1YJWZ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome/antibiotic
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjwZ00
3CC21 1Q821 1K9M2 3CMAZ 2QEX1 1VQ61 3G4S1 2QA4Z 3CCMZ 1JJ2Z 1KC81 1YJW1 1Q812 1VQPZ 1K8A2 3I55Z 3CCLZ 1YJN1 1YHQ1 1Q861 3CCUZ 3CCJZ 1KC82 1S72Z 1Q7Y1 3CCQZ 1NJI2 1NJI1 1KQSZ 1VQ81 1QVGZ 2OTJ1 3CCJ1 1KD12 3CCVZ 1YIJ1 1YI2Z 1Q862 2QA41 1VQ9Z 2QEXZ 1VQP1 1QVFY 3CC71 2OTJZ 1VQ7Z 3CC41 3G6EZ 1VQKZ 1VQ4Z 3CME1 1VQNZ 3CCR1 3CCS1 3G711 2OTL1 1YJ9Z 3CCE1 1VQ91 1N8R1 1W2BZ 1VQOZ 3CXCZ 3OW2Y 1YJNZ 3I561 1QVGY 1M1K1 3CPWZ 1YIJZ 1Q822 3CC7Z 1VQ71 3CD61 3CCSZ 1M902 1YIT1 3G71Z 1VQM1 2OTLZ 1W2BY 1VQ8Z 3G4SZ 3CCM1 1QVFZ 1YJWZ 1VQ5Z 1VQO1 3CMA1 1K732 1YI21 1JJ2Y 3CC4Z 3I551 3CPWY 1VQLZ 1YJ91 3CD6Z 3CC2Z 1VQK1 1S721 1KQSY 1VQ6Z 3G6E1 3CCL1 1K8A1 1YHQZ 1M901 1YITZ 3CCEZ 3CCV1 1VQMZ 1VQL1 3CXCY 3OW2Z 1VQ41 1M1K2 3CMEZ 3CCQ1 1KD11 3CCRZ 1VQN1 3I56Z 1VQ51 1N8R2 1K9M1 3CCU1 1K731 1Q7Y2 1Q811
chains in the Genus database with same CATH superfamily
5CM2M 4RS4A 3CMAZ 3M4OI 2NAPA 2VPYA 3D9XA 3MZKB 3IX0A 4NBFA 3GTMS 1SIWA 2F4OA 1YJW1 3NDIA 2P28A 3KIHA 2RHBA 2V8IA 3I55Z 3GTJI 1ZH1A 1YJN1 1Y8CA 1RO4A 3MZLB 3CCJZ 3HOYI 2QRDB 3HOXI 1TWHI 2GTHA 1NJI1 4DGLA 4BBSI 1YI2Z 2JIOA 4CL1A 1Q862 4MD9A 2OZKA 1L1OC 1VQ9Z 3I4NI 1LQLA 5T6BA 4BY1I 4DQYB 4NBBA 2OTJZ 1VQ7Z 3S1NI 3I07A 4A3DI 3TE5B 3F3FC 5IP9I 1RQFA 3GTPI 1RLYA 2O4HA 1VQ4Z 1VQNZ 3CCR1 4Y7NI 4TNUA 3GTOI 4A3GI 3NH5A 4X6AI 2E7ZA 2EGTA 1VQ91 1N8R1 2YU9I 2AKLA 3OW2Y 3BG0B 1YJNZ 3CPWZ 2VF1A 3CC7Z 3KIFA 1VQ71 3CCSZ 2R93I 4NH1C 1VQM1 2VPZA 1W2BY 3J81f 5FLXf 2W03A 5C3EI 3CCM1 2QLVB 2RT9A 1VQ5Z 1VQO1 3HKZA 2DE6A 1YI21 3CMA1 1I6HI 2VUMI 2Q51A 1YJ91 3CD6Z 3CC2Z 4XX2A 1VQK1 2O53A 1PFTA 4E2ZA 3RZDI 3NH8A 1I50I 1YHQZ 4E2YA 1Q16A 4EWCA 3S1MI 3CXCY 1KD11 1VQN1 3CCRZ 4A3MI 2M6NA 4NBEA 1VQ51 1N8R2 3Q87A 1K731 1DL6A 2W04A 4NB9A 3CC21 3VMIA 4BBRI 1Q821 4A93I 5D1OB 2JA8I 1X3ZA 1K9M2 4BY7I 4NB8A 2LEXA 2YADA 3GTGI 2IV2X 2DE7A 3CCMZ 2ZAEB 1TFIA 3FKII 4A3EI 3CCLZ 4MONA 1R9TI 4QTUA 2JIMA 3HOZI 2QRCB 5C4JI 3GTKI 2GU2A 4NBHA 1FDIA 2AYDA 2RIQA 1QVGZ 4Y52I 4NOZA 2JA6I 3S17I 