1YJWZ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjwZ00
1W2BY 3G71Z 1Q811 2OTL1 3OW2Z 3CCE1 1VQ91 2OTJZ 3CCR1 1VQNZ 1YIJ1 3G6E1 3CCM1 1VQ41 3CCQZ 1VQK1 1S72Z 3CC2Z 1QVGY 1Q7Y2 1K9M1 1M1K1 1VQ6Z 3CCUZ 1YITZ 1YI21 1VQ51 1YJN1 3CC41 1YJWZ 3CC71 3OW2Y 1YJ91 3CCS1 1JJ2Z 3CCJZ 3CPWZ 1KQSZ 1VQOZ 1Q7Y1 3I56Z 3G4S1 2OTLZ 3CD61 3CMEZ 1VQ9Z 3I55Z 1YIJZ 3G711 1VQ4Z 1YHQZ 1VQM1 1QVFZ 1VQKZ 1K732 1VQ8Z 1VQN1 1VQ7Z 3CCVZ 1VQPZ 3CCQ1 3CMAZ 3CXCZ 1S721 2QEXZ 3CC21 1NJI2 1YI2Z 1VQ61 3CCLZ 3CCU1 3CC7Z 2QA4Z 1YJ9Z 3CCSZ 1YIT1 1K731 1YJW1 1VQL1 3CCEZ 1K8A2 1KD12 3CCRZ 3CCJ1 1VQO1 3G6EZ 3CCMZ 1NJI1 1JJ2Y 2OTJ1 1KC82 1M901 3CPWY 1KQSY 1N8R1 3CME1 1VQMZ 1Q822 1K8A1 3I551 1KD11 1VQ5Z 1YJNZ 3CC4Z 1W2BZ 1YHQ1 1Q862 1M902 1VQ81 1Q812 1N8R2 1VQ71 3CCV1 1KC81 1QVFY 1VQP1 3CMA1 2QEX1 1Q821 1QVGZ 3CCL1 1VQLZ 3G4SZ 3CD6Z 3CXCY 2QA41 1K9M2 1M1K2 3I561 1Q861
chains in the Genus database with same CATH superfamily
2RBLA 1W2BY 3F3PC 1N2FA 1Q811 2AYDA 3HOXI 3GTPI 1YIJ1 4RV9A 3S1RI 3CCM1 3VB9A 1VQK1 1Y1VS 1K9M1 1M1K1 2JIOA 2V8JA 5AN9F 2R6MA 1RO0A 3D2LA 1YJN1 1YJWZ 5A2Qf 4A3II 1PFTA 3CCJZ 1QF8A 3HOYI 4A3CI 4A3LI 3F3FC 1SIWA 4E32A 3CMEZ 4QTUA 2O4HA 1VQ4Z 1YHQZ 2VPZA 1VQM1 1QVFZ 2V8KA 4NOZA 1VQN1 1VQ7Z 3CCVZ 4NBHA 3I4NI 3D6WA 3CMAZ 5FLMI 1S721 3CC21 2JR6A 2JA7I 3TE5B 2NAPA 3CCU1 3VMGA 3M3YI 4E33A 2E9HA 3GTOI 4S1TA 1VQL1 1TWCI 3GTJI 2QKDA 2QRDB 1KD12 3S1MI 2G2KA 1VQO1 3CCMZ 2JS4A 1M901 1Z01A 3PO3S 3VTNA 1RO4A 4E31A 1KD11 1YJNZ 1WIIA 1I3QI 2K3RA 2W03A 3BG0B 1Q862 3TDHB 3VMIA 3I4MI 5T6BA 4NBEA 1VQP1 4RVGA 3NH8A 2QEX1 2NVTI 3T4NB 2PMZA 2VF1A 4DGLA 4A3MI 1QYPA 3CXCY 4Y7NI 4NFRA 1SFOI 1Q861 3S16I 3IFUA 5A2Qb 4HH4A 3CQZI 3CCR1 1VQNZ 1FDOA 1VQ41 1WZNA 1RO2A 1S7MA 3S2DI 2GTIA 1S72Z 3CC2Z 3LUSA 2EGTA 1Q7Y2 2E7ZA 3CCUZ 3NFZA 4MD9A 1X0TA 2IZ4A 2LIYA 4BXXI 4NBFA 1ZH1A 3S2HI 3GTMS 1KQSZ 3MZLB 5IT9f 1VQOZ 3D9XA 3NH5A 1Q7Y1 4DQYB 2R7ZI 2RPRA 5LL6f 3HOZI 2HU9A 1VQ9Z 3KIHA 1L1OC 5D1OA 2IV2X 2QREB 3G711 3IX0A 3HOVI 4MH4A 3KIFA 2LFUA 1VLAA 2OOXB 4E2ZA 2NVQI 5T64A 5C4JI 3CCQ1 1VQPZ 2JNYA 2PM9A 5C4XI 2QEXZ 1USPB 2H85A 4E30A 1YJ9Z 3CCSZ 