3CD6Z

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6Z00
1KD11 1W2BY 3G4SZ 1YJ9Z 3CMEZ 1YIJ1 3CC2Z 1VQ61 3CCMZ 1VQLZ 2OTLZ 3I551 1KC81 1VQOZ 1YHQZ 1VQNZ 1Q7Y2 1K8A1 1VQ5Z 1N8R1 1M901 1QVFZ 1YJN1 3CCQZ 3CPWZ 3CCS1 1VQKZ 3CCE1 1Q822 1QVFY 3CCU1 3CCVZ 1VQ4Z 1VQPZ 1K731 3I56Z 3CCJZ 1Q811 1S72Z 1KQSZ 1VQ91 3G6E1 1YI21 3G71Z 1VQ7Z 1N8R2 3CC71 2OTJZ 1K9M1 1KQSY 1YJ91 1Q812 1VQ6Z 1KD12 1QVGZ 1YJWZ 3I55Z 2OTL1 1VQ81 1Q861 1VQN1 1QVGY 3CPWY 2QEX1 1KC82 1M1K1 3CC41 2QA41 1YJNZ 1K8A2 3CCQ1 3CCSZ 3CCEZ 3CCUZ 1M902 3CCL1 1JJ2Z 3CD61 3CCV1 3CMA1 1VQM1 3CCR1 1YIT1 3G4S1 1Q862 1YIJZ 3G6EZ 3CME1 1YI2Z 1K732 1W2BZ 3CC7Z 1VQ71 1Q7Y1 3CC21 3CCM1 1VQL1 3OW2Z 1VQO1 1YHQ1 1NJI1 1K9M2 3OW2Y 1VQ51 1Q821 1YJW1 1VQ8Z 1VQK1 1VQ41 2QEXZ 1VQP1 3I561 3CCJ1 2QA4Z 3CC4Z 1S721 1JJ2Y 1NJI2 3CXCZ 1VQ9Z 3CCLZ 3G711 3CD6Z 1M1K2 3CMAZ 1VQMZ 3CXCY 2OTJ1 3CCRZ 1YITZ
chains in the Genus database with same CATH superfamily
3D9XA 1NP6A 1YIJ1 2JA8I 3NFZA 2VUMI 2RT9A 3CC2Z 3F3PC 2OTLZ 2E2II 1VQOZ 3D2LA 5IP7I 1VQNZ 1Q7Y2 3FQQA 2M48A 3GTJI 4RV9A 4E32A 1RO0A 2K5RA 1YJN1 4EWCA 3CCQZ 4NBEA 1QXFA 3CCS1 1VQKZ 3CCE1 3T4NB 1FDOA 2K3RA 1K731 3BG0B 3PO2I 2YU9I 1LQLA 4BBRI 1VLAA 4RVGA 1Y1VS 2H85A 3G71Z 3J81f 1SFOI 3NDJA 2OTJZ 2RPRA 1K9M1 2NVQI 4E30A 3NH4A 2V8JA 4HGYA 5T6BA 4MD9A 4NH1C 4NFRA 1ML8A 1VQ6Z 4DGLA 2AKLA 4NBCA 2JS4A 4E2WA 2OTL1 1QYPA 1VQ81 4BBSI 1VQN1 2LFUA 3CPWY 2F4MA 2QEX1 3Q87A 2QA41 5A2Qb 3CCQ1 3ESWA 1AA6A 1ZH1A 3CMA1 1VQM1 2JIOA 1Y8CA 1S7MA 1X0TA 3G6EZ 1K732 2E2JI 1W2BZ 3CC7Z 3CCM1 1VQL1 2RIQA 3OW2Z 3GTPI 1NJI1 4QTTA 2G2KA 1K9M2 3I07A 3TE5B 5C4JI 4NBDA 5AN9F 3OW2Y 4Y52I 4CL1A 3IF8A 2R6MA 2V8KA 3S1RI 2EGTA 1JJ2Y 3GTGI 4DQYB 2O4HA 5IP9I 1VQ9Z 1X3ZA 2VPZA 3HOZI 2OZKA 3CCLZ 3FKII 1YITZ 4A3II 2W04A 2OOYB 5T64A 3G4SZ 1NUIA 3VMIA 2GTIA 3J7A4 1TWFI 2LIYA 2IZ3A 3U50C 3GTMS 1WZNA 1KC81 2B63I 3TDHB 1L1OC 2VF1A 4MD7A 1K8A1 1TWCI 4E2YA 1VQ5Z 5A2Qf 1ZB9A 3RZDI 2V45A 4BY7I 5T67A 1VQ4Z 3I56Z 2GTHA 2P3YA 1Z02A 3EERA 5C3EI 1VQ91 2E2HI 2JA6I 3H3VJ 1WIIA 1YUAA 3KIHA 3S2DI 1Q812 2JNYA 5LL6f 5D1OA 1USPA 3I55Z 2V8IA 4NBBA 1Y1WI 3MONA 1KC82 