3CD6Z

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6Z00
3I56Z 3G71Z 3CCL1 3CXCY 1VQO1 1YI2Z 1QVGZ 1YHQZ 1Q862 3CMA1 1M1K1 1YIJ1 1KD11 3G6EZ 1VQ41 1QVGY 2OTJZ 1VQK1 1Q812 3CCSZ 1VQM1 3CC4Z 1KC82 3G4S1 3CCMZ 1VQLZ 3G6E1 1Q7Y1 1S72Z 3CCE1 3CD6Z 3CCQZ 3CC21 3CC41 1VQ5Z 1VQNZ 1K9M2 1W2BY 1VQP1 1VQ61 3I55Z 1VQ7Z 1K732 3CPWY 1QVFY 3CC7Z 3CCJZ 3I561 3G711 1M901 1KQSZ 1YI21 1YHQ1 3CCRZ 1VQ9Z 1VQ8Z 2OTLZ 1NJI1 1KD12 1YJ9Z 1KQSY 1W2BZ 1YITZ 2OTJ1 1YJNZ 3CCS1 2QEXZ 3CCVZ 3CCM1 3CPWZ 1Q822 1VQL1 1QVFZ 1K8A1 1YJWZ 1N8R2 1S721 3CCUZ 1YIT1 3CD61 3CCQ1 1VQ51 1VQN1 1JJ2Y 3CCLZ 1Q861 1VQOZ 3I551 1YIJZ 1VQ71 1M1K2 3CC71 3CCJ1 1VQ4Z 1Q811 1M902 1VQKZ 3CCR1 1KC81 1VQMZ 1VQ91 2QA4Z 3G4SZ 1VQ81 2OTL1 1JJ2Z 3CMEZ 1YJ91 1Q7Y2 1NJI2 3OW2Z 1YJN1 3CCEZ 2QEX1 1Q821 3CCV1 3CC2Z 2QA41 1K9M1 1N8R1 3CME1 3OW2Y 1YJW1 3CXCZ 1VQPZ 3CMAZ 3CCU1 1K8A2 1K731 1VQ6Z
chains in the Genus database with same CATH superfamily
1TWFI 3CXCY 1VQO1 1QVGZ 3KIFA 3RZOI 1PFTA 4E32A 2GTIA 2J6AA 4DK1A 1Q812 1RLYA 2KI7B 3CCMZ 4NBCA 1Q7Y1 2Y0SA 2E2JI 3S15I 2QRDB 2OZKA 4Y52I 3CD6Z 3VB9A 2NVXI 1K9M2 2OOXB 1TWAI 2LEXA 5FLXb 5CM2M 3GKQA 3CPWY 3CC7Z 1KQSZ 1Y1VI 3D9XA 1YI21 4NBGA 4E2WA 4RVGA 4BY1I 3H0GI 1VQ8Z 3QWUA 1YJ9Z 2JA8I 3U50C 3HKZA 1YJNZ 4A3KI 4E2YA 1TFIA 2VPXA 3GTKI 1VQL1 1QVFZ 2R92I 1YJWZ 1N8R2 5A2Qf 2JR6A 3CCQ1 1TWHI 1VQN1 1JJ2Y 3NDJA 3CCLZ 1JWHC 5LL6f 2AYDA 3GTMS 4X6AI 4E33A 4QTUA 3CCJ1 3IX0A 2F4MA 1Q811 4NBDA 1M902 1WCMI 1Z02A 3NH8A 2VUGA 3G4SZ 1QYPA 2VPZA 1Q7Y2 1KRLA 1Y1WI 2JIPA 1ZH1A 2QEX1 2DE5A 2QKDA 3J7A4 1K9M1 4RVDA 3S2DI 3T4NB 3M4OI 1X0TA 3OW2Y 3CXCZ 2JIMA 3CMAZ 3CCU1 2R7ZI 1AA6A 2B63I 5T6BA 3I56Z 2V8IA 3JAMf 1YHQZ 1Q862 3FQQA 2JA7I 3S2HI 3CMA1 1WW9A 3HOVI 2JIOA 3VMHA 2GU2A 1S7MA 2KPIA 1VQK1 5T67A 4RVHA 2VPYA 3CCSZ 1VQM1 3CC4Z 3PO3I 4BBRI 1ZB8A 4A3FI 5D1OA 1S72Z 3CC21 3VMIA 3CC41 1VQ5Z 3GCFA 1LQLA 1W2BY 2K3RA 2W04A 2ZAEB 4HGYA 1VQ61 1VQ7Z 5AN9F 3S17I 2V45A 4A3JI 4EWCA 1M901 1TWGI 3NH5A 4RV9A 2BJOA 2V3VA 2I3CA 2DE6A 3FKII 3KIHA 4A3GI 4XX2A 3GTQI 5IP9I 2Q4ZA 3J81b 5FLXf 2DE7A 1I50I 2AKLA 5IT9b 3CCM1 2P28A 3S1RI 2JNYA 