5IT9b 1ZB9A 2QA41 3VB9A 2K3RA 3BG1B 5T67A 1JWHC 2QEXZ 1VQP1 1RO2A 3VMGA 2NVTI 3S14I 4HGYA 3HOVI 3CME1 2PM9A 3G711 1ML8A 1S7MA 1RO0A 2PK7A 1FDOA 1VQOZ 3CXCZ 1YIJZ 2VPXA 3JAMb 3CD61 2OTLZ 2GTIA 5AN9F 2JUBA 3G4SZ 4A3CI 2R92I 1USPA 5T64A 1JJ2Y 4A3BI 2E2II 3HOUI 4E2WA 1KQSY 3MONA 4E2XA 1NUIA 2JMOA 3GTLI 2KI7B 1YITZ 3CCEZ 1WW9A 4E32A 3VMHA 1M1K2 3CCQ1 5A2Qb 3I56Z 5C44I 2JIPA 4MXUA 3IR7A 3VTNA 4RVGA 2HF1A 4NBCA 3J7A4 5D1OA 2V45A 1Q811 3S2HI 3GTMI 4S1TA 2QEX1 1VQ61 2J6AA 2JS4A 5D1PA 4MRIA 3G4S1 2LIYA 3GKQA 1KC81 1JJ2Z 1ZB8A 1WZNA 3RZOI 2WB1A 1Q812 4DK1A 4A3KI 1K8A2 1I3QI 3F3PC 1YHQ1 1KC82 2V8JA 1S72Z 1Q7Y1 1QXFA 3M3YI 1KD12 3CCVZ 4E30A 1Z01A 1USPB 1YIJ1 2NVYI 1YUKA 2V8KA 2JR6A 3CQZI 4QTTA 3J80b 1N2FA 3CC71 3D2LA 1WJ2A 3H3VJ 2NVXI 1QYPA 4NBDA 2VPWA 2R7ZI 2PMZA 4RVHA 3H0GI 3J81b 2OTL1 4NBGA 1YJ9Z 3CCE1 3JAMf 1W2BZ 5C4XI 3PO3S 5LL6f 3I561 1QVGY 3FQMA 1Q822 4NBAA 1M902 5IP7I 3J80f 1NP6A 3G71Z 1RNIA 3I4MI 1QVFZ 1YUAA 2LFUA 3GTQI 1Z03A 1TWFI 1K732 1Y1VS 3T4NB 2JA5I 3CC4Z 3IF8A 1TWCI 2IZ4A 1KRLA 2QR1B 1TWGI 2BJOA 4RVFA 1WCMI 5FLXb 2HU9A 5A2Qf 1K8A1 4A3II 4BXXI 1M901 2Q4ZA 4MD8A 1VQMZ 1VQL1 2K5RA 3IFUA 1VQ41 2IZ3A 2JNYA 2V3VA 3CCU1 4E33A 1Q7Y2 2DE5A 3NDJA 2QA4Z 1TWAI 1VQPZ 2E9HA 2E2HI 2OOYB 1X0TA 3NFZA 1Q861 3S16I 3CCUZ 4A3LI 3TDHB 2Y0SA 2B63I 3CCQZ 4E31A 1NJI2 3QWUA 1VQ81 1KQSZ 2OTJ1 4A3JI 2RBLA 1P9NA 2G2KA 4RVDA 2R6MA 1QF8A 2E2JI 3K7AI 3P5JB 3S1RI 2P3YA 1QVFY 1Y1VI 2QREB 2M48A 3CC41 3G6EZ 3NH4A 3S15I 2WAQA 5IT9f 1VQKZ 1VLAA 1WIIA 3CCS1 5FLMI 2JA7I 3HOWI 3D6WA 4HGZA 1M1K1 2I3CA 3FQQA 3U50C 2KPIA 1YIT1 1VQ8Z 3GCFA 3S2DI 4AYBA 1YJWZ 2JIRA 2JIQA 4RV9A 4MD7A 3I551 2QKDA 3CPWY 1VQLZ 1K83I 3S1QI 4NFRA 2H85A 1AA6A 1S721 1X3WA 1VQ6Z 2VUGA 3LUSA 3PO3I 3G6E1 3CCL1 3PO2I 3EEDA 3CCV1 4MH4A 3EERA 1Y1WI 2F4MA 1SFOI 3OW2Z 2OOXB 3CMEZ 2NVQI 3ESWA 4A3FI 4HH4A 2RPRA 1K9M1 3CCJ1 1Z02A
chains in the Genus database with same CATH topology