3CC41 1K8A2 2RHBA 3HOYI 3CCUZ 3PO3S 3CD61 1Z01A 2VPYA 1Z03A 3MZKB 3CCR1 2JIRA 4MD8A 3GKQA 2W03A 3I4NI 1YI2Z 3CC21 3CQZI 2Y0SA 3HOWI 2KPIA 1VQO1 1JWHC 2RBLA 2JUBA 4RVHA 5IT9b 1Q821 5FLMI 2WAQA 4E2ZA 4E33A 2ZAEB 3FQMA 4A3KI 3GTKI 1VQK1 1TWGI 4RS4A 2V3VA 1RO2A 4HGZA 3IX0A 1SIWA 3S1MI 4NBGA 2OOXB 3G711 3S14I 2OTJ1 2PK7A 3MZLB 1W2BY 1Y1VI 3EEDA 4A3MI 3CMEZ 4XX2A 2QR1B 2VPWA 1VQ61 3P5JB 2HF1A 1YHQZ 2LEXA 4A3CI 3NH5A 3S1NI 4DK1A 4Y7NI 1Q822 2DE6A 2QRDB 1VQPZ 1YUKA 3CCJZ 1Q811 1S72Z 1KQSZ 2JIMA 3G6E1 1N8R2 3CC71 3QWUA 5C4XI 1KQSY 3VMHA 3NDIA 1I50I 3KIFA 3JAMb 5IT9f 3HOVI 3GCFA 4MH4A 2JA5I 3J80b 1YJWZ 2QRCB 2NVYI 2NAPA 1TWAI 2BJOA 4E2XA 1TFIA 4A93I 2WB1A 1M1K1 4E31A 1YJNZ 3CCSZ 2AYDA 3CCEZ 2E9HA 2Q4ZA 3CCL1 3HOUI 4A3DI 1YIT1 3G4S1 1Q862 1I6HI 1WJ2A 3H0GI 4NB8A 1ZB8A 2E7ZA 1RLYA 4A3FI 3S1QI 3GTMI 1VQ51 4A3LI 3VTNA 4A3EI 4S1TA 4NBHA 1YJW1 3M3YI 1VQ8Z 4MRIA 1RO4A 3HKZA 2JMOA 5CM2M 1VQ41 2QEXZ 3I561 2QA4Z 4NB9A 2PM9A 4RVFA 3IFUA 4NBFA 1M1K2 3CMAZ 1VQMZ 3JAMf 1KD11 1FDIA 1YJ9Z 4A3JI 1WW9A 3S2HI 4X6AI 3BG1B 4BY1I 3GTQI 3J80f 3CCMZ 1VQLZ 3K7AI 1PFTA 3I551 3NH8A 3I4MI 4BXXI 2R92I 1N2FA 1N8R1 4NBAA 1M901 2P28A 1QVFZ 2PMZA 2YADA 2O53A 4RVDA 5FLXf 3CPWZ 2J6AA 1QVFY 3CCU1 3CCVZ 3LUSA 2DE7A 2VUGA 3M4OI 3PO3I 3D6WA 4AYBA 4HH4A 1YI21 1VQ7Z 2M6NA 5D1PA 4QTUA 2VPXA 2QLVB 3S16I 1YJ91 3S17I 2QREB 2I3CA 3IR7A 3VB9A 1KD12 3S15I 1QVGZ 1Q16A 2R93I 3F3FC 1Q861 4A3GI 2F4OA 3HOXI 2IZ4A 1QVGY 2NVTI 3RZOI 2JIPA 1DL6A 2JA7I 3GTLI 1M902 1JJ2Z 4MXUA 3CCV1 2IV2X 2KI7B 2JIQA 2QKDA 1YIJZ 5C44I 2HU9A 3CME1 4TNUA 1VQ71 1Q7Y1 1TWHI 3J81b 1I3QI 1YHQ1 4NOZA 2NVXI 1WCMI 1X3WA 1P9NA 2JR6A 2GU2A 5D1OB 1R9TI 1USPB 5FLXb 3GTOI 1VQP1 2DE5A 3CCJ1 1KRLA 3CC4Z 2R7ZI 1S721 1RQFA 2Q51A 3VMGA 1NJI2 3CXCZ 1RNIA 1K83I 1QF8A 3CD6Z 4MONA 3CXCY 3CCRZ 4A3BI
chains in the Genus database with same CATH topology