3GTGI 3M3YI 2GTHA 3CD61 1DL6A 3LUSA 3BG1B 2PMZA 1Q861 3HOZI 4A93I 3MZLB 3GTOI 1YIJZ 2V8KA 3CC71 2QREB 1VQ4Z 3S14I 3HOUI 2JA5I 1VQ81 1NUIA 2E2HI 3S1NI 2QLVB 3CMEZ 1YJ91 3OW2Z 3RZDI 3CQZI 1YJN1 2JMOA 3CCEZ 2IV2X 1K83I 3CME1 2E9HA 1SFOI 1YJW1 1VQPZ 3H3VJ 1YUKA 2VPWA 3NDIA 3G71Z 3CCL1 3I4NI 3VMGA 4BXXI 4DQYB 2V8JA 1M1K1 4A3CI 2JS4A 2WAQA 1I3QI 2R6MA 1YUAA 2OTJZ 4RVFA 3ESWA 3J80b 2HU9A 5A2Qb 3G4S1 2QR1B 1ML8A 1RO4A 1WJ2A 1WZNA 2E7ZA 4QTTA 3PO2I 5D1OB 1Y8CA 4RS4A 3HOXI 3TE5B 4MD9A 1RQFA 3F3PC 4HGZA 4HH4A 4NH1C 3I55Z 1K732 4S1TA 4E2XA 1QVFY 3I561 4A3BI 2JUBA 1YHQ1 3CCRZ 1VQ9Z 2IZ3A 2OTLZ 3IFUA 1KD12 3BG0B 1USPA 2P3YA 1YITZ 4NBEA 1Y1VS 3GTLI 3CCS1 3CCVZ 4MD8A 3CPWZ 2PK7A 4E2ZA 4NBHA 1S721 1YIT1 4NB8A 2RHBA 3I07A 3JAMb 1N2FA 3GTMI 1VLAA 3J81f 1VQ51 1RNIA 2LFUA 2NAPA 1VQOZ 3HOYI 5IT9f 3EEDA 1VQ71 5C4XI 3D6WA 2NVYI 1M1K2 2M6NA 2IZ4A 4AYBA 2Q51A 1Z03A 2QA4Z 2VUMI 1QXFA 4CL1A 3HOWI 1JJ2Z 2PM9A 3F3FC 1NJI2 3VTNA 4NFRA 5IP7I 2K5RA 1RO0A 1Q821 4A3DI 2QRCB 2QA41 3NFZA 4A3MI 3S16I 3GTPI 1K8A2 2NVQI 1K731 2YU9I 4MH4A 2O4HA 4BBSI 4E30A 2OOYB 1QF8A 1YI2Z 2VF1A 3GTJI 1YIJ1 1KD11 3G6EZ 2W03A 4A3EI 4E31A 3IR7A 1FDOA 2RIQA 3IF8A 1VQ41 1QVGY 4A3LI 5FLMI 4TNUA 3NH4A 2JIQA 1WIIA 1KC82 1VQLZ 2JIRA 3G6E1 3K7AI 1X3WA 2RPRA 3MZKB 3CCE1 2F4OA 2NVTI 3CCQZ 3Q87A 3EERA 1VQNZ 3PO3S 2YADA 3J80f 2R93I 3S1QI 1VQP1 2LIYA 3S1MI 5C4JI 3CCJZ 3G711 2JA6I 5T64A 4NBFA 1RO2A 5D1PA 1NJI1 1KQSY 1W2BZ 2RT9A 2OTJ1 2HF1A 4DGLA 2QEXZ 1USPB 2E2II 4NB9A 1Q822 2G2KA 1SIWA 1K8A1 3CCUZ 2O53A 4MD7A 1Q16A 4NBAA 3P5JB 3FQMA 5C44I 1FDIA 3I551 4Y7NI 1I6HI 1R9TI 3TDHB 2H85A 1ZB9A 2RBLA 3D2LA 1VQKZ 2WB1A 3I4MI 3CCR1 1TWCI 1X3ZA 1KC81 1VQMZ 4BY7I 1VQ91 1Z01A 1L1OC 2OTL1 4MONA 3MONA 4A3II 4MRIA 5C3EI 4NBBA 3CCV1 2M48A 3CC2Z 2EGTA 4MXUA 1P9NA 1N8R1 1NP6A 1VQ6Z 4NOZA
chains in the Genus database with same CATH topology