5CM2M 4RS4A 3CMAZ 3M4OI 3D9XA 3MZKB 3IX0A 4NBFA 3GTMS 2F4OA 1YJW1 3NDIA 2P28A 3KIHA 2RHBA 2V8IA 3I55Z 3GTJI 1ZH1A 1YJN1 1RO4A 3MZLB 3CCJZ 3HOYI 2QRDB 3HOXI 1TWHI 2GTHA 1NJI1 4DGLA 4BBSI 1YI2Z 4CL1A 1Q862 4MD9A 2OZKA 1L1OC 1VQ9Z 3I4NI 1LQLA 5T6BA 4BY1I 4DQYB 4NBBA 2OTJZ 1VQ7Z 3S1NI 3I07A 4A3DI 3TE5B 3F3FC 5IP9I 1RQFA 3GTPI 1RLYA 2O4HA 1VQ4Z 1VQNZ 3CCR1 4Y7NI 4TNUA 3GTOI 4A3GI 3NH5A 4X6AI 2EGTA 1VQ91 1N8R1 2YU9I 2AKLA 3OW2Y 3BG0B 1YJNZ 3CPWZ 2VF1A 3CC7Z 3KIFA 1VQ71 3CCSZ 2R93I 4NH1C 1VQM1 1W2BY 3J81f 5FLXf 2W03A 5C3EI 3CCM1 2QLVB 2RT9A 1VQ5Z 1VQO1 3HKZA 2DE6A 1YI21 3CMA1 1I6HI 2VUMI 2Q51A 1YJ91 3CD6Z 3CC2Z 4XX2A 1VQK1 2O53A 1PFTA 4E2ZA 3RZDI 3NH8A 1I50I 1YHQZ 4E2YA 4EWCA 3S1MI 3CXCY 1KD11 1VQN1 3CCRZ 4A3MI 2M6NA 4NBEA 1VQ51 1N8R2 3Q87A 1K731 1DL6A 2W04A 4NB9A 3CC21 3VMIA 4BBRI 1Q821 4A93I 5D1OB 2JA8I 1X3ZA 1K9M2 4BY7I 4NB8A 2YADA 3GTGI 2DE7A 3CCMZ 2ZAEB 1TFIA 3FKII 4A3EI 3CCLZ 4MONA 1R9TI 4QTUA 3HOZI 2QRCB 5C4JI 3GTKI 2GU2A 4NBHA 2RIQA 1QVGZ 4Y52I 4NOZA 2JA6I 3S17I 5IT9b 1ZB9A 2QA41 3VB9A 2K3RA 3BG1B 5T67A 1JWHC 2QEXZ 1VQP1 1RO2A 3VMGA 2NVTI 3S14I 4HGYA 3HOVI 3CME1 2PM9A 3G711 1ML8A 1S7MA 1RO0A 2PK7A 1VQOZ 3CXCZ 1YIJZ 3JAMb 3CD61 2OTLZ 2GTIA 5AN9F 2JUBA 3G4SZ 4A3CI 2R92I 1USPA 5T64A 1JJ2Y 4A3BI 2E2II 3HOUI 4E2WA 1KQSY 3MONA 4E2XA 1NUIA 2JMOA 3GTLI 2KI7B 1YITZ 3CCEZ 1WW9A 4E32A 3VMHA 1M1K2 3CCQ1 5A2Qb 3I56Z 5C44I 4MXUA 3VTNA 4RVGA 2HF1A 4NBCA 3J7A4 5D1OA 1Q811 3S2HI 3GTMI 4S1TA 2QEX1 1VQ61 2J6AA 2JS4A 5D1PA 4MRIA 3G4S1 2LIYA 3GKQA 1KC81 1JJ2Z 1ZB8A 3RZOI 2WB1A 1Q812 4DK1A 4A3KI 1K8A2 1I3QI 3F3PC 1YHQ1 1KC82 2V8JA 1S72Z 1Q7Y1 3M3YI 1KD12 3CCVZ 4E30A 1Z01A 1USPB 1YIJ1 2NVYI 1YUKA 2V8KA 2JR6A 3CQZI 4QTTA 3J80b 1N2FA 3CC71 3H3VJ 2NVXI 1QYPA 4NBDA 2R7ZI 2PMZA 4RVHA 3H0GI 3J81b 2OTL1 4NBGA 1YJ9Z 3CCE1 3JAMf 1W2BZ 5C4XI 3PO3S 5LL6f 3I561 1QVGY 3FQMA 1Q822 4NBAA 1M902 5IP7I 3J80f 1NP6A 3G71Z 1RNIA 3I4MI 1QVFZ 1YUAA 2LFUA 3GTQI 1Z03A 1TWFI 1K732 1Y1VS 3T4NB 2JA5I 3CC4Z 3IF8A 1TWCI 2IZ4A 1KRLA 2QR1B 1TWGI 2BJOA 4RVFA 1WCMI 5FLXb 2HU9A 5A2Qf 1K8A1 4A3II 4BXXI 1M901 2Q4ZA 4MD8A 1VQMZ 1VQL1 2K5RA 3IFUA 1VQ41 2IZ3A 2JNYA 3CCU1 1Q7Y2 4E33A 2DE5A 3NDJA 2QA4Z 1TWAI 1VQPZ 2E9HA 2E2HI 2OOYB 1X0TA 3NFZA 1Q861 3S16I 3CCUZ 4A3LI 3TDHB 2Y0SA 2B63I 3CCQZ 4E31A 1NJI2 3QWUA 1VQ81 1KQSZ 2OTJ1 4A3JI 