4QTUA

Structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (sam bound form)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Multifunctional methyltransferase subunit TRM112
publication title Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 34
structure length 134
sequence length 134
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4qtuA00
4BY1I 3GTKI 1ML8A 1ZB9A 3PO3S 2P3YA 3HOZI 4BBRI 2DE6A 3VB9A 1Y1WI 2B63I 2E2HI 3S1RI 2DE5A 3RZDI 5C44I 4QTUA 4A3JI 2HF1A 1I50I 4A3FI 4NB9A 4A3II 3HOVI 3GTLI 5C4XI 3S15I 3GTPI 1VLAA 3CQZI 4A3EI 5FLMI 4MH4A 3EERA 3D6WA 4Y7NI 1TWFI 1QYPA 2R7ZI 1RLYA 1USPA 1L1OC 2J6AA 4NBCA 3S1NI 1K83I 1TWAI 3ESWA 2E2II 3HOYI 2K5RA 4NBFA 2JA8I 3I07A 2PK7A 3PO3I 4BXXI 3GTQI 1N2FA 3I4NI 1TWHI 4BBSI 3GTMS 1ZB8A 3S1QI 1TWGI 1R9TI 1PFTA 1Y1VS 4A3MI 2F4MA 4A3DI 3VMIA 3GTJI 2R93I 4NOZA 1WCMI 3S17I 4A3BI 1NUIA 2NVQI 5CM2M 1RO4A 3HOWI 3GTOI 2RBLA 4NBHA 2R92I 2VUMI 2BJOA 1YUAA 4Y52I 3S1MI 2JA6I 3VMHA 4A3CI 1I3QI 3GCFA 3RZOI 1X3WA 2DE7A 2NVYI 3GTMI 2YU9I 1SFOI 2JR6A 3PO2I 3I4MI 4NBGA 3U50C 3S16I 1WW9A 4X6AI 4NBAA 1Y1VI 1USPB 1X3ZA 5IP9I 2AKLA 3FKII 2JA7I 3M3YI 2JS4A 2F4OA 5C4JI 3S14I 1DL6A 3K7AI 4XX2A 3HOXI 4A3LI 2E2JI 4BY7I 3S2HI 3Q87A 2JNYA 3H0GI 2NVXI 4QTTA 2NVTI 4NBDA 3M4OI 4NBBA 3GTGI 2JA5I 3H3VJ 5IP7I 4A93I 4A3KI 3S2DI 4NB8A 4NBEA 1LQLA 5C3EI 3HOUI 4A3GI 1TFIA 3GKQA 3LUSA 1I6HI 1TWCI 3VMGA 2KPIA
chains in the Genus database with same CATH superfamily
2JIPA 2VPZA 3NDJA 5FLXb 4S1TA 1ML8A 3PO3S 1SIWA 2P3YA 3VB9A 4HGZA 3KIFA 1KD12 2DE5A 2G2KA 3G4S1 3IX0A 3CC4Z 4NB9A 1VQKZ 1KC81 1YJN1 4A3EI 1WZNA 4NFRA 2VPYA 3D6WA 4Y7NI 1QYPA 1VQP1 1K9M2 2R7ZI 2W03A 1Q16A 3I56Z 3S1NI 2OOYB 3CCMZ 3I07A 1VQN1 3F3FC 1QVGY 2V8JA 3I4NI 5D1OB 5FLXf 2QA4Z 1TWHI 1FDOA 3CCVZ 1R9TI 2E9HA 2AYDA 2JMOA 3G6E1 4HGYA 1Y1VS 2F4MA 1VQ5Z 1VQ8Z 1K8A2 3VMIA 3GTJI 1VQK1 3CCRZ 1VQO1 2NVQI 1RO4A 3GTOI 2GTIA 5T64A 3F3PC 4MD8A 3CD6Z 3S1MI 3I561 3D9XA 3CCM1 4MRIA 1X3WA 3J7A4 3GTMI 3CXCZ 4NBGA 3U50C 1WW9A 4X6AI 4NBAA 2PM9A 1X3ZA 2AKLA 1Q822 1JWHC 1VQ4Z 1K732 2F4OA 4E2ZA 1VQ9Z 5IT9b 1YIT1 4XX2A 2IZ4A 3CCJZ 2JNYA 4RS4A 2NVXI 2WAQA 3J80f 4MXUA 3H3VJ 1Q861 4RVFA 2V8IA 3CCR1 5C3EI 2QLVB 3G4SZ 1JJ2Y 1TFIA 