1TWFI 3CXCY 1VQO1 1QVGZ 3KIFA 3RZOI 1PFTA 4E32A 2GTIA 2J6AA 4DK1A 1Q812 1RLYA 2KI7B 3CCMZ 4NBCA 1Q7Y1 2Y0SA 2E2JI 3S15I 2QRDB 2OZKA 4Y52I 3CD6Z 3VB9A 2NVXI 1K9M2 2OOXB 1TWAI 5FLXb 5CM2M 3GKQA 3CPWY 3CC7Z 1KQSZ 1Y1VI 3D9XA 1YI21 4NBGA 4E2WA 4RVGA 4BY1I 3H0GI 1VQ8Z 3QWUA 1YJ9Z 2JA8I 3U50C 3HKZA 1YJNZ 4A3KI 4E2YA 1TFIA 3GTKI 1VQL1 1QVFZ 2R92I 1YJWZ 1N8R2 5A2Qf 2JR6A 3CCQ1 1TWHI 1VQN1 1JJ2Y 3NDJA 3CCLZ 1JWHC 5LL6f 3GTMS 4X6AI 4E33A 4QTUA 3CCJ1 3IX0A 2F4MA 1Q811 4NBDA 1M902 1WCMI 1Z02A 3NH8A 2VUGA 3G4SZ 1QYPA 1Q7Y2 1KRLA 1Y1WI 1ZH1A 2QEX1 2DE5A 2QKDA 3J7A4 1K9M1 4RVDA 3S2DI 3T4NB 3M4OI 1X0TA 3OW2Y 3CXCZ 3CMAZ 3CCU1 2R7ZI 2B63I 5T6BA 3I56Z 2V8IA 3JAMf 1YHQZ 1Q862 3FQQA 2JA7I 3S2HI 3CMA1 1WW9A 3HOVI 3VMHA 2GU2A 1S7MA 2KPIA 1VQK1 5T67A 4RVHA 3CCSZ 1VQM1 3CC4Z 3PO3I 4BBRI 1ZB8A 4A3FI 5D1OA 1S72Z 3CC21 3VMIA 3CC41 1VQ5Z 3GCFA 1LQLA 1W2BY 2K3RA 2W04A 2ZAEB 4HGYA 1VQ61 1VQ7Z 5AN9F 3S17I 4A3JI 4EWCA 1M901 1TWGI 3NH5A 4RV9A 2BJOA 2I3CA 2DE6A 3FKII 3KIHA 4A3GI 4XX2A 3GTQI 5IP9I 2Q4ZA 3J81b 5FLXf 2DE7A 1I50I 2AKLA 5IT9b 3CCM1 2P28A 3S1RI 2JNYA 3GTGI 3M3YI 2GTHA 3CD61 1DL6A 3LUSA 3BG1B 2PMZA 1Q861 3HOZI 4A93I 3MZLB 3GTOI 1YIJZ 2V8KA 3CC71 2QREB 1VQ4Z 3S14I 3HOUI 2JA5I 1VQ81 1NUIA 2E2HI 3S1NI 2QLVB 3CMEZ 1YJ91 3OW2Z 3RZDI 3CQZI 1YJN1 2JMOA 3CCEZ 1K83I 3CME1 2E9HA 1SFOI 1YJW1 1VQPZ 3H3VJ 1YUKA 3NDIA 3G71Z 3CCL1 3I4NI 3VMGA 4BXXI 4DQYB 2V8JA 1M1K1 4A3CI 2JS4A 2WAQA 1I3QI 2R6MA 1YUAA 2OTJZ 4RVFA 3ESWA 3J80b 2HU9A 5A2Qb 3G4S1 2QR1B 1ML8A 1RO4A 3PO2I 4QTTA 5D1OB 4RS4A 3HOXI 3TE5B 4MD9A 1RQFA 3F3PC 4HGZA 4HH4A 4NH1C 3I55Z 1K732 4S1TA 4E2XA 1QVFY 3I561 4A3BI 2JUBA 1YHQ1 3CCRZ 1VQ9Z 2IZ3A 2OTLZ 3IFUA 1KD12 3BG0B 1USPA 2P3YA 1YITZ 4NBEA 1Y1VS 3GTLI 3CCS1 3CCVZ 4MD8A 3CPWZ 2PK7A 4E2ZA 4NBHA 1S721 1YIT1 4NB8A 2RHBA 3I07A 3JAMb 1N2FA 3GTMI 1VLAA 3J81f 1VQ51 1RNIA 2LFUA 1VQOZ 3HOYI 5IT9f 3EEDA 1VQ71 5C4XI 3D6WA 2NVYI 1M1K2 2M6NA 2IZ4A 4AYBA 2Q51A 1Z03A 2QA4Z 2VUMI 4CL1A 3HOWI 1JJ2Z 2PM9A 3F3FC 1NJI2 3VTNA 4NFRA 5IP7I 2K5RA 1RO0A 1Q821 4A3DI 2QRCB 2QA41 3NFZA 4A3MI 3S16I 3GTPI 1K8A2 2NVQI 1K731 2YU9I 4MH4A 2O4HA 4BBSI 4E30A 2OOYB 1QF8A 1YI2Z 2VF1A 3GTJI 1YIJ1 1KD11 3G6EZ 2W03A 4A3EI 4E31A 2RIQA 3IF8A 1VQ41 1QVGY 4A3LI 5FLMI 4TNUA 3NH4A 1WIIA 1KC82 1VQLZ 3G6E1 3K7AI 1X3WA 2RPRA 3MZKB 3CCE1 2F4OA 2NVTI 3CCQZ 3Q87A 3EERA 1VQNZ 3PO3S 2YADA 3J80f 