3D9XA 1NP6A 1YIJ1 2JA8I 3NFZA 2VUMI 2RT9A 3CC2Z 3F3PC 2OTLZ 2E2II 1VQOZ 5IP7I 1VQNZ 1Q7Y2 3FQQA 2M48A 3GTJI 4RV9A 4E32A 1RO0A 2K5RA 1YJN1 4EWCA 3CCQZ 4NBEA 3CCS1 1VQKZ 3CCE1 3T4NB 2K3RA 1K731 3BG0B 3PO2I 2YU9I 1LQLA 4BBRI 1VLAA 4RVGA 1Y1VS 2H85A 3G71Z 3J81f 1SFOI 3NDJA 2OTJZ 2RPRA 1K9M1 2NVQI 4E30A 3NH4A 2V8JA 4HGYA 5T6BA 4MD9A 4NH1C 4NFRA 1ML8A 1VQ6Z 4DGLA 2AKLA 4NBCA 2JS4A 4E2WA 2OTL1 1QYPA 1VQ81 4BBSI 1VQN1 2LFUA 3CPWY 2F4MA 2QEX1 3Q87A 2QA41 5A2Qb 3CCQ1 3ESWA 1ZH1A 3CMA1 1VQM1 1S7MA 1X0TA 3G6EZ 1K732 2E2JI 1W2BZ 3CC7Z 3CCM1 1VQL1 2RIQA 3OW2Z 3GTPI 1NJI1 4QTTA 2G2KA 1K9M2 3I07A 3TE5B 5C4JI 4NBDA 5AN9F 3OW2Y 4Y52I 4CL1A 3IF8A 2R6MA 2V8KA 3S1RI 2EGTA 1JJ2Y 3GTGI 4DQYB 2O4HA 5IP9I 1VQ9Z 1X3ZA 3HOZI 2OZKA 3CCLZ 3FKII 1YITZ 4A3II 2W04A 2OOYB 5T64A 3G4SZ 1NUIA 3VMIA 2GTIA 3J7A4 1TWFI 2LIYA 2IZ3A 3U50C 3GTMS 1KC81 2B63I 3TDHB 1L1OC 2VF1A 4MD7A 1K8A1 1TWCI 4E2YA 1VQ5Z 5A2Qf 1ZB9A 3RZDI 4BY7I 5T67A 1VQ4Z 3I56Z 2GTHA 2P3YA 1Z02A 3EERA 5C3EI 1VQ91 2E2HI 2JA6I 3H3VJ 1WIIA 1YUAA 3KIHA 3S2DI 1Q812 2JNYA 5LL6f 5D1OA 1USPA 3I55Z 2V8IA 4NBBA 1Y1WI 3MONA 1KC82 3CC41 1K8A2 2RHBA 3HOYI 3CCUZ 3PO3S 3CD61 1Z01A 1Z03A 3MZKB 3CCR1 4MD8A 3GKQA 2W03A 3I4NI 1YI2Z 3CC21 3CQZI 2Y0SA 3HOWI 2KPIA 1VQO1 1JWHC 2RBLA 2JUBA 4RVHA 5IT9b 1Q821 5FLMI 2WAQA 4E2ZA 4E33A 2ZAEB 3FQMA 4A3KI 3GTKI 1VQK1 1TWGI 4RS4A 1RO2A 4HGZA 3IX0A 3S1MI 4NBGA 2OOXB 3G711 3S14I 2OTJ1 2PK7A 3MZLB 1W2BY 1Y1VI 3EEDA 4A3MI 3CMEZ 4XX2A 2QR1B 1VQ61 3P5JB 2HF1A 1YHQZ 4A3CI 3NH5A 3S1NI 4DK1A 4Y7NI 1Q822 2DE6A 2QRDB 1VQPZ 1YUKA 3CCJZ 1Q811 1S72Z 1KQSZ 3G6E1 1N8R2 3CC71 3QWUA 5C4XI 1KQSY 3VMHA 3NDIA 1I50I 3KIFA 3JAMb 5IT9f 3HOVI 3GCFA 4MH4A 2JA5I 3J80b 1YJWZ 2QRCB 2NVYI 1TWAI 2BJOA 4E2XA 1TFIA 4A93I 2WB1A 1M1K1 4E31A 1YJNZ 3CCSZ 3CCEZ 2E9HA 2Q4ZA 3CCL1 3HOUI 4A3DI 1YIT1 3G4S1 1Q862 1I6HI 3H0GI 4NB8A 1ZB8A 1RLYA 4A3FI 3S1QI 3GTMI 1VQ51 4A3LI 3VTNA 4A3EI 4S1TA 4NBHA 1YJW1 3M3YI 1VQ8Z 4MRIA 1RO4A 3HKZA 2JMOA 5CM2M 1VQ41 2QEXZ 3I561 2QA4Z 4NB9A 2PM9A 4RVFA 3IFUA 4NBFA 1M1K2 3CMAZ 1VQMZ 3JAMf 1KD11 1YJ9Z 4A3JI 1WW9A 3S2HI 4X6AI 3BG1B 4BY1I 3GTQI 3J80f 3CCMZ 1VQLZ 3K7AI 1PFTA 3I551 3NH8A 3I4MI 4BXXI 2R92I 1N2FA 1N8R1 4NBAA 1M901 2P28A 1QVFZ 2PMZA 2YADA 2O53A 4RVDA 5FLXf 3CPWZ 2J6AA 1QVFY 3CCU1 3CCVZ 3LUSA 2DE7A 2VUGA 3M4OI 3PO3I 3D6WA 4AYBA 4HH4A 1YI21 1VQ7Z 2M6NA 5D1PA 4QTUA 2QLVB 