2RBLA 1P9NA 2G2KA 4RVDA 2R6MA 1QF8A 2E2JI 3K7AI 3P5JB 3S1RI 2P3YA 1QVFY 1Y1VI 2QREB 2M48A 3CC41 3G6EZ 3NH4A 3S15I 2WAQA 5IT9f 1VQKZ 1VLAA 1WIIA 3CCS1 5FLMI 2JA7I 3HOWI 3D6WA 4HGZA 1M1K1 2I3CA 3FQQA 3U50C 2KPIA 1YIT1 1VQ8Z 3GCFA 3S2DI 4AYBA 1YJWZ 4RV9A 4MD7A 3I551 2QKDA 3CPWY 1VQLZ 1K83I 3S1QI 4NFRA 2H85A 1S721 1X3WA 1VQ6Z 2VUGA 3LUSA 3PO3I 3G6E1 3CCL1 3PO2I 3EEDA 3CCV1 4MH4A 3EERA 1Y1WI 2F4MA 1SFOI 3OW2Z 2OOXB 3CMEZ 2NVQI 3ESWA 4A3FI 4HH4A 2RPRA 1K9M1 3CCJ1 1Z02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 1;  1Q82 1;  1K9M 2;  3CMA Z;  2QEX 1;  1VQ6 1;  3G4S 1;  2QA4 Z;  3CCM Z;  1JJ2 Z;  1KC8 1;  1YJW 1;  1Q81 2;  1VQP Z;  1K8A 2;  3I55 Z;  3CCL Z;  1YJN 1;  1YHQ 1;  1Q86 1;  3CCU Z;  3CCJ Z;  1KC8 2;  1S72 Z;  1Q7Y 1;  3CCQ Z;  1NJI 2;  1NJI 1;  1KQS Z;  1VQ8 1;  1QVG Z;  2OTJ 1;  3CCJ 1;  1KD1 2;  3CCV Z;  1YIJ 1;  1YI2 Z;  1Q86 2;  2QA4 1;  1VQ9 Z;  2QEX Z;  1VQP 1;  1QVF Y;  3CC7 1;  2OTJ Z;  1VQ7 Z;  3CC4 1;  3G6E Z;  1VQK Z;  1VQ4 Z;  3CME 1;  1VQN Z;  3CCR 1;  3CCS 1;  3G71 1;  2OTL 1;  1YJ9 Z;  3CCE 1;  1VQ9 1;  1N8R 1;  1W2B Z;  1VQO Z;  3CXC Z;  3OW2 Y;  1YJN Z;  3I56 1;  1QVG Y;  1M1K 1;  3CPW Z;  1YIJ Z;  1Q82 2;  3CC7 Z;  1VQ7 1;  3CD6 1;  3CCS Z;  1M90 2;  1YIT 1;  3G71 Z;  1VQM 1;  2OTL Z;  1W2B Y;  1VQ8 Z;  3G4S Z;  3CCM 1;  1QVF Z;  1YJW Z;  1VQ5 Z;  1VQO 1;  3CMA 1;  1K73 2;  1YI2 1;  1JJ2 Y;  3CC4 Z;  3I55 1;  3CPW Y;  1VQL Z;  1YJ9 1;  3CD6 Z;  3CC2 Z;  1VQK 1;  1S72 1;  1KQS Y;  1VQ6 Z;  3G6E 1;  3CCL 1;  1K8A 1;  1YHQ Z;  1M90 1;  1YIT Z;  3CCE Z;  3CCV 1;  1VQM Z;  1VQL 1;  3CXC Y;  3OW2 Z;  1VQ4 1;  1M1K 2;  3CME Z;  3CCQ 1;  1KD1 1;  3CCR Z;  1VQN 1;  3I56 Z;  1VQ5 1;  1N8R 2;  1K9M 1;  3CCU 1;  1K73 1;  1Q7Y 2;  1Q81 1; 
#chains in the Genus database with same CATH topology