2R93I 3S1QI 1VQP1 2LIYA 3S1MI 5C4JI 3CCJZ 3G711 2JA6I 5T64A 4NBFA 1RO2A 5D1PA 1NJI1 1KQSY 1W2BZ 2RT9A 2OTJ1 2HF1A 4DGLA 2QEXZ 1USPB 2E2II 4NB9A 1Q822 2G2KA 1K8A1 3CCUZ 2O53A 4MD7A 4NBAA 3P5JB 3FQMA 5C44I 3I551 4Y7NI 1I6HI 1R9TI 3TDHB 2H85A 1ZB9A 2RBLA 1VQKZ 2WB1A 3I4MI 3CCR1 1TWCI 1X3ZA 1KC81 1VQMZ 4BY7I 1VQ91 1Z01A 1L1OC 2OTL1 4MONA 3MONA 4A3II 4MRIA 5C3EI 4NBBA 3CCV1 2M48A 3CC2Z 2EGTA 4MXUA 1P9NA 1N8R1 1NP6A 1VQ6Z 4NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Z;  3G71 Z;  3CCL 1;  3CXC Y;  1VQO 1;  1YI2 Z;  1QVG Z;  1YHQ Z;  1Q86 2;  3CMA 1;  1M1K 1;  1YIJ 1;  1KD1 1;  3G6E Z;  1VQ4 1;  1QVG Y;  2OTJ Z;  1VQK 1;  1Q81 2;  3CCS Z;  1VQM 1;  3CC4 Z;  1KC8 2;  3G4S 1;  3CCM Z;  1VQL Z;  3G6E 1;  1Q7Y 1;  1S72 Z;  3CCE 1;  3CD6 Z;  3CCQ Z;  3CC2 1;  3CC4 1;  1VQ5 Z;  1VQN Z;  1K9M 2;  1W2B Y;  1VQP 1;  1VQ6 1;  3I55 Z;  1VQ7 Z;  1K73 2;  3CPW Y;  1QVF Y;  3CC7 Z;  3CCJ Z;  3I56 1;  3G71 1;  1M90 1;  1KQS Z;  1YI2 1;  1YHQ 1;  3CCR Z;  1VQ9 Z;  1VQ8 Z;  2OTL Z;  1NJI 1;  1KD1 2;  1YJ9 Z;  1KQS Y;  1W2B Z;  1YIT Z;  2OTJ 1;  1YJN Z;  3CCS 1;  2QEX Z;  3CCV Z;  3CCM 1;  3CPW Z;  1Q82 2;  1VQL 1;  1QVF Z;  1K8A 1;  1YJW Z;  1N8R 2;  1S72 1;  3CCU Z;  1YIT 1;  3CD6 1;  3CCQ 1;  1VQ5 1;  1VQN 1;  1JJ2 Y;  3CCL Z;  1Q86 1;  1VQO Z;  3I55 1;  1YIJ Z;  1VQ7 1;  1M1K 2;  3CC7 1;  3CCJ 1;  1VQ4 Z;  1Q81 1;  1M90 2;  1VQK Z;  3CCR 1;  1KC8 1;  1VQM Z;  1VQ9 1;  2QA4 Z;  3G4S Z;  1VQ8 1;  2OTL 1;  1JJ2 Z;  3CME Z;  1YJ9 1;  1Q7Y 2;  1NJI 2;  3OW2 Z;  1YJN 1;  3CCE Z;  2QEX 1;  1Q82 1;  3CCV 1;  3CC2 Z;  2QA4 1;  1K9M 1;  1N8R 1;  3CME 1;  3OW2 Y;  1YJW 1;  3CXC Z;  1VQP Z;  3CMA Z;  3CCU 1;  1K8A 2;  1K73 1;  1VQ6 Z; 
#chains in the Genus database with same CATH topology
 1TWF I;  3CXC Y;  1VQO 1;  1QVG Z;  3KIF A;  3RZO I;  1PFT A;  4E32 A;  2GTI A;  2J6A A;  4DK1 A;  1Q81 2;  1RLY A;  2KI7 B;  3CCM Z;  4NBC A;  1Q7Y 1;  2Y0S A;  2E2J I;  3S15 I;  2QRD B;  2OZK A;  4Y52 I;  3CD6 Z;  3VB9 A;  2NVX I;  1K9M 2;  2OOX B;  1TWA I;  2LEX A;  5FLX b;  5CM2 M;  3GKQ A;  3CPW Y;  3CC7 Z;  1KQS