  3CCV Z;  3F3P C;  2E2I I;  3BG0 B;  3I4N I;  2KPI A;  3J80 b;  4NH1 C;  1VQP Z;  4QTT A;  3CC4 Z;  1Y1V S;  1K73 2;  3CCQ 1;  2Q51 A;  2LFU A;  4RV9 A;  4BBS I;  2P28 A;  2VF1 A;  3NDJ A;  1KD1 2;  4A3I I;  1YI2 Z;  5D1O B;  2LIY A;  1I6H I;  2R6M A;  3NH4 A;  3T4N B;  1Y1V I;  2G2K A;  1W2B Y;  2PMZ A;  2JUB A;  3OW2 Z;  1TWC I;  3VMH A;  2VPZ A;  3CPW Y;  2JA8 I;  5FLM I;  3D6W A;  3GTJ I;  1I3Q I;  1M1K 1;  1QVG Z;  2RT9 A;  3M4O I;  1TWG I;  1SFO I;  2E9H A;  3M3Y I;  3PO2 I;  4RVG A;  4BY1 I;  1Q7Y 2;  4E2X A;  1VQ9 Z;  3MZK B;  1VQ7 Z;  1M90 2;  1NJI 1;  1P9N A;  4NB9 A;  1S7M A;  1W2B Z;  1WW9 A;  2JIQ A;  2KI7 B;  3I55 Z;  1TFI A;  2VUM I;  3JAM f;  2OOX B;  2QR1 B;  1TWH I;  3J80 f;  3CPW Z;  1USP B;  2V8K A;  1JJ2 Y;  5IP9 I;  3G6E Z;  3CCR 1;  5CM2 M;  1FDO A;  3S14 I;  2R92 I;  2O53 A;  2JIP A;  1YJN 1;  4MD9 A;  3Q87 A;  3GTG I;  1JWH C;  3CC2 1;  2QKD A;  3IX0 A;  3FQM A;  4E33 A;  2OZK A;  3IR7 A;  1VQL 1;  3CME Z;  3CCE 1;  2JIO A;  4QTU A;  4A3G I;  4A3C I;  3K7A I;  2QEX Z;  4RVD A;  2EGT A;  2WAQ A;  2YAD A;  1KRL A;  4AYB A;  1Q86 2;  3IF8 A;  2OTL 1;  4MH4 A;  4EWC A;  1JJ2 Z;  1RO0 A;  2GU2 A;  1YHQ 1;  1VQ5 Z;  1VQM Z;  2QA4 1;  2NVY I;  1Q82 2;  1ZH1 A;  2QRC B;  4NBF A;  2IZ3 A;  1VQP 1;  4Y7N I;  2VPX A;  3CC4 1;  1YIJ Z;  1R9T I;  4E31 A;  3CC7 Z;  1Y1W I;  1VQN Z;  3G4S Z;  4NBD A;  2K3R A;  3PO3 S;  4BY7 I;  4TNU A;  1X3W A;  2HF1 A;  3S16 I;  3CMA Z;  3S1Q I;  4E30 A;  3CCL Z;  1VQ8 Z;  3HOW I;  1L1O C;  1LQL A;  1K8A 1;  1K9M 2;  1VQK Z;  2V3V A;  1ZB9 A;  4RVH A;  3GTO I;  2JNY A;  4S1T A;  1VQO Z;  3PO3 I;  2P3Y A;  1TWF I;  3HOU I;  2W04 A;  4MON A;  1DL6 A;  3IFU A;  3GTP I;  2JA5 I;  1NP6 A;  2AYD A;  1S72 Z;  3HKZ A;  4DK1 A;  3RZO I;  3MON A;  4E2Y A;  4BXX I;  1Q7Y 1;  3H3V J;  3G71 1;  3HOV I;  2Y0S A;  1TWA I;  1N8R 2;  2F4O A;  1VQ6 Z;  3S2D I;  1YIT 1;  3NH8 A;  5D1P A;  1N2F A;  1VQ9 1;  1VQ7 1;  4MXU A;  3QWU A;  2RHB A;  3CQZ I;  5T67 A;  1ML8 A;  1X0T A;  1ZB8 A;  3I55 1;  1KC8 2;  1Q81 2;  2VPY A;  4DQY B;  1YJ9 1;  2E7Z A;  1M1K 2;  5IT9 b;  4XX2 A;  4NBH A;  2DE7 A;  4NOZ A;  3CCJ 1;  2R93 I;  3TE5 B;  5C4J I;  5D1O A;  4CL1 A;  4NFR A;  1YUK A;  3CCU Z;  1NJI 2;  4DGL A;  3BG1 B;  1Q86 1;  3CME 1;  5C3E I;  3CCR Z;  2V8I A;  2GTI A;  3GTL I;  1YJN Z;  1NUI A;  1Z01 A;  2QEX 1;  3CC2 Z;  3CCM Z;  1Q82 1;  1RQF A;  5T64 A;  1K83 I;  5FLX f;  2AKL A;  2JIM A;  2HU9 