 5CM2 M;  4RS4 A;  3CMA Z;  3M4O I;  2NAP A;  2VPY A;  3D9X A;  3MZK B;  3IX0 A;  4NBF A;  3GTM S;  1SIW A;  2F4O A;  1YJW 1;  3NDI A;  2P28 A;  3KIH A;  2RHB A;  2V8I A;  3I55 Z;  3GTJ I;  1ZH1 A;  1YJN 1;  1Y8C A;  1RO4 A;  3MZL B;  3CCJ Z;  3HOY I;  2QRD B;  3HOX I;  1TWH I;  2GTH A;  1NJI 1;  4DGL A;  4BBS I;  1YI2 Z;  2JIO A;  4CL1 A;  1Q86 2;  4MD9 A;  2OZK A;  1L1O C;  1VQ9 Z;  3I4N I;  1LQL A;  5T6B A;  4BY1 I;  4DQY B;  4NBB A;  2OTJ Z;  1VQ7 Z;  3S1N I;  3I07 A;  4A3D I;  3TE5 B;  3F3F C;  5IP9 I;  1RQF A;  3GTP I;  1RLY A;  2O4H A;  1VQ4 Z;  1VQN Z;  3CCR 1;  4Y7N I;  4TNU A;  3GTO I;  4A3G I;  3NH5 A;  4X6A I;  2E7Z A;  2EGT A;  1VQ9 1;  1N8R 1;  2YU9 I;  2AKL A;  3OW2 Y;  3BG0 B;  1YJN Z;  3CPW Z;  2VF1 A;  3CC7 Z;  3KIF A;  1VQ7 1;  3CCS Z;  2R93 I;  4NH1 C;  1VQM 1;  2VPZ A;  1W2B Y;  3J81 f;  5FLX f;  2W03 A;  5C3E I;  3CCM 1;  2QLV B;  2RT9 A;  1VQ5 Z;  1VQO 1;  3HKZ A;  2DE6 A;  1YI2 1;  3CMA 1;  1I6H I;  2VUM I;  2Q51 A;  1YJ9 1;  3CD6 Z;  3CC2 Z;  4XX2 A;  1VQK 1;  2O53 A;  1PFT A;  4E2Z A;  3RZD I;  3NH8 A;  1I50 I;  1YHQ Z;  4E2Y A;  1Q16 A;  4EWC A;  3S1M I;  3CXC Y;  1KD1 1;  1VQN 1;  3CCR Z;  4A3M I;  2M6N A;  4NBE A;  1VQ5 1;  1N8R 2;  3Q87 A;  1K73 1;  1DL6 A;  2W04 A;  4NB9 A;  3CC2 1;  3VMI A;  4BBR I;  1Q82 1;  4A93 I;  5D1O B;  2JA8 I;  1X3Z A;  1K9M 2;  4BY7 I;  4NB8 A;  2LEX A;  2YAD A;  3GTG I;  2IV2 X;  2DE7 A;  3CCM Z;  2ZAE B;  1TFI A;  3FKI I;  4A3E I;  3CCL Z;  4MON A;  1R9T I;  4QTU A;  2JIM A;  3HOZ I;  2QRC B;  5C4J I;  3GTK I;  2GU2 A;  4NBH A;  1FDI A;  2AYD A;  2RIQ A;  1QVG Z;  4Y52 I;  4NOZ A;  2JA6 I;  3S17 I;  5IT9 b;  1ZB9 A;  2QA4 1;  3VB9 A;  2K3R A;  3BG1 B;  5T67 A;  1JWH C;  2QEX Z;  1VQP 1;  1RO2 A;  3VMG A;  2NVT I;  3S14 I;  4HGY A;  3HOV I;  3CME 1;  2PM9 A;  3G71 1;  1ML8 A;  1S7M A;  1RO0 A;  2PK7 A;  1FDO A;  1VQO Z;  3CXC Z;  1YIJ Z;  2VPX A;  3JAM b;  3CD6 1;  2OTL Z;  2GTI A;  5AN9 F;  2JUB A;  3G4S Z;  4A3C I;  2R92 I;  1USP A;  5T64 A;  1JJ2 Y;  4A3B I;  2E2I I;  3HOU I;  4E2W A;  1KQS Y;  3MON A;  4E2X A;  1NUI A;  2JMO A;  3GTL I;  2KI7 B;  1YIT Z;  3CCE Z;  1WW9 A;  4E32 A;  3VMH A;  1M1K 2;  3CCQ 1;  5A2Q b;  3I56 Z;  5C44 I;  2JIP A;  4MXU A;  3IR7 A;  3VTN A;  4RVG A;  2HF1 A;  4NBC A;  3J7A 4;  5D1O A;  2V45 A;  1Q81 1;  3S2H I;  3GTM I;  4S1T A;  2QEX 1;  1VQ6 1;  2J6A A;  2JS4 A;  5D1P A;  4MRI