1P9NA 3LUSA 3HOVI 2KPIA 4A3CI 1YJNZ 4BY1I 3CMAZ 3HOZI 2DE6A 1Y1WI 1YI2Z 1VQPZ 2JIQA 5C4XI 3S15I 3CQZI 1VQ41 4MH4A 1M902 4E30A 2E7ZA 3NH8A 1USPA 3EEDA 1Y8CA 2GTHA 4TNUA 1K83I 5AN9F 1AA6A 3HOYI 2V3VA 2K5RA 2PK7A 2RIQA 2V45A 3G6EZ 3FQMA 1QVFZ 3GTQI 2VPWA 4E2WA 1VQOZ 5D1PA 3I551 1ZB8A 3GTMS 1Q811 3CMA1 1VQL1 2JUBA 1YI21 3CCL1 4E2XA 2R93I 1NJI2 4NOZA 4A3BI 5CM2M 2RBLA 4NBHA 3CPWZ 3FQQA 2BJOA 3P5JB 2HU9A 4MD9A 3QWUA 1YUAA 2JA6I 3MZLB 2K3RA 3VMHA 2QRDB 3CCSZ 1S7MA 1YITZ 2Q4ZA 2NAPA 2YU9I 2JR6A 1WJ2A 1USPB 1YUKA 3FKII 2EGTA 3NFZA 3J80b 3S14I 2I3CA 3K7AI 5T67A 1M1K2 2E2JI 4BY7I 4RVGA 1KD11 2NVTI 3M4OI 4NBBA 5IP7I 1S72Z 3CCE1 3S2DI 1YJWZ 4NBEA 1N8R2 3HOUI 1K9M1 3CCQ1 1ZH1A 1I6HI 1TWCI 1W2BZ 2LEXA 3GTKI 4MD7A 1VQ7Z 1ZB9A 3BG0B 2IZ3A 3CCS1 4BBRI 3S1RI 5C44I 2OOXB 4AYBA 4A3FI 4A3II 3CC21 3GTPI 1VLAA 3JAMf 1FDIA 1Q7Y2 5FLMI 4RVDA 1VQM1 2J6AA 4NBCA 4E2YA 2JIRA 3NH5A 1TWAI 1K8A1 3ESWA 4MONA 3I55Z 4NBFA 1S721 1VQLZ 2JIMA 5LL6f 3CCU1 4BXXI 3CCLZ 1YJW1 1N2FA 2VUGA 4NH1C 1KC82 2OTLZ 4HH4A 1Z03A 3S1QI 1TWGI 2O4HA 1VQ71 1QF8A 2VF1A 3NDIA 4A3MI 2VPXA 2V8KA 4A3DI 1WCMI 3CXCY 2O53A 1Q821 1QVGZ 1K731 3HOWI 4EWCA 1W2BY 2R92I 2VUMI 1RQFA 1KQSZ 1RO2A 3CC7Z 3GCFA 2GU2A 2DE7A 2NVYI 1SFOI 3PO2I 3I4MI 3BG1B 3CME1 1NP6A 3S16I 2KI7B 3J81b 3OW2Z 2QRCB 3M3YI 3TDHB 2JA7I 2JS4A 2RT9A 2OTL1 3CCEZ 4A3LI 1YHQZ 2QREB 3Q87A 5T6BA 3H0GI 4QTTA 3CCQZ 3IFUA 1Z01A 4NBDA 3D2LA 2JIOA 4E32A 1YIJ1 2YADA 2JA5I 3HKZA 4A93I 3G71Z 1M901 4A3KI 4NB8A 3TE5B 5A2Qf 3GKQA 3NH4A 3CC2Z 1YJ9Z 4RV9A 2OTJ1 3CC71 2B63I 2ZAEB 2E2HI 1VQMZ 3J81f 3JAMb 3RZDI 1QXFA 2RHBA 4QTUA 4A3JI 2HF1A 1I50I 3MONA 1Q862 1JJ2Z 3GTLI 1QVFY 2LFUA 2R6MA 1KQSY 3KIHA 2Y0SA 3EERA 3CCUZ 1TWFI 1RLYA 1L1OC 1Z02A 1YHQ1 3CC41 1VQ6Z 2W04A 2E2II 2M6NA 2LIYA 1NJI1 2JA8I 3OW2Y 1RNIA 3PO3I 3G711 2QEXZ 2RPRA 2OZKA 2QKDA 4BBSI 3CPWY 1RO0A 1YJ91 4DK1A 2H85A 2PMZA 1PFTA 1X0TA 2QA41 2WB1A 3CCV1 4CL1A 3S17I 1NUIA 2IV2X 3MZKB 3T4NB 1KRLA 1M1K1 3CMEZ 4Y52I 1VQ51 1VQ81 1VQ61 2P28A 1I3QI 4DGLA 3IF8A 1Q812 3RZOI 3IR7A 1N8R1 1YIJZ 2QEX1 1Y1VI 1WIIA 3CD61 5IP9I 4DQYB 5C4JI 1DL6A 3HOXI 3S2HI 5D1OA 5IT9f 4RVHA 3GTGI 3VTNA 5A2Qb 2OTJZ 1VQ91 2M48A 4E31A 1VQNZ 2Q51A 1Q7Y1 1LQLA 2QR1B 4E33A 4A3GI 3CCJ1 3VMGA