1Z02A 3EEDA 2J6AA 4Y52I 4NBAA 2GTHA 2E2JI 2PK7A 3NDJA 2DE5A 4TNUA 1RNIA 3CCRZ 4MONA 2RIQA 3VMHA 1P9NA 5CM2M 4BBRI 1YUAA 2V8IA 4XX2A 3BG1B 2F4OA 2JIMA 1X3ZA 4A3EI 1M902 2QR1B 1WW9A 3Q87A 4RVHA 2VPWA 3J80f 1QXFA 3S14I 2GU2A 2JUBA 1WJ2A 1QVFY 2M48A 2HF1A 2RT9A 3ESWA 3NH4A 3CCL1 2VPXA 2JMOA 1DL6A 1TWGI 3HKZA 2Q4ZA 3G71Z 2Y0SA 1VQ91 1Z03A 2YU9I 3H0GI 5IT9b 2JIRA 4RVDA 3IF8A 2O53A 1TWHI 1Y1VI 3CCQZ 3FKII 3HOUI 2ZAEB 3MONA 2VUMI 3I07A 4MD7A 1VQ51 3H3VJ 3CC41 3S17I 4MXUA 1TWAI 1YJ91 3CCS1 1JJ2Z 4BBSI 2JIQA 3CPWZ 4BY1I 2JA8I 3I56Z 3K7AI 2E2II 3G4S1 2OTLZ 3CD61 2NVYI 2M6NA 3S15I 4NBCA 3GTKI 1AA6A 4X6AI 3GTGI 2F4MA 3J81b 1JWHC 1YI2Z 1Y8CA 1VQ61 2VPYA 3CCLZ 3CC7Z 2I3CA 1YIT1 3GTQI 1K83I 1K8A2 1RLYA 1ML8A 3J80b 1ZB8A 5IP7I 3P5JB 3M4OI 1KC82 1KQSY 1TWFI 2Q51A 3PO3I 5FLXf 3RZOI 4A93I 4E2XA 2OOYB 5D1OB 4A3KI 2BJOA 1TFIA 1N8R1 1Q822 2DE7A 1K8A1 3I551 1VQ5Z 1KRLA 3CC4Z 2R92I 4HGYA 5C3EI 4BY7I 4HGZA 2RHBA 1VQ81 1Y1WI 2E2HI 1KC81 2R93I 1USPA 1Q821 1QVGZ 3GCFA 3GKQA 3G4SZ 2AKLA 3CD6Z 2QA41 5D1PA 1YUKA 3J81f 4A3GI 3I561 4A3JI 4RS4A 3RZDI 2OTL1 3OW2Z 3CCE1 4NBDA 2P3YA 2OTJZ 3G6E1 1NUIA 4A3BI 1WCMI 3JAMf 3HOWI 2KI7B 2QRCB 4RVFA 1QVGY 1R9TI 2V3VA 4AYBA 1X3WA 1VQ6Z 1I50I 3FQMA 3NDIA 1YITZ 1YI21 3CC71 3OW2Y 2NVXI 1ZB9A 1NP6A 2K5RA 3GTMI 4E2YA 2P28A 4EWCA 4QTTA 3GTLI 2V45A 3PO2I 3MZKB 5C44I 2IZ3A 3IR7A 2LEXA 3S1NI 3I55Z 1YIJZ 2JA6I 1VQKZ 3U50C 1K732 2YADA 1VQ8Z 1RQFA 4A3DI 2QLVB 2W04A 3CXCZ 5FLXb 1NJI2 4A3FI 2QA4Z 4NH1C 1I6HI 1K731 1YJW1 3CCEZ 3EERA 4DK1A 2B63I 2DE6A 3CCJ1 3G6EZ 1NJI1 4NB9A 4E2WA 2KPIA 4MRIA 1FDIA 1JJ2Y 2OTJ1 3CPWY 4NB8A 1LQLA 3CME1 1VQMZ 3QWUA 3FQQA 1W2BZ 1YHQ1 4CL1A 2JA5I 4NBGA 3J7A4 1Q16A 1Q812 2VUGA 1N8R2 3JAMb 3CCV1 1VQ71 3S1QI 5T67A 3CMA1 4MD8A 4NBBA 2WB1A 5IP9I 1VQLZ 2OZKA 2JIPA 2WAQA 1K9M2 1M1K2
chains in the Genus database with same CATH topology