A;  3G4S 1;  2LIY A;  3GKQ A;  1KC8 1;  1JJ2 Z;  1ZB8 A;  1WZN A;  3RZO I;  2WB1 A;  1Q81 2;  4DK1 A;  4A3K I;  1K8A 2;  1I3Q I;  3F3P C;  1YHQ 1;  1KC8 2;  2V8J A;  1S72 Z;  1Q7Y 1;  1QXF A;  3M3Y I;  1KD1 2;  3CCV Z;  4E30 A;  1Z01 A;  1USP B;  1YIJ 1;  2NVY I;  1YUK A;  2V8K A;  2JR6 A;  3CQZ I;  4QTT A;  3J80 b;  1N2F A;  3CC7 1;  3D2L A;  1WJ2 A;  3H3V J;  2NVX I;  1QYP A;  4NBD A;  2VPW A;  2R7Z I;  2PMZ A;  4RVH A;  3H0G I;  3J81 b;  2OTL 1;  4NBG A;  1YJ9 Z;  3CCE 1;  3JAM f;  1W2B Z;  5C4X I;  3PO3 S;  5LL6 f;  3I56 1;  1QVG Y;  3FQM A;  1Q82 2;  4NBA A;  1M90 2;  5IP7 I;  3J80 f;  1NP6 A;  3G71 Z;  1RNI A;  3I4M I;  1QVF Z;  1YUA A;  2LFU A;  3GTQ I;  1Z03 A;  1TWF I;  1K73 2;  1Y1V S;  3T4N B;  2JA5 I;  3CC4 Z;  3IF8 A;  1TWC I;  2IZ4 A;  1KRL A;  2QR1 B;  1TWG I;  2BJO A;  4RVF A;  1WCM I;  5FLX b;  2HU9 A;  5A2Q f;  1K8A 1;  4A3I I;  4BXX I;  1M90 1;  2Q4Z A;  4MD8 A;  1VQM Z;  1VQL 1;  2K5R A;  3IFU A;  1VQ4 1;  2IZ3 A;  2JNY A;  2V3V A;  3CCU 1;  4E33 A;  1Q7Y 2;  2DE5 A;  3NDJ A;  2QA4 Z;  1TWA I;  1VQP Z;  2E9H A;  2E2H I;  2OOY B;  1X0T A;  3NFZ A;  1Q86 1;  3S16 I;  3CCU Z;  4A3L I;  3TDH B;  2Y0S A;  2B63 I;  3CCQ Z;  4E31 A;  1NJI 2;  3QWU A;  1VQ8 1;  1KQS Z;  2OTJ 1;  4A3J I;  2RBL A;  1P9N A;  2G2K A;  4RVD A;  2R6M A;  1QF8 A;  2E2J I;  3K7A I;  3P5J B;  3S1R I;  2P3Y A;  1QVF Y;  1Y1V I;  2QRE B;  2M48 A;  3CC4 1;  3G6E Z;  3NH4 A;  3S15 I;  2WAQ A;  5IT9 f;  1VQK Z;  1VLA A;  1WII A;  3CCS 1;  5FLM I;  2JA7 I;  3HOW I;  3D6W A;  4HGZ A;  1M1K 1;  2I3C A;  3FQQ A;  3U50 C;  2KPI A;  1YIT 1;  1VQ8 Z;  3GCF A;  3S2D I;  4AYB A;  1YJW Z;  2JIR A;  2JIQ A;  4RV9 A;  4MD7 A;  3I55 1;  2QKD A;  3CPW Y;  1VQL Z;  1K83 I;  3S1Q I;  4NFR A;  2H85 A;  1AA6 A;  1S72 1;  1X3W A;  1VQ6 Z;  2VUG A;  3LUS A;  3PO3 I;  3G6E 1;  3CCL 1;  3PO2 I;  3EED A;  3CCV 1;  4MH4 A;  3EER A;  1Y1W I;  2F4M A;  1SFO I;  3OW2 Z;  2OOX B;  3CME Z;  2NVQ I;  3ESW A;  4A3F I;  4HH4 A;  2RPR A;  1K9M 1;  3CCJ 1;  1Z02 A; 
#chains in the Genus database with same CATH homology