A;  2WB1 A;  3I56 Z;  1RO4 A;  1K73 1;  1VQL Z;  3CD6 Z;  2OTJ Z;  3CCE Z;  3CCS Z;  1VQM 1;  1RLY A;  5A2Q b;  1I50 I;  1VQ4 Z;  3CCV 1;  1KD1 1;  3GTQ I;  3S15 I;  1QVF Y;  3HOZ I;  1RNI A;  1YIJ 1;  4A3M I;  1K9M 1;  3D2L A;  3S2H I;  1VQN 1;  1SIW A;  2JR6 A;  2NVT I;  4NBE A;  2DE5 A;  1RO2 A;  1YI2 1;  1YHQ Z;  1VQ8 1;  2V45 A;  5IT9 f;  1YJW Z;  1USP A;  2Q4Z A;  4X6A I;  4HGY A;  1VQO 1;  3D9X A;  3GTK I;  2IZ4 A;  3CCQ Z;  3VMG A;  1QXF A;  3KIF A;  2LEX A;  3I07 A;  1Y8C A;  4A3J I;  4A3F I;  1S72 1;  2RPR A;  1N8R 1;  1WCM I;  2IV2 X;  5FLX b;  1QVF Z;  1M90 1;  2JA6 I;  2PM9 A; 
#chains in the Genus database with same CATH homology
 3EER A;  3GCF A;  2V8J A;  4A3E I;  3VMI A;  2GTH A;  5IP7 I;  3FQQ A;  4E32 A;  4A3D I;  1VQ6 1;  1K8A 2;  1KC8 1;  4NBA A;  1Q81 1;  3RZD I;  2QRD B;  2JMO A;  2NVQ I;  3G71 Z;  3P5J B;  3NH5 A;  2DE6 A;  4BBR I;  2H85 A;  3VTN A;  3MZL B;  3KIH A;  3S1N I;  2NVX I;  1VLA A;  3J81 b;  5A2Q f;  3ESW A;  2QLV B;  5AN9 F;  1KQS Y;  4Y52 I;  3S17 I;  1YIT Z;  4NB8 A;  2K5R A;  3EED A;  2YU9 I;  2M48 A;  3G6E 1;  2E2J I;  2I3C A;  2B63 I;  4MD7 A;  3S1M I;  2F4M A;  1Z03 A;  4MD8 A;  3H0G I;  3NDI A;  3J7A 4;  3GKQ A;  2RBL A;  1YJ9 Z;  1PFT A;  1X3Z A;  3CCU 1;  4A3K I;  2OOY B;  2W03 A;  4NBC A;  2M6N A;  2BJO A;  3S1R I;  2ZAE B;  4NBG A;  3CXC Y;  3CCJ Z;  3NFZ A;  3HOY I;  2E2H I;  3U50 C;  5C4X I;  3LUS A;  2JS4 A;  2O4H A;  4RVF A;  1KQS Z;  3CCM 1;  5T6B A;  3HOX I;  3GTM S;  4E2Z A;  5C44 I;  3I56 1;  2JA7 I;  3TDH B;  1QF8 A;  1QYP A;  3CD6 1;  4E2W A;  1VQ5 1;  2R7Z I;  2RIQ A;  3CCS 1;  2OTJ 1;  4NBB A;  1WII A;  1VQ4 1;  2PK7 A;  3GTM I;  1YUA A;  4A3B I;  2QRE B;  2J6A A;  4MRI A;  4HGZ A;  3VB9 A;  3CC7 1;  3FKI I;  4RS4 A;  3G4S 1;  4HH4 A;  1Z02 A;  2OTL Z;  3I4M I;  3OW2 Y;  3J81 f;  4A3L I;  5LL6 f;  3CXC Z;  3CMA 1;  4A93 I;  2VUG A;  3CCL 1;  3F3F C;  1QVG Y;  1YJW 1;  2QA4 Z;  3JAM b;  1VQK 1;  3CCV Z;  3F3P C;  2E2I I;  3BG0 B;  3I4N I;  2KPI A;  3J80 b;  4NH1 C;  1VQP Z;  4QTT A;  3CC4 Z;  1Y1V S;  1K73 2;  3CCQ 1;  2Q51 A;  2LFU A;  4RV9 A;  4BBS I;  2P28 A;  2VF1 A;  3NDJ A;  1KD1 2;  4A3I I;  1YI2 Z;  5D1O B;  2LIY A;  1I6H I;  2R6M A;  3NH4 A;  3T4N B;  1Y1V I;  2G2K A;  1W2B Y;  2PMZ A;  2JUB A;  3OW2 Z;  1TWC I;  3VMH A;  3CPW Y;  2JA8 I;  5FLM I;  3D6W A;  3GTJ I;  1I3Q I;  1M1K 1;  1QVG Z;  2RT9 A;  3M4O I;  1TWG I;  1SFO I;  2E9H A;  3M3Y I;  3PO2 