3S16I 1YJ91 3S17I 2QREB 2I3CA 3VB9A 1KD12 3S15I 1QVGZ 2R93I 3F3FC 1Q861 4A3GI 2F4OA 3HOXI 2IZ4A 1QVGY 2NVTI 3RZOI 1DL6A 2JA7I 3GTLI 1M902 1JJ2Z 4MXUA 3CCV1 2KI7B 2QKDA 1YIJZ 5C44I 2HU9A 3CME1 4TNUA 1VQ71 1Q7Y1 1TWHI 3J81b 1I3QI 1YHQ1 4NOZA 2NVXI 1WCMI 1X3WA 1P9NA 2JR6A 2GU2A 5D1OB 1R9TI 1USPB 5FLXb 3GTOI 1VQP1 2DE5A 3CCJ1 1KRLA 3CC4Z 2R7ZI 1S721 1RQFA 2Q51A 3VMGA 1NJI2 3CXCZ 1RNIA 1K83I 1QF8A 3CD6Z 4MONA 3CXCY 3CCRZ 4A3BI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 1;  1W2B Y;  3G4S Z;  1YJ9 Z;  3CME Z;  1YIJ 1;  3CC2 Z;  1VQ6 1;  3CCM Z;  1VQL Z;  2OTL Z;  3I55 1;  1KC8 1;  1VQO Z;  1YHQ Z;  1VQN Z;  1Q7Y 2;  1K8A 1;  1VQ5 Z;  1N8R 1;  1M90 1;  1QVF Z;  1YJN 1;  3CCQ Z;  3CPW Z;  3CCS 1;  1VQK Z;  3CCE 1;  1Q82 2;  1QVF Y;  3CCU 1;  3CCV Z;  1VQ4 Z;  1VQP Z;  1K73 1;  3I56 Z;  3CCJ Z;  1Q81 1;  1S72 Z;  1KQS Z;  1VQ9 1;  3G6E 1;  1YI2 1;  3G71 Z;  1VQ7 Z;  1N8R 2;  3CC7 1;  2OTJ Z;  1K9M 1;  1KQS Y;  1YJ9 1;  1Q81 2;  1VQ6 Z;  1KD1 2;  1QVG Z;  1YJW Z;  3I55 Z;  2OTL 1;  1VQ8 1;  1Q86 1;  1VQN 1;  1QVG Y;  3CPW Y;  2QEX 1;  1KC8 2;  1M1K 1;  3CC4 1;  2QA4 1;  1YJN Z;  1K8A 2;  3CCQ 1;  3CCS Z;  3CCE Z;  3CCU Z;  1M90 2;  3CCL 1;  1JJ2 Z;  3CD6 1;  3CCV 1;  3CMA 1;  1VQM 1;  3CCR 1;  1YIT 1;  3G4S 1;  1Q86 2;  1YIJ Z;  3G6E Z;  3CME 1;  1YI2 Z;  1K73 2;  1W2B Z;  3CC7 Z;  1VQ7 1;  1Q7Y 1;  3CC2 1;  3CCM 1;  1VQL 1;  3OW2 Z;  1VQO 1;  1YHQ 1;  1NJI 1;  1K9M 2;  3OW2 Y;  1VQ5 1;  1Q82 1;  1YJW 1;  1VQ8 Z;  1VQK 1;  1VQ4 1;  2QEX Z;  1VQP 1;  3I56 1;  3CCJ 1;  2QA4 Z;  3CC4 Z;  1S72 1;  1JJ2 Y;  1NJI 2;  3CXC Z;  1VQ9 Z;  3CCL Z;  3G71 1;  3CD6 Z;  1M1K 2;  3CMA Z;  1VQM Z;  3CXC Y;  2OTJ 1;  3CCR Z;  1YIT Z; 
#chains in the Genus database with same CATH topology
 3D9X A;  1NP6 A;  1YIJ 1;  2JA8 I;  3NFZ A;  2VUM I;  2RT9 A;  3CC2 Z;  3F3P C;  2OTL Z;  2E2I I;  1VQO Z;  3D2L A;  5IP7 I;  1VQN Z;  1Q7Y 2;  3FQQ A;  2M48 A;  3GTJ I;  4RV9 A;  4E32 A;  1RO0 A;  2K5R A;  1YJN 1;  4EWC A;  3CCQ Z;  4NBE A;  1QXF A;  3CCS 1;  1VQK Z;  3CCE 1;  3T4N B;  1FDO A;  2K3R A;  1K73 1;  3BG0 