 5CM2 M;  4RS4 A;  3CMA Z;  3M4O I;  3D9X A;  3MZK B;  3IX0 A;  4NBF A;  3GTM S;  2F4O A;  1YJW 1;  3NDI A;  2P28 A;  3KIH A;  2RHB A;  2V8I A;  3I55 Z;  3GTJ I;  1ZH1 A;  1YJN 1;  1RO4 A;  3MZL B;  3CCJ Z;  3HOY I;  2QRD B;  3HOX I;  1TWH I;  2GTH A;  1NJI 1;  4DGL A;  4BBS I;  1YI2 Z;  4CL1 A;  1Q86 2;  4MD9 A;  2OZK A;  1L1O C;  1VQ9 Z;  3I4N I;  1LQL A;  5T6B A;  4BY1 I;  4DQY B;  4NBB A;  2OTJ Z;  1VQ7 Z;  3S1N I;  3I07 A;  4A3D I;  3TE5 B;  3F3F C;  5IP9 I;  1RQF A;  3GTP I;  1RLY A;  2O4H A;  1VQ4 Z;  1VQN Z;  3CCR 1;  4Y7N I;  4TNU A;  3GTO I;  4A3G I;  3NH5 A;  4X6A I;  2EGT A;  1VQ9 1;  1N8R 1;  2YU9 I;  2AKL A;  3OW2 Y;  3BG0 B;  1YJN Z;  3CPW Z;  2VF1 A;  3CC7 Z;  3KIF A;  1VQ7 1;  3CCS Z;  2R93 I;  4NH1 C;  1VQM 1;  1W2B Y;  3J81 f;  5FLX f;  2W03 A;  5C3E I;  3CCM 1;  2QLV B;  2RT9 A;  1VQ5 Z;  1VQO 1;  3HKZ A;  2DE6 A;  1YI2 1;  3CMA 1;  1I6H I;  2VUM I;  2Q51 A;  1YJ9 1;  3CD6 Z;  3CC2 Z;  4XX2 A;  1VQK 1;  2O53 A;  1PFT A;  4E2Z A;  3RZD I;  3NH8 A;  1I50 I;  1YHQ Z;  4E2Y A;  4EWC A;  3S1M I;  3CXC Y;  1KD1 1;  1VQN 1;  3CCR Z;  4A3M I;  2M6N A;  4NBE A;  1VQ5 1;  1N8R 2;  3Q87 A;  1K73 1;  1DL6 A;  2W04 A;  4NB9 A;  3CC2 1;  3VMI A;  4BBR I;  1Q82 1;  4A93 I;  5D1O B;  2JA8 I;  1X3Z A;  1K9M 2;  4BY7 I;  4NB8 A;  2YAD A;  3GTG I;  2DE7 A;  3CCM Z;  2ZAE B;  1TFI A;  3FKI I;  4A3E I;  3CCL Z;  4MON A;  1R9T I;  4QTU A;  3HOZ I;  2QRC B;  5C4J I;  3GTK I;  2GU2 A;  4NBH A;  2RIQ A;  1QVG Z;  4Y52 I;  4NOZ A;  2JA6 I;  3S17 I;  5IT9 b;  1ZB9 A;  2QA4 1;  3VB9 A;  2K3R A;  3BG1 B;  5T67 A;  1JWH C;  2QEX Z;  1VQP 1;  1RO2 A;  3VMG A;  2NVT I;  3S14 I;  4HGY A;  3HOV I;  3CME 1;  2PM9 A;  3G71 1;  1ML8 A;  1S7M A;  1RO0 A;  2PK7 A;  1VQO Z;  3CXC Z;  1YIJ Z;  3JAM b;  3CD6 1;  2OTL Z;  2GTI A;  5AN9 F;  2JUB A;  3G4S Z;  4A3C I;  2R92 I;  1USP A;  5T64 A;  1JJ2 Y;  4A3B I;  2E2I I;  3HOU I;  4E2W A;  1KQS Y;  3MON A;  4E2X A;  1NUI A;  2JMO A;  3GTL I;  2KI7 B;  1YIT Z;  3CCE Z;  1WW9 A;  4E32 A;  3VMH A;  1M1K 2;  3CCQ 1;  5A2Q b;  3I56 Z;  5C44 I;  4MXU A;  3VTN A;  4RVG A;  2HF1 A;  4NBC A;  