2RBLA 1W2BY 3F3PC 1N2FA 1Q811 3HOXI 3GTPI 1YIJ1 4RV9A 3S1RI 3CCM1 3VB9A 1VQK1 1Y1VS 1K9M1 1M1K1 2V8JA 5AN9F 2R6MA 1RO0A 1YJN1 1YJWZ 5A2Qf 4A3II 1PFTA 3CCJZ 1QF8A 3HOYI 4A3CI 4A3LI 3F3FC 4E32A 3CMEZ 4QTUA 2O4HA 1VQ4Z 1YHQZ 1VQM1 1QVFZ 2V8KA 4NOZA 1VQN1 1VQ7Z 3CCVZ 4NBHA 3I4NI 3D6WA 3CMAZ 5FLMI 1S721 3CC21 2JR6A 2JA7I 3TE5B 3CCU1 3VMGA 3M3YI 4E33A 2E9HA 3GTOI 4S1TA 1VQL1 1TWCI 3GTJI 2QKDA 2QRDB 1KD12 3S1MI 2G2KA 1VQO1 3CCMZ 2JS4A 1M901 1Z01A 3PO3S 3VTNA 1RO4A 4E31A 1KD11 1YJNZ 1WIIA 1I3QI 2K3RA 2W03A 3BG0B 1Q862 3TDHB 3VMIA 3I4MI 5T6BA 4NBEA 1VQP1 4RVGA 3NH8A 2QEX1 2NVTI 3T4NB 2PMZA 2VF1A 4DGLA 4A3MI 1QYPA 3CXCY 4Y7NI 4NFRA 1SFOI 1Q861 3S16I 3IFUA 5A2Qb 4HH4A 3CQZI 3CCR1 1VQNZ 1VQ41 1RO2A 1S7MA 3S2DI 2GTIA 1S72Z 3CC2Z 3LUSA 2EGTA 1Q7Y2 3CCUZ 3NFZA 4MD9A 1X0TA 2IZ4A 2LIYA 4BXXI 4NBFA 1ZH1A 3S2HI 3GTMS 1KQSZ 3MZLB 5IT9f 1VQOZ 3D9XA 3NH5A 1Q7Y1 4DQYB 2R7ZI 2RPRA 5LL6f 3HOZI 2HU9A 1VQ9Z 3KIHA 1L1OC 5D1OA 2QREB 3G711 3IX0A 3HOVI 4MH4A 3KIFA 2LFUA 1VLAA 2OOXB 4E2ZA 2NVQI 5T64A 5C4JI 3CCQ1 1VQPZ 2JNYA 2PM9A 5C4XI 2QEXZ 1USPB 2H85A 4E30A 1YJ9Z 3CCSZ 1Z02A 3EEDA 2J6AA 4Y52I 4NBAA 2GTHA 2E2JI 2PK7A 3NDJA 2DE5A 4TNUA 1RNIA 3CCRZ 4MONA 2RIQA 3VMHA 1P9NA 5CM2M 4BBRI 1YUAA 2V8IA 4XX2A 3BG1B 2F4OA 1X3ZA 4A3EI 1M902 2QR1B 1WW9A 3Q87A 4RVHA 3J80f 3S14I 2GU2A 2JUBA 1QVFY 2M48A 2HF1A 2RT9A 3ESWA 3NH4A 3CCL1 2JMOA 1DL6A 1TWGI 3HKZA 2Q4ZA 3G71Z 2Y0SA 1VQ91 1Z03A 2YU9I 3H0GI 5IT9b 4RVDA 3IF8A 2O53A 1TWHI 1Y1VI 3CCQZ 3FKII 3HOUI 2ZAEB 3MONA 2VUMI 3I07A 4MD7A 1VQ51 3H3VJ 3CC41 3S17I 4MXUA 1TWAI 1YJ91 3CCS1 1JJ2Z 4BBSI 3CPWZ 4BY1I 2JA8I 3I56Z 3K7AI 2E2II 3G4S1 2OTLZ 3CD61 2NVYI 2M6NA 3S15I 4NBCA 3GTKI 4X6AI 3GTGI 2F4MA 3J81b 1JWHC 1YI2Z 1VQ61 3CCLZ 3CC7Z 2I3CA 1YIT1 3GTQI 1K83I 1K8A2 1RLYA 1ML8A 3J80b 1ZB8A 5IP7I 3P5JB 3M4OI 1KC82 1KQSY 1TWFI 2Q51A 3PO3I 5FLXf 3RZOI 4A93I 4E2XA 2OOYB 5D1OB 4A3KI 2BJOA 1TFIA 1N8R1 1Q822 2DE7A 1K8A1 3I551 1VQ5Z 1KRLA 3CC4Z 2R92I 4HGYA 5C3EI 4BY7I 4HGZA 2RHBA 1VQ81 1Y1WI 2E2HI 1KC81 2R93I 1USPA 1Q821 1QVGZ 3GCFA 3GKQA 3G4SZ 2AKLA 3CD6Z 2QA41 5D1PA 1YUKA 3J81f 4A3GI 3I561 4A3JI 4RS4A 3RZDI 2OTL1 3OW2Z 3CCE1 4NBDA 2P3YA 2OTJZ 3G6E1 1NUIA 4A3BI 1WCMI 3JAMf 3HOWI 2KI7B 2QRCB 4RVFA 1QVGY 1R9TI 4AYBA 1X3WA 1VQ6Z 1I50I 3FQMA 3NDIA 1YITZ 1YI21 3CC71 3OW2Y 2NVXI 1ZB9A 1NP6A 2K5RA 3GTMI 4E2YA 2P28A 4EWCA 4QTTA 3GTLI 3PO2I 