B;  3PO2 I;  2YU9 I;  1LQL A;  4BBR I;  1VLA A;  4RVG A;  1Y1V S;  2H85 A;  3G71 Z;  3J81 f;  1SFO I;  3NDJ A;  2OTJ Z;  2RPR A;  1K9M 1;  2NVQ I;  4E30 A;  3NH4 A;  2V8J A;  4HGY A;  5T6B A;  4MD9 A;  4NH1 C;  4NFR A;  1ML8 A;  1VQ6 Z;  4DGL A;  2AKL A;  4NBC A;  2JS4 A;  4E2W A;  2OTL 1;  1QYP A;  1VQ8 1;  4BBS I;  1VQN 1;  2LFU A;  3CPW Y;  2F4M A;  2QEX 1;  3Q87 A;  2QA4 1;  5A2Q b;  3CCQ 1;  3ESW A;  1AA6 A;  1ZH1 A;  3CMA 1;  1VQM 1;  2JIO A;  1Y8C A;  1S7M A;  1X0T A;  3G6E Z;  1K73 2;  2E2J I;  1W2B Z;  3CC7 Z;  3CCM 1;  1VQL 1;  2RIQ A;  3OW2 Z;  3GTP I;  1NJI 1;  4QTT A;  2G2K A;  1K9M 2;  3I07 A;  3TE5 B;  5C4J I;  4NBD A;  5AN9 F;  3OW2 Y;  4Y52 I;  4CL1 A;  3IF8 A;  2R6M A;  2V8K A;  3S1R I;  2EGT A;  1JJ2 Y;  3GTG I;  4DQY B;  2O4H A;  5IP9 I;  1VQ9 Z;  1X3Z A;  2VPZ A;  3HOZ I;  2OZK A;  3CCL Z;  3FKI I;  1YIT Z;  4A3I I;  2W04 A;  2OOY B;  5T64 A;  3G4S Z;  1NUI A;  3VMI A;  2GTI A;  3J7A 4;  1TWF I;  2LIY A;  2IZ3 A;  3U50 C;  3GTM S;  1WZN A;  1KC8 1;  2B63 I;  3TDH B;  1L1O C;  2VF1 A;  4MD7 A;  1K8A 1;  1TWC I;  4E2Y A;  1VQ5 Z;  5A2Q f;  1ZB9 A;  3RZD I;  2V45 A;  4BY7 I;  5T67 A;  1VQ4 Z;  3I56 Z;  2GTH A;  2P3Y A;  1Z02 A;  3EER A;  5C3E I;  1VQ9 1;  2E2H I;  2JA6 I;  3H3V J;  1WII A;  1YUA A;  3KIH A;  3S2D I;  1Q81 2;  2JNY A;  5LL6 f;  5D1O A;  1USP A;  3I55 Z;  2V8I A;  4NBB A;  1Y1W I;  3MON A;  1KC8 2;  3CC4 1;  1K8A 2;  2RHB A;  3HOY I;  3CCU Z;  3PO3 S;  3CD6 1;  1Z01 A;  2VPY A;  1Z03 A;  3MZK B;  3CCR 1;  2JIR A;  4MD8 A;  3GKQ A;  2W03 A;  3I4N I;  1YI2 Z;  3CC2 1;  3CQZ I;  2Y0S A;  3HOW I;  2KPI A;  1VQO 1;  1JWH C;  2RBL A;  2JUB A;  4RVH A;  5IT9 b;  1Q82 1;  5FLM I;  2WAQ A;  4E2Z A;  4E33 A;  2ZAE B;  3FQM A;  4A3K I;  3GTK I;  1VQK 1;  1TWG I;  4RS4 A;  2V3V A;  1RO2 A;  4HGZ A;  3IX0 A;  1SIW A;  3S1M I;  4NBG A;  2OOX B;  3G71 1;  3S14 I;  2OTJ 1;  2PK7 A;  3MZL B;  1W2B Y;  1Y1V I;  3EED A;  4A3M I;  3CME Z;  4XX2 A;  2QR1 B;  2VPW A;  1VQ6 1;  3P5J B;  2HF1 A;  1YHQ Z;  2LEX A;  4A3C I;  3NH5 A;  3S1N I;  4DK1 A;  4Y7N I;  1Q82 2;  2DE6 