3J7A 4;  5D1O A;  1Q81 1;  3S2H I;  3GTM I;  4S1T A;  2QEX 1;  1VQ6 1;  2J6A A;  2JS4 A;  5D1P A;  4MRI A;  3G4S 1;  2LIY A;  3GKQ A;  1KC8 1;  1JJ2 Z;  1ZB8 A;  3RZO I;  2WB1 A;  1Q81 2;  4DK1 A;  4A3K I;  1K8A 2;  1I3Q I;  3F3P C;  1YHQ 1;  1KC8 2;  2V8J A;  1S72 Z;  1Q7Y 1;  3M3Y I;  1KD1 2;  3CCV Z;  4E30 A;  1Z01 A;  1USP B;  1YIJ 1;  2NVY I;  1YUK A;  2V8K A;  2JR6 A;  3CQZ I;  4QTT A;  3J80 b;  1N2F A;  3CC7 1;  3H3V J;  2NVX I;  1QYP A;  4NBD A;  2R7Z I;  2PMZ A;  4RVH A;  3H0G I;  3J81 b;  2OTL 1;  4NBG A;  1YJ9 Z;  3CCE 1;  3JAM f;  1W2B Z;  5C4X I;  3PO3 S;  5LL6 f;  3I56 1;  1QVG Y;  3FQM A;  1Q82 2;  4NBA A;  1M90 2;  5IP7 I;  3J80 f;  1NP6 A;  3G71 Z;  1RNI A;  3I4M I;  1QVF Z;  1YUA A;  2LFU A;  3GTQ I;  1Z03 A;  1TWF I;  1K73 2;  1Y1V S;  3T4N B;  2JA5 I;  3CC4 Z;  3IF8 A;  1TWC I;  2IZ4 A;  1KRL A;  2QR1 B;  1TWG I;  2BJO A;  4RVF A;  1WCM I;  5FLX b;  2HU9 A;  5A2Q f;  1K8A 1;  4A3I I;  4BXX I;  1M90 1;  2Q4Z A;  4MD8 A;  1VQM Z;  1VQL 1;  2K5R A;  3IFU A;  1VQ4 1;  2IZ3 A;  2JNY A;  3CCU 1;  1Q7Y 2;  4E33 A;  2DE5 A;  3NDJ A;  2QA4 Z;  1TWA I;  1VQP Z;  2E9H A;  2E2H I;  2OOY B;  1X0T A;  3NFZ A;  1Q86 1;  3S16 I;  3CCU Z;  4A3L I;  3TDH B;  2Y0S A;  2B63 I;  3CCQ Z;  4E31 A;  1NJI 2;  3QWU A;  1VQ8 1;  1KQS Z;  2OTJ 1;  4A3J I;  2RBL A;  1P9N A;  2G2K A;  4RVD A;  2R6M A;  1QF8 A;  2E2J I;  3K7A I;  3P5J B;  3S1R I;  2P3Y A;  1QVF Y;  1Y1V I;  2QRE B;  2M48 A;  3CC4 1;  3G6E Z;  3NH4 A;  3S15 I;  2WAQ A;  5IT9 f;  1VQK Z;  1VLA A;  1WII A;  3CCS 1;  5FLM I;  2JA7 I;  3HOW I;  3D6W A;  4HGZ A;  1M1K 1;  2I3C A;  3FQQ A;  3U50 C;  2KPI A;  1YIT 1;  1VQ8 Z;  3GCF A;  3S2D I;  4AYB A;  1YJW Z;  4RV9 A;  4MD7 A;  3I55 1;  2QKD A;  3CPW Y;  1VQL Z;  1K83 I;  3S1Q I;  4NFR A;  2H85 A;  1S72 1;  1X3W A;  1VQ6 Z;  2VUG A;  3LUS A;  3PO3 I;  3G6E 1;  3CCL 1;  3PO2 I;  3EED A;  3CCV 1;  4MH4 A;  3EER A;  1Y1W I;  2F4M A;  1SFO I;  3OW2 Z;  2OOX B;  3CME Z;  2NVQ I;  3ESW A;  4A3F I;  4HH4 A;  2RPR A;  1K9M 1;  3CCJ 1;  1Z02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...