I;  4RVG A;  4BY1 I;  1Q7Y 2;  4E2X A;  1VQ9 Z;  3MZK B;  1VQ7 Z;  1M90 2;  1NJI 1;  1P9N A;  4NB9 A;  1S7M A;  1W2B Z;  1WW9 A;  2KI7 B;  3I55 Z;  1TFI A;  2VUM I;  3JAM f;  2OOX B;  2QR1 B;  1TWH I;  3J80 f;  3CPW Z;  1USP B;  2V8K A;  1JJ2 Y;  5IP9 I;  3G6E Z;  3CCR 1;  5CM2 M;  3S14 I;  2R92 I;  2O53 A;  1YJN 1;  4MD9 A;  3Q87 A;  3GTG I;  1JWH C;  3CC2 1;  2QKD A;  3IX0 A;  3FQM A;  4E33 A;  2OZK A;  1VQL 1;  3CME Z;  3CCE 1;  4QTU A;  4A3G I;  4A3C I;  3K7A I;  2QEX Z;  4RVD A;  2EGT A;  2WAQ A;  2YAD A;  1KRL A;  4AYB A;  1Q86 2;  3IF8 A;  2OTL 1;  4MH4 A;  4EWC A;  1JJ2 Z;  1RO0 A;  2GU2 A;  1YHQ 1;  1VQ5 Z;  1VQM Z;  2QA4 1;  2NVY I;  1Q82 2;  1ZH1 A;  2QRC B;  4NBF A;  2IZ3 A;  1VQP 1;  4Y7N I;  3CC4 1;  1YIJ Z;  1R9T I;  4E31 A;  3CC7 Z;  1Y1W I;  1VQN Z;  3G4S Z;  4NBD A;  2K3R A;  3PO3 S;  4BY7 I;  4TNU A;  1X3W A;  2HF1 A;  3S16 I;  3CMA Z;  3S1Q I;  4E30 A;  3CCL Z;  1VQ8 Z;  3HOW I;  1L1O C;  1LQL A;  1K8A 1;  1K9M 2;  1VQK Z;  1ZB9 A;  4RVH A;  3GTO I;  2JNY A;  4S1T A;  1VQO Z;  3PO3 I;  2P3Y A;  1TWF I;  3HOU I;  2W04 A;  4MON A;  1DL6 A;  3IFU A;  3GTP I;  2JA5 I;  1NP6 A;  1S72 Z;  3HKZ A;  4DK1 A;  3RZO I;  3MON A;  4E2Y A;  4BXX I;  1Q7Y 1;  3H3V J;  3G71 1;  3HOV I;  2Y0S A;  1TWA I;  1N8R 2;  2F4O A;  1VQ6 Z;  3S2D I;  1YIT 1;  3NH8 A;  5D1P A;  1N2F A;  1VQ9 1;  1VQ7 1;  4MXU A;  3QWU A;  2RHB A;  3CQZ I;  5T67 A;  1ML8 A;  1X0T A;  1ZB8 A;  3I55 1;  1KC8 2;  1Q81 2;  4DQY B;  1YJ9 1;  1M1K 2;  5IT9 b;  4XX2 A;  4NBH A;  2DE7 A;  4NOZ A;  3CCJ 1;  2R93 I;  3TE5 B;  5C4J I;  5D1O A;  4CL1 A;  4NFR A;  1YUK A;  3CCU Z;  1NJI 2;  4DGL A;  3BG1 B;  1Q86 1;  3CME 1;  5C3E I;  3CCR Z;  2V8I A;  2GTI A;  3GTL I;  1YJN Z;  1NUI A;  1Z01 A;  2QEX 1;  3CC2 Z;  3CCM Z;  1Q82 1;  1RQF A;  5T64 A;  1K83 I;  5FLX f;  2AKL A;  2HU9 A;  2WB1 A;  3I56 Z;  1RO4 A;  1K73 1;  1VQL Z;  3CD6 Z;  2OTJ Z;  3CCE Z;  3CCS Z;  1VQM 1;  1RLY A;  5A2Q b;  1I50 I;  1VQ4 Z;  3CCV 1;  1KD1 1;  3GTQ I;  3S15 I;  1QVF Y;  3HOZ I;  1RNI A;  1YIJ 1;  4A3M I;  1K9M 1;  3S2H I;  1VQN 1;  2JR6 A;  2NVT I;  4NBE A;  2DE5 A;  1RO2 A;  1YI2 1;  1YHQ Z;  1VQ8 1;  5IT9 f;  1YJW Z;  1USP A;  2Q4Z A;  4X6A I;  4HGY A;  1VQO 1;  3D9X A;  3GTK I;  2IZ4 A;  3CCQ Z;  3VMG A;  3KIF A;  3I07 A;  4A3J I;  4A3F I;  1S72 1;  2RPR A;  1N8R 1;  1WCM I;  5FLX b;  1QVF Z;  1M90 1;  2JA6 I;  2PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...