A;  2QRD B;  1VQP Z;  1YUK A;  3CCJ Z;  1Q81 1;  1S72 Z;  1KQS Z;  2JIM A;  3G6E 1;  1N8R 2;  3CC7 1;  3QWU A;  5C4X I;  1KQS Y;  3VMH A;  3NDI A;  1I50 I;  3KIF A;  3JAM b;  5IT9 f;  3HOV I;  3GCF A;  4MH4 A;  2JA5 I;  3J80 b;  1YJW Z;  2QRC B;  2NVY I;  2NAP A;  1TWA I;  2BJO A;  4E2X A;  1TFI A;  4A93 I;  2WB1 A;  1M1K 1;  4E31 A;  1YJN Z;  3CCS Z;  2AYD A;  3CCE Z;  2E9H A;  2Q4Z A;  3CCL 1;  3HOU I;  4A3D I;  1YIT 1;  3G4S 1;  1Q86 2;  1I6H I;  1WJ2 A;  3H0G I;  4NB8 A;  1ZB8 A;  2E7Z A;  1RLY A;  4A3F I;  3S1Q I;  3GTM I;  1VQ5 1;  4A3L I;  3VTN A;  4A3E I;  4S1T A;  4NBH A;  1YJW 1;  3M3Y I;  1VQ8 Z;  4MRI A;  1RO4 A;  3HKZ A;  2JMO A;  5CM2 M;  1VQ4 1;  2QEX Z;  3I56 1;  2QA4 Z;  4NB9 A;  2PM9 A;  4RVF A;  3IFU A;  4NBF A;  1M1K 2;  3CMA Z;  1VQM Z;  3JAM f;  1KD1 1;  1FDI A;  1YJ9 Z;  4A3J I;  1WW9 A;  3S2H I;  4X6A I;  3BG1 B;  4BY1 I;  3GTQ I;  3J80 f;  3CCM Z;  1VQL Z;  3K7A I;  1PFT A;  3I55 1;  3NH8 A;  3I4M I;  4BXX I;  2R92 I;  1N2F A;  1N8R 1;  4NBA A;  1M90 1;  2P28 A;  1QVF Z;  2PMZ A;  2YAD A;  2O53 A;  4RVD A;  5FLX f;  3CPW Z;  2J6A A;  1QVF Y;  3CCU 1;  3CCV Z;  3LUS A;  2DE7 A;  2VUG A;  3M4O I;  3PO3 I;  3D6W A;  4AYB A;  4HH4 A;  1YI2 1;  1VQ7 Z;  2M6N A;  5D1P A;  4QTU A;  2VPX A;  2QLV B;  3S16 I;  1YJ9 1;  3S17 I;  2QRE B;  2I3C A;  3IR7 A;  3VB9 A;  1KD1 2;  3S15 I;  1QVG Z;  1Q16 A;  2R93 I;  3F3F C;  1Q86 1;  4A3G I;  2F4O A;  3HOX I;  2IZ4 A;  1QVG Y;  2NVT I;  3RZO I;  2JIP A;  1DL6 A;  2JA7 I;  3GTL I;  1M90 2;  1JJ2 Z;  4MXU A;  3CCV 1;  2IV2 X;  2KI7 B;  2JIQ A;  2QKD A;  1YIJ Z;  5C44 I;  2HU9 A;  3CME 1;  4TNU A;  1VQ7 1;  1Q7Y 1;  1TWH I;  3J81 b;  1I3Q I;  1YHQ 1;  4NOZ A;  2NVX I;  1WCM I;  1X3W A;  1P9N A;  2JR6 A;  2GU2 A;  5D1O B;  1R9T I;  1USP B;  5FLX b;  3GTO I;  1VQP 1;  2DE5 A;  3CCJ 1;  1KRL A;  3CC4 Z;  2R7Z I;  1S72 1;  1RQF A;  2Q51 A;  3VMG A;  1NJI 2;  3CXC Z;  1RNI A;  1K83 I;  1QF8 A;  3CD6 Z;  4MON A;  3CXC Y;  3CCR Z;  4A3B I; 
#chains in the Genus database with same CATH homology