chains in the Genus database with same CATH topology
3NDJA 5FLXb 4S1TA 1ML8A 3PO3S 2P3YA 3VB9A 4HGZA 3KIFA 1KD12 2DE5A 2G2KA 3G4S1 3IX0A 3CC4Z 4NB9A 1VQKZ 1KC81 1YJN1 4A3EI 4NFRA 3D6WA 4Y7NI 1QYPA 1VQP1 1K9M2 2R7ZI 2W03A 3S1NI 3I56Z 2OOYB 3CCMZ 3I07A 1VQN1 3F3FC 1QVGY 2V8JA 3I4NI 5D1OB 5FLXf 2QA4Z 1TWHI 3CCVZ 1R9TI 2E9HA 2JMOA 3G6E1 4HGYA 1Y1VS 2F4MA 1VQ5Z 1VQ8Z 1K8A2 3VMIA 3GTJI 1VQK1 3CCRZ 1VQO1 2NVQI 1RO4A 3GTOI 2GTIA 5T64A 3F3PC 4MD8A 3CD6Z 3S1MI 3I561 3D9XA 3CCM1 4MRIA 1X3WA 3J7A4 3GTMI 3CXCZ 4NBGA 3U50C 1WW9A 4X6AI 4NBAA 2PM9A 1X3ZA 2AKLA 1Q822 1JWHC 1VQ4Z 1K732 2F4OA 4E2ZA 1VQ9Z 5IT9b 1YIT1 4XX2A 2IZ4A 3CCJZ 2JNYA 4RS4A 2NVXI 2WAQA 3J80f 4MXUA 3H3VJ 1Q861 4RVFA 2V8IA 3CCR1 5C3EI 2QLVB 3G4SZ 1JJ2Y 1TFIA 1P9NA 3LUSA 3HOVI 2KPIA 4A3CI 1YJNZ 4BY1I 3CMAZ 3HOZI 2DE6A 1Y1WI 1YI2Z 1VQPZ 5C4XI 3S15I 3CQZI 1VQ41 4MH4A 1M902 4E30A 3NH8A 1USPA 3EEDA 2GTHA 4TNUA 1K83I 5AN9F 3HOYI 2K5RA 2PK7A 2RIQA 3G6EZ 3FQMA 1QVFZ 3GTQI 4E2WA 1VQOZ 5D1PA 3I551 1ZB8A 3GTMS 1Q811 3CMA1 1VQL1 2JUBA 1YI21 3CCL1 4E2XA 2R93I 1NJI2 4NOZA 4A3BI 5CM2M 2RBLA 4NBHA 3CPWZ 3FQQA 2BJOA 3P5JB 2HU9A 4MD9A 3QWUA 1YUAA 2JA6I 3MZLB 2K3RA 3VMHA 2QRDB 3CCSZ 1S7MA 1YITZ 2Q4ZA 2YU9I 2JR6A 1USPB 1YUKA 3FKII 2EGTA 3NFZA 3J80b 3S14I 2I3CA 3K7AI 5T67A 1M1K2 2E2JI 4BY7I 4RVGA 1KD11 2NVTI 3M4OI 4NBBA 5IP7I 1S72Z 3CCE1 3S2DI 1YJWZ 4NBEA 1N8R2 3HOUI 1K9M1 3CCQ1 1ZH1A 1I6HI 1TWCI 1W2BZ 3GTKI 4MD7A 1VQ7Z 1ZB9A 3BG0B 2IZ3A 3CCS1 4BBRI 3S1RI 5C44I 2OOXB 4AYBA 4A3FI 4A3II 3CC21 3GTPI 1VLAA 3JAMf 1Q7Y2 5FLMI 4RVDA 1VQM1 2J6AA 4NBCA 4E2YA 3NH5A 1TWAI 1K8A1 3ESWA 4MONA 3I55Z 4NBFA 1S721 1VQLZ 5LL6f 3CCU1 4BXXI 3CCLZ 1YJW1 1N2FA 2VUGA 4NH1C 1KC82 2OTLZ 4HH4A 1Z03A 3S1QI 1TWGI 2O4HA 1VQ71 1QF8A 2VF1A 3NDIA 4A3MI 2V8KA 4A3DI 1WCMI 3CXCY 2O53A 1Q821 1QVGZ 1K731 3HOWI 4EWCA 1W2BY 2R92I 2VUMI 1RQFA 1KQSZ 1RO2A 3CC7Z 3GCFA 2GU2A 2DE7A 2NVYI 1SFOI 3PO2I 3I4MI 3BG1B 3CME1 1NP6A 3S16I 2KI7B 3J81b 3OW2Z 2QRCB 3M3YI 3TDHB 2JA7I 2JS4A 2RT9A 2OTL1 3CCEZ 4A3LI 1YHQZ 2QREB 3Q87A 5T6BA 3H0GI 4QTTA 3CCQZ 3IFUA 1Z01A 4NBDA 4E32A 1YIJ1 2YADA 2JA5I 3HKZA 4A93I 3G71Z 1M901 4A3KI 4NB8A 3TE5B 5A2Qf 3GKQA 3NH4A 3CC2Z 1YJ9Z 4RV9A 2OTJ1 3CC71 2B63I 2ZAEB 