3MZKB 5C44I 2IZ3A 3S1NI 3I55Z 1YIJZ 2JA6I 1VQKZ 3U50C 1K732 2YADA 1VQ8Z 1RQFA 4A3DI 2QLVB 2W04A 3CXCZ 5FLXb 1NJI2 4A3FI 2QA4Z 4NH1C 1I6HI 1K731 1YJW1 3CCEZ 3EERA 4DK1A 2B63I 2DE6A 3CCJ1 3G6EZ 1NJI1 4NB9A 4E2WA 2KPIA 4MRIA 1JJ2Y 2OTJ1 3CPWY 4NB8A 1LQLA 3CME1 1VQMZ 3QWUA 3FQQA 1W2BZ 1YHQ1 4CL1A 2JA5I 4NBGA 3J7A4 1Q812 2VUGA 1N8R2 3JAMb 3CCV1 1VQ71 3S1QI 5T67A 3CMA1 4MD8A 4NBBA 2WB1A 5IP9I 1VQLZ 2OZKA 2WAQA 1K9M2 1M1K2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B Y;  3G71 Z;  1Q81 1;  2OTL 1;  3OW2 Z;  3CCE 1;  1VQ9 1;  2OTJ Z;  3CCR 1;  1VQN Z;  1YIJ 1;  3G6E 1;  3CCM 1;  1VQ4 1;  3CCQ Z;  1VQK 1;  1S72 Z;  3CC2 Z;  1QVG Y;  1Q7Y 2;  1K9M 1;  1M1K 1;  1VQ6 Z;  3CCU Z;  1YIT Z;  1YI2 1;  1VQ5 1;  1YJN 1;  3CC4 1;  1YJW Z;  3CC7 1;  3OW2 Y;  1YJ9 1;  3CCS 1;  1JJ2 Z;  3CCJ Z;  3CPW Z;  1KQS Z;  1VQO Z;  1Q7Y 1;  3I56 Z;  3G4S 1;  2OTL Z;  3CD6 1;  3CME Z;  1VQ9 Z;  3I55 Z;  1YIJ Z;  3G71 1;  1VQ4 Z;  1YHQ Z;  1VQM 1;  1QVF Z;  1VQK Z;  1K73 2;  1VQ8 Z;  1VQN 1;  1VQ7 Z;  3CCV Z;  1VQP Z;  3CCQ 1;  3CMA Z;  3CXC Z;  1S72 1;  2QEX Z;  3CC2 1;  1NJI 2;  1YI2 Z;  1VQ6 1;  3CCL Z;  3CCU 1;  3CC7 Z;  2QA4 Z;  1YJ9 Z;  3CCS Z;  1YIT 1;  1K73 1;  1YJW 1;  1VQL 1;  3CCE Z;  1K8A 2;  1KD1 2;  3CCR Z;  3CCJ 1;  1VQO 1;  3G6E Z;  3CCM Z;  1NJI 1;  1JJ2 Y;  2OTJ 1;  1KC8 2;  1M90 1;  3CPW Y;  1KQS Y;  1N8R 1;  3CME 1;  1VQM Z;  1Q82 2;  1K8A 1;  3I55 1;  1KD1 1;  1VQ5 Z;  1YJN Z;  3CC4 Z;  1W2B Z;  1YHQ 1;  1Q86 2;  1M90 2;  1VQ8 1;  1Q81 2;  1N8R 2;  1VQ7 1;  3CCV 1;  1KC8 1;  1QVF Y;  1VQP 1;  3CMA 1;  2QEX 1;  1Q82 1;  1QVG Z;  3CCL 1;  1VQL Z;  3G4S Z;  3CD6 Z;  3CXC Y;  2QA4 1;  1K9M 2;  1M1K 2;  3I56 1;  1Q86 1; 
#chains in the Genus database with same CATH topology
 2RBL A;  1W2B Y;  3F3P C;  1N2F A;  1Q81 1;  2AYD A;  3HOX I;  3GTP I;  1YIJ 1;  4RV9 A;  3S1R I;  3CCM 1;  3VB9 A;  1VQK 1;  1Y1V S;  1K9M 1;  1M1K 1;  2JIO A;  2V8J A;  5AN9 F;  2R6M A;  1RO0 A;  3D2L A;  1YJN 1;  1YJW Z;  5A2Q f;  4A3I I;  1PFT A;  3CCJ Z;  1QF8 A;  3HOY I;  4A3C I;  4A3L I;  3F3F C;  1SIW A;  4E32 