Z;  1Y1V I;  3D9X A;  1YI2 1;  4NBG A;  4E2W A;  4RVG A;  4BY1 I;  3H0G I;  1VQ8 Z;  3QWU A;  1YJ9 Z;  2JA8 I;  3U50 C;  3HKZ A;  1YJN Z;  4A3K I;  4E2Y A;  1TFI A;  2VPX A;  3GTK I;  1VQL 1;  1QVF Z;  2R92 I;  1YJW Z;  1N8R 2;  5A2Q f;  2JR6 A;  3CCQ 1;  1TWH I;  1VQN 1;  1JJ2 Y;  3NDJ A;  3CCL Z;  1JWH C;  5LL6 f;  2AYD A;  3GTM S;  4X6A I;  4E33 A;  4QTU A;  3CCJ 1;  3IX0 A;  2F4M A;  1Q81 1;  4NBD A;  1M90 2;  1WCM I;  1Z02 A;  3NH8 A;  2VUG A;  3G4S Z;  1QYP A;  2VPZ A;  1Q7Y 2;  1KRL A;  1Y1W I;  2JIP A;  1ZH1 A;  2QEX 1;  2DE5 A;  2QKD A;  3J7A 4;  1K9M 1;  4RVD A;  3S2D I;  3T4N B;  3M4O I;  1X0T A;  3OW2 Y;  3CXC Z;  2JIM A;  3CMA Z;  3CCU 1;  2R7Z I;  1AA6 A;  2B63 I;  5T6B A;  3I56 Z;  2V8I A;  3JAM f;  1YHQ Z;  1Q86 2;  3FQQ A;  2JA7 I;  3S2H I;  3CMA 1;  1WW9 A;  3HOV I;  2JIO A;  3VMH A;  2GU2 A;  1S7M A;  2KPI A;  1VQK 1;  5T67 A;  4RVH A;  2VPY A;  3CCS Z;  1VQM 1;  3CC4 Z;  3PO3 I;  4BBR I;  1ZB8 A;  4A3F I;  5D1O A;  1S72 Z;  3CC2 1;  3VMI A;  3CC4 1;  1VQ5 Z;  3GCF A;  1LQL A;  1W2B Y;  2K3R A;  2W04 A;  2ZAE B;  4HGY A;  1VQ6 1;  1VQ7 Z;  5AN9 F;  3S17 I;  2V45 A;  4A3J I;  4EWC A;  1M90 1;  1TWG I;  3NH5 A;  4RV9 A;  2BJO A;  2V3V A;  2I3C A;  2DE6 A;  3FKI I;  3KIH A;  4A3G I;  4XX2 A;  3GTQ I;  5IP9 I;  2Q4Z A;  3J81 b;  5FLX f;  2DE7 A;  1I50 I;  2AKL A;  5IT9 b;  3CCM 1;  2P28 A;  3S1R I;  2JNY A;  3GTG I;  3M3Y I;  2GTH A;  3CD6 1;  1DL6 A;  3LUS A;  3BG1 B;  2PMZ A;  1Q86 1;  3HOZ I;  4A93 I;  3MZL B;  3GTO I;  1YIJ Z;  2V8K A;  3CC7 1;  2QRE B;  1VQ4 Z;  3S14 I;  3HOU I;  2JA5 I;  1VQ8 1;  1NUI A;  2E2H I;  3S1N I;  2QLV B;  3CME Z;  1YJ9 1;  3OW2 Z;  3RZD I;  3CQZ I;  1YJN 1;  2JMO A;  3CCE Z;  2IV2 X;  1K83 I;  3CME 1;  2E9H A;  1SFO I;  1YJW 1;  1VQP Z;  3H3V J;  1YUK A;  2VPW A;  3NDI A;  3G71 Z;  3CCL 1;  3I4N I;  3VMG A;  4BXX I;  4DQY B;  2V8J A;  1M1K 1;  4A3C I;  2JS4 A;  2WAQ A;  1I3Q I;  2R6M A;  1YUA A;  2OTJ Z;  4RVF A;  3ESW A;  3J80 b;  2HU9 A;  5A2Q b;  3G4S 1;  2QR1 B;  1ML8 A;  1RO4 A;  1WJ2 A;  1WZN A;  2E7Z A;  4QTT A;  3PO2 I;  