2E2HI 1VQMZ 3J81f 3JAMb 3RZDI 2RHBA 4QTUA 4A3JI 2HF1A 1I50I 3MONA 1Q862 1JJ2Z 3GTLI 1QVFY 2LFUA 2R6MA 1KQSY 3KIHA 2Y0SA 3EERA 3CCUZ 1TWFI 1RLYA 1L1OC 1Z02A 1YHQ1 3CC41 1VQ6Z 2W04A 2E2II 2M6NA 2LIYA 1NJI1 2JA8I 3OW2Y 1RNIA 3PO3I 3G711 2QEXZ 2RPRA 2OZKA 2QKDA 4BBSI 3CPWY 1RO0A 1YJ91 4DK1A 2H85A 2PMZA 1PFTA 1X0TA 2QA41 2WB1A 3CCV1 4CL1A 3S17I 1NUIA 3MZKB 3T4NB 1KRLA 1M1K1 3CMEZ 4Y52I 1VQ51 1VQ81 1VQ61 2P28A 1I3QI 4DGLA 3IF8A 1Q812 3RZOI 1N8R1 1YIJZ 2QEX1 1Y1VI 1WIIA 3CD61 5IP9I 4DQYB 5C4JI 1DL6A 3HOXI 3S2HI 5D1OA 5IT9f 4RVHA 3GTGI 3VTNA 5A2Qb 2OTJZ 1VQ91 2M48A 4E31A 1VQNZ 2Q51A 1Q7Y1 1LQLA 2QR1B 4E33A 4A3GI 3CCJ1 3VMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 I;  3GTK I;  1ML8 A;  1ZB9 A;  3PO3 S;  2P3Y A;  3HOZ I;  4BBR I;  2DE6 A;  3VB9 A;  1Y1W I;  2B63 I;  2E2H I;  3S1R I;  2DE5 A;  3RZD I;  5C44 I;  4QTU A;  4A3J I;  2HF1 A;  1I50 I;  4A3F I;  4NB9 A;  4A3I I;  3HOV I;  3GTL I;  5C4X I;  3S15 I;  3GTP I;  1VLA A;  3CQZ I;  4A3E I;  5FLM I;  4MH4 A;  3EER A;  3D6W A;  4Y7N I;  1TWF I;  1QYP A;  2R7Z I;  1RLY A;  1USP A;  1L1O C;  2J6A A;  4NBC A;  3S1N I;  1K83 I;  1TWA I;  3ESW A;  2E2I I;  3HOY I;  2K5R A;  4NBF A;  2JA8 I;  3I07 A;  2PK7 A;  3PO3 I;  4BXX I;  3GTQ I;  1N2F A;  3I4N I;  1TWH I;  4BBS I;  3GTM S;  1ZB8 A;  3S1Q I;  1TWG I;  1R9T I;  1PFT A;  1Y1V S;  4A3M I;  2F4M A;  4A3D I;  3VMI A;  3GTJ I;  2R93 I;  4NOZ A;  1WCM I;  3S17 I;  4A3B I;  1NUI A;  2NVQ I;  5CM2 M;  1RO4 A;  3HOW I;  3GTO I;  2RBL A;  4NBH A;  2R92 I;  2VUM I;  2BJO A;  1YUA A;  4Y52 I;  3S1M I;  2JA6 I;  3VMH A;  4A3C I;  1I3Q I;  3GCF A;  3RZO I;  1X3W A;  2DE7 A;  2NVY I;  3GTM I;  2YU9 I;  1SFO I;  2JR6 A;  3PO2 I;  3I4M I;  4NBG A;  3U50 C;  3S16 I;  1WW9 A;  4X6A I;  4NBA A;  1Y1V I;  1USP B;  1X3Z A;  5IP9 I;  2AKL A;  3FKI I;  2JA7 I;  3M3Y I;  2JS4 A;  2F4O A;  5C4J I;  3S14 I;  1DL6 A;  3K7A I;  4XX2 A;  3HOX I;  4A3L I;  2E2J I;  4BY7 I;  3S2H I;  3Q87 A;  2JNY A;  3H0G I;  2NVX I;  4QTT A;  2NVT I;  4NBD A;  3M4O I;  4NBB A;  3GTG I;  2JA5 I;  3H3V J;  5IP7 I;  4A93 I;  4A3K I;  3S2D I;  4NB8 A;  4NBE A;  1LQL A;  5C3E I;  3HOU I;  4A3G I;  1TFI A;  3GKQ A;  3LUS A;  1I6H I;  1TWC I;  3VMG A;  2KPI A; 