A;  3CME Z;  4QTU A;  2O4H A;  1VQ4 Z;  1YHQ Z;  2VPZ A;  1VQM 1;  1QVF Z;  2V8K A;  4NOZ A;  1VQN 1;  1VQ7 Z;  3CCV Z;  4NBH A;  3I4N I;  3D6W A;  3CMA Z;  5FLM I;  1S72 1;  3CC2 1;  2JR6 A;  2JA7 I;  3TE5 B;  2NAP A;  3CCU 1;  3VMG A;  3M3Y I;  4E33 A;  2E9H A;  3GTO I;  4S1T A;  1VQL 1;  1TWC I;  3GTJ I;  2QKD A;  2QRD B;  1KD1 2;  3S1M I;  2G2K A;  1VQO 1;  3CCM Z;  2JS4 A;  1M90 1;  1Z01 A;  3PO3 S;  3VTN A;  1RO4 A;  4E31 A;  1KD1 1;  1YJN Z;  1WII A;  1I3Q I;  2K3R A;  2W03 A;  3BG0 B;  1Q86 2;  3TDH B;  3VMI A;  3I4M I;  5T6B A;  4NBE A;  1VQP 1;  4RVG A;  3NH8 A;  2QEX 1;  2NVT I;  3T4N B;  2PMZ A;  2VF1 A;  4DGL A;  4A3M I;  1QYP A;  3CXC Y;  4Y7N I;  4NFR A;  1SFO I;  1Q86 1;  3S16 I;  3IFU A;  5A2Q b;  4HH4 A;  3CQZ I;  3CCR 1;  1VQN Z;  1FDO A;  1VQ4 1;  1WZN A;  1RO2 A;  1S7M A;  3S2D I;  2GTI A;  1S72 Z;  3CC2 Z;  3LUS A;  2EGT A;  1Q7Y 2;  2E7Z A;  3CCU Z;  3NFZ A;  4MD9 A;  1X0T A;  2IZ4 A;  2LIY A;  4BXX I;  4NBF A;  1ZH1 A;  3S2H I;  3GTM S;  1KQS Z;  3MZL B;  5IT9 f;  1VQO Z;  3D9X A;  3NH5 A;  1Q7Y 1;  4DQY B;  2R7Z I;  2RPR A;  5LL6 f;  3HOZ I;  2HU9 A;  1VQ9 Z;  3KIH A;  1L1O C;  5D1O A;  2IV2 X;  2QRE B;  3G71 1;  3IX0 A;  3HOV I;  4MH4 A;  3KIF A;  2LFU A;  1VLA A;  2OOX B;  4E2Z A;  2NVQ I;  5T64 A;  5C4J I;  3CCQ 1;  1VQP Z;  2JNY A;  2PM9 A;  5C4X I;  2QEX Z;  1USP B;  2H85 A;  4E30 A;  1YJ9 Z;  3CCS Z;  1Z02 A;  3EED A;  2J6A A;  4Y52 I;  4NBA A;  2GTH A;  2E2J I;  2PK7 A;  3NDJ A;  2DE5 A;  4TNU A;  1RNI A;  3CCR Z;  4MON A;  2RIQ A;  3VMH A;  1P9N A;  5CM2 M;  4BBR I;  1YUA A;  2V8I A;  4XX2 A;  3BG1 B;  2F4O A;  2JIM A;  1X3Z A;  4A3E I;  1M90 2;  2QR1 B;  1WW9 A;  3Q87 A;  4RVH A;  2VPW A;  3J80 f;  1QXF A;  3S14 I;  2GU2 A;  2JUB A;  1WJ2 A;  1QVF Y;  2M48 A;  2HF1 A;  2RT9 A;  3ESW A;  3NH4 A;  3CCL 1;  2VPX A;  2JMO A;  1DL6 A;  1TWG I;  3HKZ A;  2Q4Z A;  3G71 Z;  2Y0S A;  1VQ9 1;  1Z03 A;  2YU9 I;  3H0G I;  5IT9 b;  2JIR A;  4RVD A;  3IF8 A;  2O53 A;  1TWH I;  1Y1V I;  3CCQ Z;  3FKI I;  3HOU I;  2ZAE B;  3MON A;  2VUM I;  3I07 A;  4MD7 A;  