5D1O B;  1Y8C A;  4RS4 A;  3HOX I;  3TE5 B;  4MD9 A;  1RQF A;  3F3P C;  4HGZ A;  4HH4 A;  4NH1 C;  3I55 Z;  1K73 2;  4S1T A;  4E2X A;  1QVF Y;  3I56 1;  4A3B I;  2JUB A;  1YHQ 1;  3CCR Z;  1VQ9 Z;  2IZ3 A;  2OTL Z;  3IFU A;  1KD1 2;  3BG0 B;  1USP A;  2P3Y A;  1YIT Z;  4NBE A;  1Y1V S;  3GTL I;  3CCS 1;  3CCV Z;  4MD8 A;  3CPW Z;  2PK7 A;  4E2Z A;  4NBH A;  1S72 1;  1YIT 1;  4NB8 A;  2RHB A;  3I07 A;  3JAM b;  1N2F A;  3GTM I;  1VLA A;  3J81 f;  1VQ5 1;  1RNI A;  2LFU A;  2NAP A;  1VQO Z;  3HOY I;  5IT9 f;  3EED A;  1VQ7 1;  5C4X I;  3D6W A;  2NVY I;  1M1K 2;  2M6N A;  2IZ4 A;  4AYB A;  2Q51 A;  1Z03 A;  2QA4 Z;  2VUM I;  1QXF A;  4CL1 A;  3HOW I;  1JJ2 Z;  2PM9 A;  3F3F C;  1NJI 2;  3VTN A;  4NFR A;  5IP7 I;  2K5R A;  1RO0 A;  1Q82 1;  4A3D I;  2QRC B;  2QA4 1;  3NFZ A;  4A3M I;  3S16 I;  3GTP I;  1K8A 2;  2NVQ I;  1K73 1;  2YU9 I;  4MH4 A;  2O4H A;  4BBS I;  4E30 A;  2OOY B;  1QF8 A;  1YI2 Z;  2VF1 A;  3GTJ I;  1YIJ 1;  1KD1 1;  3G6E Z;  2W03 A;  4A3E I;  4E31 A;  3IR7 A;  1FDO A;  2RIQ A;  3IF8 A;  1VQ4 1;  1QVG Y;  4A3L I;  5FLM I;  4TNU A;  3NH4 A;  2JIQ A;  1WII A;  1KC8 2;  1VQL Z;  2JIR A;  3G6E 1;  3K7A I;  1X3W A;  2RPR A;  3MZK B;  3CCE 1;  2F4O A;  2NVT I;  3CCQ Z;  3Q87 A;  3EER A;  1VQN Z;  3PO3 S;  2YAD A;  3J80 f;  2R93 I;  3S1Q I;  1VQP 1;  2LIY A;  3S1M I;  5C4J I;  3CCJ Z;  3G71 1;  2JA6 I;  5T64 A;  4NBF A;  1RO2 A;  5D1P A;  1NJI 1;  1KQS Y;  1W2B Z;  2RT9 A;  2OTJ 1;  2HF1 A;  4DGL A;  2QEX Z;  1USP B;  2E2I I;  4NB9 A;  1Q82 2;  2G2K A;  1SIW A;  1K8A 1;  3CCU Z;  2O53 A;  4MD7 A;  1Q16 A;  4NBA A;  3P5J B;  3FQM A;  5C44 I;  1FDI A;  3I55 1;  4Y7N I;  1I6H I;  1R9T I;  3TDH B;  2H85 A;  1ZB9 A;  2RBL A;  3D2L A;  1VQK Z;  2WB1 A;  3I4M I;  3CCR 1;  1TWC I;  1X3Z A;  1KC8 1;  1VQM Z;  4BY7 I;  1VQ9 1;  1Z01 A;  1L1O C;  2OTL 1;  4MON A;  3MON A;  4A3I I;  4MRI A;  5C3E I;  4NBB A;  3CCV 1;  2M48 A;  3CC2 Z;  2EGT A;  4MXU A;  1P9N A;  1N8R 1;  1NP6 A;  1VQ6 Z;  4NOZ A; 
#chains in the Genus database with same CATH homology