#chains in the Genus database with same CATH topology
 2JIP A;  2VPZ A;  3NDJ A;  5FLX b;  4S1T A;  1ML8 A;  3PO3 S;  1SIW A;  2P3Y A;  3VB9 A;  4HGZ A;  3KIF A;  1KD1 2;  2DE5 A;  2G2K A;  3G4S 1;  3IX0 A;  3CC4 Z;  4NB9 A;  1VQK Z;  1KC8 1;  1YJN 1;  4A3E I;  1WZN A;  4NFR A;  2VPY A;  3D6W A;  4Y7N I;  1QYP A;  1VQP 1;  1K9M 2;  2R7Z I;  2W03 A;  1Q16 A;  3I56 Z;  3S1N I;  2OOY B;  3CCM Z;  3I07 A;  1VQN 1;  3F3F C;  1QVG Y;  2V8J A;  3I4N I;  5D1O B;  5FLX f;  2QA4 Z;  1TWH I;  1FDO A;  3CCV Z;  1R9T I;  2E9H A;  2AYD A;  2JMO A;  3G6E 1;  4HGY A;  1Y1V S;  2F4M A;  1VQ5 Z;  1VQ8 Z;  1K8A 2;  3VMI A;  3GTJ I;  1VQK 1;  3CCR Z;  1VQO 1;  2NVQ I;  1RO4 A;  3GTO I;  2GTI A;  5T64 A;  3F3P C;  4MD8 A;  3CD6 Z;  3S1M I;  3I56 1;  3D9X A;  3CCM 1;  4MRI A;  1X3W A;  3J7A 4;  3GTM I;  3CXC Z;  4NBG A;  3U50 C;  1WW9 A;  4X6A I;  4NBA A;  2PM9 A;  1X3Z A;  2AKL A;  1Q82 2;  1JWH C;  1VQ4 Z;  1K73 2;  2F4O A;  4E2Z A;  1VQ9 Z;  5IT9 b;  1YIT 1;  4XX2 A;  2IZ4 A;  3CCJ Z;  2JNY A;  4RS4 A;  2NVX I;  2WAQ A;  3J80 f;  4MXU A;  3H3V J;  1Q86 1;  4RVF A;  2V8I A;  3CCR 1;  5C3E I;  2QLV B;  3G4S Z;  1JJ2 Y;  1TFI A;  1P9N A;  3LUS A;  3HOV I;  2KPI A;  4A3C I;  1YJN Z;  4BY1 I;  3CMA Z;  3HOZ I;  2DE6 A;  1Y1W I;  1YI2 Z;  1VQP Z;  2JIQ A;  5C4X I;  3S15 I;  3CQZ I;  1VQ4 1;  4MH4 A;  1M90 2;  4E30 A;  2E7Z A;  3NH8 A;  1USP A;  3EED A;  1Y8C A;  2GTH A;  4TNU A;  1K83 I;  5AN9 F;  1AA6 A;  3HOY I;  2V3V A;  2K5R A;  2PK7 A;  2RIQ A;  2V45 A;  3G6E Z;  3FQM A;  1QVF Z;  3GTQ I;  2VPW A;  4E2W A;  1VQO Z;  5D1P A;  3I55 1;  1ZB8 A;  3GTM S;  1Q81 1;  3CMA 1;  1VQL 1;  2JUB A;  1YI2 1;  3CCL 1;  4E2X A;  2R93 I;  1NJI 2;  4NOZ A;  4A3B I;  5CM2 M;  2RBL A;  4NBH A;  3CPW Z;  3FQQ A;  2BJO A;  3P5J B;  2HU9 A;  4MD9 A;  3QWU A;  1YUA A;  2JA6 I;  3MZL B;  2K3R A;  3VMH A;  2QRD B;  3CCS Z;  1S7M A;  1YIT Z;  2Q4Z A;  2NAP A;  2YU9 I;  2JR6 A;  1WJ2 A;  1USP B;  1YUK A;  3FKI I;  2EGT A;  3NFZ A;  3J80 b;  3S14 I;  2I3C A;  3K7A I;  5T67 A;  1M1K 2;  2E2J I;  4BY7 I;  4RVG A;  1KD1 1;  2NVT I;  3M4O I;  4NBB A;  5IP7 I;  1S72 Z;  3CCE 1;  3S2D I;  1YJW Z;  4NBE