 3D9X A;  1NP6 A;  1YIJ 1;  2JA8 I;  3NFZ A;  2VUM I;  2RT9 A;  3CC2 Z;  3F3P C;  2OTL Z;  2E2I I;  1VQO Z;  5IP7 I;  1VQN Z;  1Q7Y 2;  3FQQ A;  2M48 A;  3GTJ I;  4RV9 A;  4E32 A;  1RO0 A;  2K5R A;  1YJN 1;  4EWC A;  3CCQ Z;  4NBE A;  3CCS 1;  1VQK Z;  3CCE 1;  3T4N B;  2K3R A;  1K73 1;  3BG0 B;  3PO2 I;  2YU9 I;  1LQL A;  4BBR I;  1VLA A;  4RVG A;  1Y1V S;  2H85 A;  3G71 Z;  3J81 f;  1SFO I;  3NDJ A;  2OTJ Z;  2RPR A;  1K9M 1;  2NVQ I;  4E30 A;  3NH4 A;  2V8J A;  4HGY A;  5T6B A;  4MD9 A;  4NH1 C;  4NFR A;  1ML8 A;  1VQ6 Z;  4DGL A;  2AKL A;  4NBC A;  2JS4 A;  4E2W A;  2OTL 1;  1QYP A;  1VQ8 1;  4BBS I;  1VQN 1;  2LFU A;  3CPW Y;  2F4M A;  2QEX 1;  3Q87 A;  2QA4 1;  5A2Q b;  3CCQ 1;  3ESW A;  1ZH1 A;  3CMA 1;  1VQM 1;  1S7M A;  1X0T A;  3G6E Z;  1K73 2;  2E2J I;  1W2B Z;  3CC7 Z;  3CCM 1;  1VQL 1;  2RIQ A;  3OW2 Z;  3GTP I;  1NJI 1;  4QTT A;  2G2K A;  1K9M 2;  3I07 A;  3TE5 B;  5C4J I;  4NBD A;  5AN9 F;  3OW2 Y;  4Y52 I;  4CL1 A;  3IF8 A;  2R6M A;  2V8K A;  3S1R I;  2EGT A;  1JJ2 Y;  3GTG I;  4DQY B;  2O4H A;  5IP9 I;  1VQ9 Z;  1X3Z A;  3HOZ I;  2OZK A;  3CCL Z;  3FKI I;  1YIT Z;  4A3I I;  2W04 A;  2OOY B;  5T64 A;  3G4S Z;  1NUI A;  3VMI A;  2GTI A;  3J7A 4;  1TWF I;  2LIY A;  2IZ3 A;  3U50 C;  3GTM S;  1KC8 1;  2B63 I;  3TDH B;  1L1O C;  2VF1 A;  4MD7 A;  1K8A 1;  1TWC I;  4E2Y A;  1VQ5 Z;  5A2Q f;  1ZB9 A;  3RZD I;  4BY7 I;  5T67 A;  1VQ4 Z;  3I56 Z;  2GTH A;  2P3Y A;  1Z02 A;  3EER A;  5C3E I;  1VQ9 1;  2E2H I;  2JA6 I;  3H3V J;  1WII A;  1YUA A;  3KIH A;  3S2D I;  1Q81 2;  2JNY A;  5LL6 f;  5D1O A;  1USP A;  3I55 Z;  2V8I A;  4NBB A;  1Y1W I;  3MON A;  1KC8 2;  3CC4 1;  1K8A 2;  2RHB A;  3HOY I;  3CCU Z;  3PO3 S;  3CD6 1;  1Z01 A;  1Z03 A;  3MZK B;  3CCR 1;  4MD8 A;  3GKQ A;  2W03 A;  3I4N I;  1YI2 Z;  3CC2 1;  3CQZ I;  2Y0S A;  3HOW I;  2KPI A;  1VQO 1;  1JWH C;  2RBL A;  2JUB A;  4RVH A;  5IT9 b;  1Q82 1;  5FLM I;  2WAQ A;  4E2Z A;  4E33 A;  2ZAE B;  3FQM A;  4A3K I;  3GTK I;  1VQK 1;  1TWG I;  4RS4 A;  1RO2 A;  4HGZ A;  3IX0 A;  3S1M I;  4NBG A;  2OOX B;  3G71 1;  3S14 I;  2OTJ 1;  2PK7 A;  3MZL B;  1W2B Y;  