1VQ5 1;  3H3V J;  3CC4 1;  3S17 I;  4MXU A;  1TWA I;  1YJ9 1;  3CCS 1;  1JJ2 Z;  4BBS I;  2JIQ A;  3CPW Z;  4BY1 I;  2JA8 I;  3I56 Z;  3K7A I;  2E2I I;  3G4S 1;  2OTL Z;  3CD6 1;  2NVY I;  2M6N A;  3S15 I;  4NBC A;  3GTK I;  1AA6 A;  4X6A I;  3GTG I;  2F4M A;  3J81 b;  1JWH C;  1YI2 Z;  1Y8C A;  1VQ6 1;  2VPY A;  3CCL Z;  3CC7 Z;  2I3C A;  1YIT 1;  3GTQ I;  1K83 I;  1K8A 2;  1RLY A;  1ML8 A;  3J80 b;  1ZB8 A;  5IP7 I;  3P5J B;  3M4O I;  1KC8 2;  1KQS Y;  1TWF I;  2Q51 A;  3PO3 I;  5FLX f;  3RZO I;  4A93 I;  4E2X A;  2OOY B;  5D1O B;  4A3K I;  2BJO A;  1TFI A;  1N8R 1;  1Q82 2;  2DE7 A;  1K8A 1;  3I55 1;  1VQ5 Z;  1KRL A;  3CC4 Z;  2R92 I;  4HGY A;  5C3E I;  4BY7 I;  4HGZ A;  2RHB A;  1VQ8 1;  1Y1W I;  2E2H I;  1KC8 1;  2R93 I;  1USP A;  1Q82 1;  1QVG Z;  3GCF A;  3GKQ A;  3G4S Z;  2AKL A;  3CD6 Z;  2QA4 1;  5D1P A;  1YUK A;  3J81 f;  4A3G I;  3I56 1;  4A3J I;  4RS4 A;  3RZD I;  2OTL 1;  3OW2 Z;  3CCE 1;  4NBD A;  2P3Y A;  2OTJ Z;  3G6E 1;  1NUI A;  4A3B I;  1WCM I;  3JAM f;  3HOW I;  2KI7 B;  2QRC B;  4RVF A;  1QVG Y;  1R9T I;  2V3V A;  4AYB A;  1X3W A;  1VQ6 Z;  1I50 I;  3FQM A;  3NDI A;  1YIT Z;  1YI2 1;  3CC7 1;  3OW2 Y;  2NVX I;  1ZB9 A;  1NP6 A;  2K5R A;  3GTM I;  4E2Y A;  2P28 A;  4EWC A;  4QTT A;  3GTL I;  2V45 A;  3PO2 I;  3MZK B;  5C44 I;  2IZ3 A;  3IR7 A;  2LEX A;  3S1N I;  3I55 Z;  1YIJ Z;  2JA6 I;  1VQK Z;  3U50 C;  1K73 2;  2YAD A;  1VQ8 Z;  1RQF A;  4A3D I;  2QLV B;  2W04 A;  3CXC Z;  5FLX b;  1NJI 2;  4A3F I;  2QA4 Z;  4NH1 C;  1I6H I;  1K73 1;  1YJW 1;  3CCE Z;  3EER A;  4DK1 A;  2B63 I;  2DE6 A;  3CCJ 1;  3G6E Z;  1NJI 1;  4NB9 A;  4E2W A;  2KPI A;  4MRI A;  1FDI A;  1JJ2 Y;  2OTJ 1;  3CPW Y;  4NB8 A;  1LQL A;  3CME 1;  1VQM Z;  3QWU A;  3FQQ A;  1W2B Z;  1YHQ 1;  4CL1 A;  2JA5 I;  4NBG A;  3J7A 4;  1Q16 A;  1Q81 2;  2VUG A;  1N8R 2;  3JAM b;  3CCV 1;  1VQ7 1;  3S1Q I;  5T67 A;  3CMA 1;  4MD8 A;  4NBB A;  2WB1 A;  5IP9 I;  1VQL Z;  2OZK A;  2JIP A;  2WAQ A;  1K9M 2;  1M1K 2; 
#chains in the Genus database with same CATH homology