A;  1N8R 2;  3HOU I;  1K9M 1;  3CCQ 1;  1ZH1 A;  1I6H I;  1TWC I;  1W2B Z;  2LEX A;  3GTK I;  4MD7 A;  1VQ7 Z;  1ZB9 A;  3BG0 B;  2IZ3 A;  3CCS 1;  4BBR I;  3S1R I;  5C44 I;  2OOX B;  4AYB A;  4A3F I;  4A3I I;  3CC2 1;  3GTP I;  1VLA A;  3JAM f;  1FDI A;  1Q7Y 2;  5FLM I;  4RVD A;  1VQM 1;  2J6A A;  4NBC A;  4E2Y A;  2JIR A;  3NH5 A;  1TWA I;  1K8A 1;  3ESW A;  4MON A;  3I55 Z;  4NBF A;  1S72 1;  1VQL Z;  2JIM A;  5LL6 f;  3CCU 1;  4BXX I;  3CCL Z;  1YJW 1;  1N2F A;  2VUG A;  4NH1 C;  1KC8 2;  2OTL Z;  4HH4 A;  1Z03 A;  3S1Q I;  1TWG I;  2O4H A;  1VQ7 1;  1QF8 A;  2VF1 A;  3NDI A;  4A3M I;  2VPX A;  2V8K A;  4A3D I;  1WCM I;  3CXC Y;  2O53 A;  1Q82 1;  1QVG Z;  1K73 1;  3HOW I;  4EWC A;  1W2B Y;  2R92 I;  2VUM I;  1RQF A;  1KQS Z;  1RO2 A;  3CC7 Z;  3GCF A;  2GU2 A;  2DE7 A;  2NVY I;  1SFO I;  3PO2 I;  3I4M I;  3BG1 B;  3CME 1;  1NP6 A;  3S16 I;  2KI7 B;  3J81 b;  3OW2 Z;  2QRC B;  3M3Y I;  3TDH B;  2JA7 I;  2JS4 A;  2RT9 A;  2OTL 1;  3CCE Z;  4A3L I;  1YHQ Z;  2QRE B;  3Q87 A;  5T6B A;  3H0G I;  4QTT A;  3CCQ Z;  3IFU A;  1Z01 A;  4NBD A;  3D2L A;  2JIO A;  4E32 A;  1YIJ 1;  2YAD A;  2JA5 I;  3HKZ A;  4A93 I;  3G71 Z;  1M90 1;  4A3K I;  4NB8 A;  3TE5 B;  5A2Q f;  3GKQ A;  3NH4 A;  3CC2 Z;  1YJ9 Z;  4RV9 A;  2OTJ 1;  3CC7 1;  2B63 I;  2ZAE B;  2E2H I;  1VQM Z;  3J81 f;  3JAM b;  3RZD I;  1QXF A;  2RHB A;  4QTU A;  4A3J I;  2HF1 A;  1I50 I;  3MON A;  1Q86 2;  1JJ2 Z;  3GTL I;  1QVF Y;  2LFU A;  2R6M A;  1KQS Y;  3KIH A;  2Y0S A;  3EER A;  3CCU Z;  1TWF I;  1RLY A;  1L1O C;  1Z02 A;  1YHQ 1;  3CC4 1;  1VQ6 Z;  2W04 A;  2E2I I;  2M6N A;  2LIY A;  1NJI 1;  2JA8 I;  3OW2 Y;  1RNI A;  3PO3 I;  3G71 1;  2QEX Z;  2RPR A;  2OZK A;  2QKD A;  4BBS I;  3CPW Y;  1RO0 A;  1YJ9 1;  4DK1 A;  2H85 A;  2PMZ A;  1PFT A;  1X0T A;  2QA4 1;  2WB1 A;  3CCV 1;  4CL1 A;  3S17 I;  1NUI A;  2IV2 X;  3MZK B;  3T4N B;  1KRL A;  1M1K 1;  3CME Z;  4Y52 I;  1VQ5 1;  1VQ8 1;  1VQ6 1;  2P28 A;  1I3Q I;  4DGL A;  3IF8 A;  1Q81 2;  3RZO I;  3IR7 A;  1N8R 1;  1YIJ Z;  2QEX 1;  1Y1V I;  1WII A;  3CD6 1;  5IP9 I;  4DQY B;  5C4J I;  1DL6 A;  3HOX I;  3S2H I;  5D1O A;  5IT9 f;  4RVH A;  3GTG I;  3VTN A;  5A2Q b;  2OTJ Z;  1VQ9 1;  2M48 A;  4E31 A;  1VQN Z;  2Q51 A;  1Q7Y 1;  1LQL A;  2QR1 B;  4E33 A;  4A3G I;  3CCJ 1;  3VMG A; 
#chains in the Genus database with same CATH homology
 3NDJ A;  5FLX b;  4S1T A;  1ML8 A;  3PO3 S;  2P3Y A;  3VB9 A;  4HGZ A;  3KIF A;  1KD1 2;  2DE5 A;  2G2K A;  3G4S 1;  3IX0 A;  3CC4 Z;  4NB9 A;  1VQK Z;  1KC8 1;  1YJN 1;  4A3E I;  4NFR A;  3D6W A;  4Y7N I;  1QYP A;  1VQP 1;  1K9M 2;  2R7Z I;  2W03 A;  3S1N I;  3I56 Z;  2OOY B;  3CCM Z;  3I07 A;  1VQN 1;  3F3F C;  1QVG Y;  2V8J A;  3I4N I;  5D1O B;  5FLX f;  2QA4 Z;  1TWH I;  3CCV Z;  1R9T I;  2E9H A;  2JMO A;  3G6E 1;  4HGY A;  1Y1V S;  2F4M A;  1VQ5 Z;  1VQ8 Z;  1K8A 2;  3VMI A;  3GTJ I;  1VQK 1;  3CCR Z;  1VQO 1;  2NVQ I;  1RO4 A;  3GTO I;  2GTI A;  5T64 A;  3F3P C;  4MD8 A;  3CD6 Z;  3S1M I;  3I56 1;  3D9X A;  3CCM 1;  4MRI A;  1X3W A;  3J7A 4;  3GTM I;  3CXC Z;  4NBG A;  3U50 C;  1WW9 A;  4X6A I;  4NBA A;  2PM9 A;  1X3Z A;  2AKL A;  1Q82 2;  1JWH C;  1VQ4 Z;  1K73 2;  2F4O A;  4E2Z A;  1VQ9 Z;  5IT9 b;  1YIT 1;  4XX2 A;  2IZ4 A;  3CCJ Z;  2JNY A;  4RS4 A;  2NVX I;  2WAQ A;  3J80 f;  4MXU A;  3H3V J;  1Q86 1;  4RVF A;  2V8I A;  3CCR 1;  5C3E I;  2QLV B;  3G4S Z;  1JJ2 Y;  1TFI A;  1P9N A;  3LUS A;  3HOV I;  2KPI A;  4A3C I;  1YJN Z;  4BY1 I;  3CMA Z;  3HOZ I;  2DE6 A;  1Y1W I;  1YI2 Z;  1VQP Z;  5C4X I;  3S15 I;  3CQZ I;  1VQ4 1;  4MH4 A;  1M90 2;  4E30 A;  3NH8 A;  1USP A;  3EED A;  2GTH A;  4TNU A;  1K83 I;  5AN9 F;  3HOY I;  2K5R A;  2PK7 A;  2RIQ A;  3G6E Z;  3FQM A;  1QVF Z;  3GTQ I;  4E2W A;  1VQO Z;  5D1P A;  3I55 1;  1ZB8 A;  3GTM S;  1Q81 1;  3CMA 1;  1VQL 1;  2JUB A;  1YI2 1;  3CCL 1;  4E2X A;  2R93 I;  1NJI 2;  4NOZ A;  4A3B I;  5CM2 M;  2RBL A;  4NBH A;  3CPW Z;  3FQQ A;  2BJO A;  3P5J B;  2HU9 A;  4MD9 A;  3QWU A;  1YUA A;  2JA6 I;  3MZL B;  2K3R A;  3VMH A;  2QRD B;  3CCS Z;  1S7M A;  1YIT Z;  2Q4Z A;  2YU9 I;  2JR6 A;  1USP B;  1YUK A;  3FKI I;  2EGT A;  3NFZ A;  3J80 b;  3S14 I;  2I3C A;  3K7A I;  5T67 A;  1M1K 2;  2E2J I;  4BY7 I;  4RVG A;  1KD1 1;  2NVT I;  3M4O I;  4NBB A;  5IP7 I;  1S72 Z;  3CCE 1;  3S2D I;  1YJW Z;  4NBE A;  1N8R 2;  3HOU I;  1K9M 1;  3CCQ 1;  1ZH1 A;  1I6H I;  1TWC I;  1W2B