 1TWF I;  3CXC Y;  1VQO 1;  1QVG Z;  3KIF A;  3RZO I;  1PFT A;  4E32 A;  2GTI A;  2J6A A;  4DK1 A;  1Q81 2;  1RLY A;  2KI7 B;  3CCM Z;  4NBC A;  1Q7Y 1;  2Y0S A;  2E2J I;  3S15 I;  2QRD B;  2OZK A;  4Y52 I;  3CD6 Z;  3VB9 A;  2NVX I;  1K9M 2;  2OOX B;  1TWA I;  5FLX b;  5CM2 M;  3GKQ A;  3CPW Y;  3CC7 Z;  1KQS Z;  1Y1V I;  3D9X A;  1YI2 1;  4NBG A;  4E2W A;  4RVG A;  4BY1 I;  3H0G I;  1VQ8 Z;  3QWU A;  1YJ9 Z;  2JA8 I;  3U50 C;  3HKZ A;  1YJN Z;  4A3K I;  4E2Y A;  1TFI A;  3GTK I;  1VQL 1;  1QVF Z;  2R92 I;  1YJW Z;  1N8R 2;  5A2Q f;  2JR6 A;  3CCQ 1;  1TWH I;  1VQN 1;  1JJ2 Y;  3NDJ A;  3CCL Z;  1JWH C;  5LL6 f;  3GTM S;  4X6A I;  4E33 A;  4QTU A;  3CCJ 1;  3IX0 A;  2F4M A;  1Q81 1;  4NBD A;  1M90 2;  1WCM I;  1Z02 A;  3NH8 A;  2VUG A;  3G4S Z;  1QYP A;  1Q7Y 2;  1KRL A;  1Y1W I;  1ZH1 A;  2QEX 1;  2DE5 A;  2QKD A;  3J7A 4;  1K9M 1;  4RVD A;  3S2D I;  3T4N B;  3M4O I;  1X0T A;  3OW2 Y;  3CXC Z;  3CMA Z;  3CCU 1;  2R7Z I;  2B63 I;  5T6B A;  3I56 Z;  2V8I A;  3JAM f;  1YHQ Z;  1Q86 2;  3FQQ A;  2JA7 I;  3S2H I;  3CMA 1;  1WW9 A;  3HOV I;  3VMH A;  2GU2 A;  1S7M A;  2KPI A;  1VQK 1;  5T67 A;  4RVH A;  3CCS Z;  1VQM 1;  3CC4 Z;  3PO3 I;  4BBR I;  1ZB8 A;  4A3F I;  5D1O A;  1S72 Z;  3CC2 1;  3VMI A;  3CC4 1;  1VQ5 Z;  3GCF A;  1LQL A;  1W2B Y;  2K3R A;  2W04 A;  2ZAE B;  4HGY A;  1VQ6 1;  1VQ7 Z;  5AN9 F;  3S17 I;  4A3J I;  4EWC A;  1M90 1;  1TWG I;  3NH5 A;  4RV9 A;  2BJO A;  2I3C A;  2DE6 A;  3FKI I;  3KIH A;  4A3G I;  4XX2 A;  3GTQ I;  5IP9 I;  2Q4Z A;  3J81 b;  5FLX f;  2DE7 A;  1I50 I;  2AKL A;  5IT9 b;  3CCM 1;  2P28 A;  3S1R I;  2JNY A;  3GTG I;  3M3Y I;  2GTH A;  3CD6 1;  1DL6 A;  3LUS A;  3BG1 B;  2PMZ A;  1Q86 1;  3HOZ I;  4A93 I;  3MZL B;  3GTO I;  1YIJ Z;  2V8K A;  3CC7 1;  2QRE B;  1VQ4 Z;  3S14 I;  3HOU I;  2JA5 I;  1VQ8 1;  1NUI A;  2E2H I;  3S1N I;  2QLV B;  3CME Z;  1YJ9 1;  3OW2 Z;  3RZD I;  3CQZ I;  1YJN 1;  2JMO A;  3CCE Z;  1K83 I;  3CME 1;  2E9H A;  1SFO I;  1YJW 1;  1VQP Z;  3H3V J;  1YUK A;  3NDI A;  3G71 Z;  3CCL 1;  3I4N I;  3VMG A;  4BXX I;  4DQY B;  2V8J A;  1M1K 1;  4A3C I;  2JS4 A;  2WAQ A;  1I3Q I;  2R6M A;  1YUA A;  2OTJ Z;  4RVF A;  3ESW A;  3J80 b;  2HU9 A;  5A2Q b;  3G4S 1;  2QR1 B;  1ML8 A;  1RO4 A;  3PO2 I;  4QTT A;  5D1O B;  4RS4 A;  3HOX I;  3TE5 B;  4MD9 A;  1RQF A;  3F3P C;  4HGZ A;  4HH4 A;  4NH1 C;  3I55 Z;  1K73 2;  4S1T A;  4E2X A;  1QVF Y;  3I56 1;  4A3B I;  2JUB A;  1YHQ 1;  3CCR Z;  1VQ9 Z;  2IZ3 A;  2OTL Z;  3IFU A;  1KD1 2;  3BG0 B;  1USP A;  2P3Y A;  1YIT Z;  4NBE A;  1Y1V S;  3GTL I;  3CCS 1;  3CCV Z;  4MD8 A;  3CPW Z;  2PK7 A;  4E2Z A;  4NBH A;  1S72 1;  1YIT 1;  4NB8 A;  2RHB A;  3I07 A;  3JAM b;  1N2F A;  3GTM I;  1VLA A;  3J81 f;  1VQ5 1;  1RNI A;  2LFU A;  1VQO Z;  3HOY I;  5IT9 f;  3EED A;  1VQ7 1;  5C4X I;  3D6W A;  2NVY I;  1M1K 2;  2M6N A;  2IZ4 A;  4AYB A;  2Q51 A;  1Z03 A;  2QA4 Z;  2VUM I;  4CL1 A;  3HOW I;  1JJ2 Z;  2PM9 A;  3F3F C;  1NJI 2;  3VTN A;  4NFR A;  5IP7 I;  2K5R A;  1RO0 A;  1Q82 1;  4A3D I;  2QRC B;  2QA4 1;  3NFZ A;  4A3M I;  3S16 I;  3GTP I;  1K8A 2;  2NVQ I;  1K73 1;  2YU9 I;  4MH4 A;  2O4H A;  4BBS I;  4E30 A;  2OOY B;  1QF8 A;  1YI2 Z;  2VF1 A;  3GTJ I;  1YIJ 1;  1KD1 1;  3G6E Z;  2W03 A;  4A3E I;  4E31 A;  2RIQ A;  3IF8 A;  1VQ4 1;  1QVG Y;  4A3L I;  5FLM I;  4TNU A;  3NH4 A;  1WII A;  1KC8 2;  1VQL Z;  3G6E 1;  3K7A I;  1X3W A;  2RPR A;  3MZK B;  3CCE 1;  2F4O A;  2NVT I;  3CCQ Z;  3Q87 A;  3EER A;  1VQN Z;  3PO3 S;  2YAD A;  3J80 f;  2R93 I;  3S1Q I;  1VQP 1;  2LIY A;  3S1M I;  5C4J I;  3CCJ Z;  3G71 1;  2JA6 I;  5T64 A;  4NBF A;  1RO2 A;  5D1P A;  1NJI 1;  1KQS Y;  1W2B Z;  2RT9 A;  2OTJ 1;  2HF1 A;  4DGL A;  2QEX Z;  1USP B;  2E2I I;  4NB9 A;  1Q82 2;  2G2K A;  1K8A 1;  3CCU Z;  2O53 A;  4MD7 A;  4NBA A;  3P5J B;  3FQM A;  5C44 I;  3I55 1;  4Y7N I;  1I6H I;  1R9T I;  3TDH B;  2H85 A;  1ZB9 A;  2RBL A;  1VQK Z;  2WB1 A;  3I4M I;  3CCR 1;  1TWC I;  1X3Z A;  1KC8 1;  1VQM Z;  4BY7 I;  1VQ9 1;  1Z01 A;  1L1O C;  2OTL 1;  4MON A;  3MON A;  4A3I I;  4MRI A;  5C3E I;  4NBB A;  3CCV 1;  2M48 A;  3CC2 Z;  2EGT A;  4MXU A;  1P9N A;  1N8R 1;  1NP6 A;  1VQ6 Z;  4NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...