 2RBL A;  1W2B Y;  3F3P C;  1N2F A;  1Q81 1;  3HOX I;  3GTP I;  1YIJ 1;  4RV9 A;  3S1R I;  3CCM 1;  3VB9 A;  1VQK 1;  1Y1V S;  1K9M 1;  1M1K 1;  2V8J A;  5AN9 F;  2R6M A;  1RO0 A;  1YJN 1;  1YJW Z;  5A2Q f;  4A3I I;  1PFT A;  3CCJ Z;  1QF8 A;  3HOY I;  4A3C I;  4A3L I;  3F3F C;  4E32 A;  3CME Z;  4QTU A;  2O4H A;  1VQ4 Z;  1YHQ Z;  1VQM 1;  1QVF Z;  2V8K A;  4NOZ A;  1VQN 1;  1VQ7 Z;  3CCV Z;  4NBH A;  3I4N I;  3D6W A;  3CMA Z;  5FLM I;  1S72 1;  3CC2 1;  2JR6 A;  2JA7 I;  3TE5 B;  3CCU 1;  3VMG A;  3M3Y I;  4E33 A;  2E9H A;  3GTO I;  4S1T A;  1VQL 1;  1TWC I;  3GTJ I;  2QKD A;  2QRD B;  1KD1 2;  3S1M I;  2G2K A;  1VQO 1;  3CCM Z;  2JS4 A;  1M90 1;  1Z01 A;  3PO3 S;  3VTN A;  1RO4 A;  4E31 A;  1KD1 1;  1YJN Z;  1WII A;  1I3Q I;  2K3R A;  2W03 A;  3BG0 B;  1Q86 2;  3TDH B;  3VMI A;  3I4M I;  5T6B A;  4NBE A;  1VQP 1;  4RVG A;  3NH8 A;  2QEX 1;  2NVT I;  3T4N B;  2PMZ A;  2VF1 A;  4DGL A;  4A3M I;  1QYP A;  3CXC Y;  4Y7N I;  4NFR A;  1SFO I;  1Q86 1;  3S16 I;  3IFU A;  5A2Q b;  4HH4 A;  3CQZ I;  3CCR 1;  1VQN Z;  1VQ4 1;  1RO2 A;  1S7M A;  3S2D I;  2GTI A;  1S72 Z;  3CC2 Z;  3LUS A;  2EGT A;  1Q7Y 2;  3CCU Z;  3NFZ A;  4MD9 A;  1X0T A;  2IZ4 A;  2LIY A;  4BXX I;  4NBF A;  1ZH1 A;  3S2H I;  3GTM S;  1KQS Z;  3MZL B;  5IT9 f;  1VQO Z;  3D9X A;  3NH5 A;  1Q7Y 1;  4DQY B;  2R7Z I;  2RPR A;  5LL6 f;  3HOZ I;  2HU9 A;  1VQ9 Z;  3KIH A;  1L1O C;  5D1O A;  2QRE B;  3G71 1;  3IX0 A;  3HOV I;  4MH4 A;  3KIF A;  2LFU A;  1VLA A;  2OOX B;  4E2Z A;  2NVQ I;  5T64 A;  5C4J I;  3CCQ 1;  1VQP Z;  2JNY A;  2PM9 A;  5C4X I;  2QEX Z;  1USP B;  2H85 A;  4E30 A;  1YJ9 Z;  3CCS Z;  1Z02 A;  3EED A;  2J6A A;  4Y52 I;  4NBA A;  2GTH A;  2E2J I;  2PK7 A;  3NDJ A;  2DE5 A;  4TNU A;  1RNI A;  3CCR Z;  4MON A;  2RIQ A;  3VMH A;  1P9N A;  5CM2 M;  4BBR I;  1YUA A;  2V8I A;  4XX2 A;  3BG1 B;  2F4O A;  1X3Z A;  4A3E I;  1M90 2;  2QR1 B;  1WW9 A;  3Q87 A;  4RVH A;  3J80 f;  3S14 I;  2GU2 A;  2JUB A;  1QVF Y;  2M48 A;  2HF1 A;  2RT9 A;  3ESW A;  3NH4 A;  3CCL 1;  2JMO A;  1DL6 A;  1TWG I;  3HKZ A;  2Q4Z A;  3G71 Z;  2Y0S A;  1VQ9 1;  1Z03 A;  2YU9 I;  