1Y1V I;  3EED A;  4A3M I;  3CME Z;  4XX2 A;  2QR1 B;  1VQ6 1;  3P5J B;  2HF1 A;  1YHQ Z;  4A3C I;  3NH5 A;  3S1N I;  4DK1 A;  4Y7N I;  1Q82 2;  2DE6 A;  2QRD B;  1VQP Z;  1YUK A;  3CCJ Z;  1Q81 1;  1S72 Z;  1KQS Z;  3G6E 1;  1N8R 2;  3CC7 1;  3QWU A;  5C4X I;  1KQS Y;  3VMH A;  3NDI A;  1I50 I;  3KIF A;  3JAM b;  5IT9 f;  3HOV I;  3GCF A;  4MH4 A;  2JA5 I;  3J80 b;  1YJW Z;  2QRC B;  2NVY I;  1TWA I;  2BJO A;  4E2X A;  1TFI A;  4A93 I;  2WB1 A;  1M1K 1;  4E31 A;  1YJN Z;  3CCS Z;  3CCE Z;  2E9H A;  2Q4Z A;  3CCL 1;  3HOU I;  4A3D I;  1YIT 1;  3G4S 1;  1Q86 2;  1I6H I;  3H0G I;  4NB8 A;  1ZB8 A;  1RLY A;  4A3F I;  3S1Q I;  3GTM I;  1VQ5 1;  4A3L I;  3VTN A;  4A3E I;  4S1T A;  4NBH A;  1YJW 1;  3M3Y I;  1VQ8 Z;  4MRI A;  1RO4 A;  3HKZ A;  2JMO A;  5CM2 M;  1VQ4 1;  2QEX Z;  3I56 1;  2QA4 Z;  4NB9 A;  2PM9 A;  4RVF A;  3IFU A;  4NBF A;  1M1K 2;  3CMA Z;  1VQM Z;  3JAM f;  1KD1 1;  1YJ9 Z;  4A3J I;  1WW9 A;  3S2H I;  4X6A I;  3BG1 B;  4BY1 I;  3GTQ I;  3J80 f;  3CCM Z;  1VQL Z;  3K7A I;  1PFT A;  3I55 1;  3NH8 A;  3I4M I;  4BXX I;  2R92 I;  1N2F A;  1N8R 1;  4NBA A;  1M90 1;  2P28 A;  1QVF Z;  2PMZ A;  2YAD A;  2O53 A;  4RVD A;  5FLX f;  3CPW Z;  2J6A A;  1QVF Y;  3CCU 1;  3CCV Z;  3LUS A;  2DE7 A;  2VUG A;  3M4O I;  3PO3 I;  3D6W A;  4AYB A;  4HH4 A;  1YI2 1;  1VQ7 Z;  2M6N A;  5D1P A;  4QTU A;  2QLV B;  3S16 I;  1YJ9 1;  3S17 I;  2QRE B;  2I3C A;  3VB9 A;  1KD1 2;  3S15 I;  1QVG Z;  2R93 I;  3F3F C;  1Q86 1;  4A3G I;  2F4O A;  3HOX I;  2IZ4 A;  1QVG Y;  2NVT I;  3RZO I;  1DL6 A;  2JA7 I;  3GTL I;  1M90 2;  1JJ2 Z;  4MXU A;  3CCV 1;  2KI7 B;  2QKD A;  1YIJ Z;  5C44 I;  2HU9 A;  3CME 1;  4TNU A;  1VQ7 1;  1Q7Y 1;  1TWH I;  3J81 b;  1I3Q I;  1YHQ 1;  4NOZ A;  2NVX I;  1WCM I;  1X3W A;  1P9N A;  2JR6 A;  2GU2 A;  5D1O B;  1R9T I;  1USP B;  5FLX b;  3GTO I;  1VQP 1;  2DE5 A;  3CCJ 1;  1KRL A;  3CC4 Z;  2R7Z I;  1S72 1;  1RQF A;  2Q51 A;  3VMG A;  1NJI 2;  3CXC Z;  1RNI A;  1K83 I;  1QF8 A;  3CD6 Z;  4MON A;  3CXC Y;  3CCR Z;  4A3B I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...