Z;  3GTK I;  4MD7 A;  1VQ7 Z;  1ZB9 A;  3BG0 B;  2IZ3 A;  3CCS 1;  4BBR I;  3S1R I;  5C44 I;  2OOX B;  4AYB A;  4A3F I;  4A3I I;  3CC2 1;  3GTP I;  1VLA A;  3JAM f;  1Q7Y 2;  5FLM I;  4RVD A;  1VQM 1;  2J6A A;  4NBC A;  4E2Y A;  3NH5 A;  1TWA I;  1K8A 1;  3ESW A;  4MON A;  3I55 Z;  4NBF A;  1S72 1;  1VQL Z;  5LL6 f;  3CCU 1;  4BXX I;  3CCL Z;  1YJW 1;  1N2F A;  2VUG A;  4NH1 C;  1KC8 2;  2OTL Z;  4HH4 A;  1Z03 A;  3S1Q I;  1TWG I;  2O4H A;  1VQ7 1;  1QF8 A;  2VF1 A;  3NDI A;  4A3M I;  2V8K A;  4A3D I;  1WCM I;  3CXC Y;  2O53 A;  1Q82 1;  1QVG Z;  1K73 1;  3HOW I;  4EWC A;  1W2B Y;  2R92 I;  2VUM I;  1RQF A;  1KQS Z;  1RO2 A;  3CC7 Z;  3GCF A;  2GU2 A;  2DE7 A;  2NVY I;  1SFO I;  3PO2 I;  3I4M I;  3BG1 B;  3CME 1;  1NP6 A;  3S16 I;  2KI7 B;  3J81 b;  3OW2 Z;  2QRC B;  3M3Y I;  3TDH B;  2JA7 I;  2JS4 A;  2RT9 A;  2OTL 1;  3CCE Z;  4A3L I;  1YHQ Z;  2QRE B;  3Q87 A;  5T6B A;  3H0G I;  4QTT A;  3CCQ Z;  3IFU A;  1Z01 A;  4NBD A;  4E32 A;  1YIJ 1;  2YAD A;  2JA5 I;  3HKZ A;  4A93 I;  3G71 Z;  1M90 1;  4A3K I;  4NB8 A;  3TE5 B;  5A2Q f;  3GKQ A;  3NH4 A;  3CC2 Z;  1YJ9 Z;  4RV9 A;  2OTJ 1;  3CC7 1;  2B63 I;  2ZAE B;  2E2H I;  1VQM Z;  3J81 f;  3JAM b;  3RZD I;  2RHB A;  4QTU A;  4A3J I;  2HF1 A;  1I50 I;  3MON A;  1Q86 2;  1JJ2 Z;  3GTL I;  1QVF Y;  2LFU A;  2R6M A;  1KQS Y;  3KIH A;  2Y0S A;  3EER A;  3CCU Z;  1TWF I;  1RLY A;  1L1O C;  1Z02 A;  1YHQ 1;  3CC4 1;  1VQ6 Z;  2W04 A;  2E2I I;  2M6N A;  2LIY A;  1NJI 1;  2JA8 I;  3OW2 Y;  1RNI A;  3PO3 I;  3G71 1;  2QEX Z;  2RPR A;  2OZK A;  2QKD A;  4BBS I;  3CPW Y;  1RO0 A;  1YJ9 1;  4DK1 A;  2H85 A;  2PMZ A;  1PFT A;  1X0T A;  2QA4 1;  2WB1 A;  3CCV 1;  4CL1 A;  3S17 I;  1NUI A;  3MZK B;  3T4N B;  1KRL A;  1M1K 1;  3CME Z;  4Y52 I;  1VQ5 1;  1VQ8 1;  1VQ6 1;  2P28 A;  1I3Q I;  4DGL A;  3IF8 A;  1Q81 2;  3RZO I;  1N8R 1;  1YIJ Z;  2QEX 1;  1Y1V I;  1WII A;  3CD6 1;  5IP9 I;  4DQY B;  5C4J I;  1DL6 A;  3HOX I;  3S2H I;  5D1O A;  5IT9 f;  4RVH A;  3GTG I;  3VTN A;  5A2Q b;  2OTJ Z;  1VQ9 1;  2M48 A;  4E31 A;  1VQN Z;  2Q51 A;  1Q7Y 1;  1LQL A;  2QR1 B;  4E33 A;  4A3G I;  3CCJ 1;  3VMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...