3H0G I;  5IT9 b;  4RVD A;  3IF8 A;  2O53 A;  1TWH I;  1Y1V I;  3CCQ Z;  3FKI I;  3HOU I;  2ZAE B;  3MON A;  2VUM I;  3I07 A;  4MD7 A;  1VQ5 1;  3H3V J;  3CC4 1;  3S17 I;  4MXU A;  1TWA I;  1YJ9 1;  3CCS 1;  1JJ2 Z;  4BBS I;  3CPW Z;  4BY1 I;  2JA8 I;  3I56 Z;  3K7A I;  2E2I I;  3G4S 1;  2OTL Z;  3CD6 1;  2NVY I;  2M6N A;  3S15 I;  4NBC A;  3GTK I;  4X6A I;  3GTG I;  2F4M A;  3J81 b;  1JWH C;  1YI2 Z;  1VQ6 1;  3CCL Z;  3CC7 Z;  2I3C A;  1YIT 1;  3GTQ I;  1K83 I;  1K8A 2;  1RLY A;  1ML8 A;  3J80 b;  1ZB8 A;  5IP7 I;  3P5J B;  3M4O I;  1KC8 2;  1KQS Y;  1TWF I;  2Q51 A;  3PO3 I;  5FLX f;  3RZO I;  4A93 I;  4E2X A;  2OOY B;  5D1O B;  4A3K I;  2BJO A;  1TFI A;  1N8R 1;  1Q82 2;  2DE7 A;  1K8A 1;  3I55 1;  1VQ5 Z;  1KRL A;  3CC4 Z;  2R92 I;  4HGY A;  5C3E I;  4BY7 I;  4HGZ A;  2RHB A;  1VQ8 1;  1Y1W I;  2E2H I;  1KC8 1;  2R93 I;  1USP A;  1Q82 1;  1QVG Z;  3GCF A;  3GKQ A;  3G4S Z;  2AKL A;  3CD6 Z;  2QA4 1;  5D1P A;  1YUK A;  3J81 f;  4A3G I;  3I56 1;  4A3J I;  4RS4 A;  3RZD I;  2OTL 1;  3OW2 Z;  3CCE 1;  4NBD A;  2P3Y A;  2OTJ Z;  3G6E 1;  1NUI A;  4A3B I;  1WCM I;  3JAM f;  3HOW I;  2KI7 B;  2QRC B;  4RVF A;  1QVG Y;  1R9T I;  4AYB A;  1X3W A;  1VQ6 Z;  1I50 I;  3FQM A;  3NDI A;  1YIT Z;  1YI2 1;  3CC7 1;  3OW2 Y;  2NVX I;  1ZB9 A;  1NP6 A;  2K5R A;  3GTM I;  4E2Y A;  2P28 A;  4EWC A;  4QTT A;  3GTL I;  3PO2 I;  3MZK B;  5C44 I;  2IZ3 A;  3S1N I;  3I55 Z;  1YIJ Z;  2JA6 I;  1VQK Z;  3U50 C;  1K73 2;  2YAD A;  1VQ8 Z;  1RQF A;  4A3D I;  2QLV B;  2W04 A;  3CXC Z;  5FLX b;  1NJI 2;  4A3F I;  2QA4 Z;  4NH1 C;  1I6H I;  1K73 1;  1YJW 1;  3CCE Z;  3EER A;  4DK1 A;  2B63 I;  2DE6 A;  3CCJ 1;  3G6E Z;  1NJI 1;  4NB9 A;  4E2W A;  2KPI A;  4MRI A;  1JJ2 Y;  2OTJ 1;  3CPW Y;  4NB8 A;  1LQL A;  3CME 1;  1VQM Z;  3QWU A;  3FQQ A;  1W2B Z;  1YHQ 1;  4CL1 A;  2JA5 I;  4NBG A;  3J7A 4;  1Q81 2;  2VUG A;  1N8R 2;  3JAM b;  3CCV 1;  1VQ7 1;  3S1Q I;  5T67 A;  3CMA 1;  4MD8 A;  4NBB A;  2WB1 A;  5IP9 I;  1VQL Z;  2OZK A;  2WAQ A;  1K9M 2;  1M1K 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...