1YJWZ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjwZ00
3CCEZ 3CCM1 1Q861 1JJ2Z 1VQL1 3CCJZ 1VQ8Z 1VQ61 3CCS1 3I56Z 3CD6Z 3CCV1 1KC81 1YJ9Z 2QEXZ 3CCUZ 1KD12 3CXCY 2QA41 1M1K2 1VQ7Z 1YHQZ 1Q7Y2 3CCQ1 1VQKZ 1NJI1 3CCR1 1QVGY 1KC82 1VQO1 1M1K1 3CC21 1VQ41 3CCSZ 3I561 3CMAZ 2QEX1 1NJI2 1M902 1YJN1 3CCU1 3CMEZ 1Q862 1N8R2 1VQ9Z 1K8A1 1N8R1 3CPWZ 1YIJZ 3G71Z 3CCQZ 2OTLZ 1Q7Y1 1YI2Z 1VQOZ 3CC4Z 3G4S1 1VQN1 3OW2Y 3CCE1 3CCMZ 1VQLZ 3CCLZ 3CME1 1VQM1 3G6E1 3CCVZ 1YITZ 3G711 3I55Z 1JJ2Y 1M901 1K9M1 2QA4Z 2OTJ1 3CC41 1YHQ1 1VQP1 1KQSY 3CCRZ 1VQ81 1VQ6Z 1W2BY 3CD61 1VQ4Z 3CC7Z 1VQ5Z 3CCL1 1VQMZ 1Q811 1QVGZ 1YJWZ 3I551 1K9M2 1VQ91 3CPWY 2OTJZ 1YIJ1 1VQPZ 3CC2Z 2OTL1 1QVFZ 1S721 1Q822 3CMA1 3G4SZ 3CC71 1VQ51 1YJNZ 1KQSZ 1K8A2 3CCJ1 1K731 1Q812 1YJW1 1YJ91 3G6EZ 1W2BZ 3OW2Z 1KD11 1YI21 1YIT1 1VQ71 3CXCZ 1QVFY 1K732 1VQK1 1S72Z 1VQNZ 1Q821
chains in the Genus database with same CATH superfamily
3CCEZ 3GTLI 1VQL1 2KI7B 2QREB 3GTPI 3HKZA 3I56Z 1ZB8A 1YUKA 1RQFA 3GCFA 4E33A 2RIQA 3CXCY 1FDOA 1Q7Y2 4MH4A 3GTMI 4NFRA 1KC82 2Q51A 1X0TA 1WCMI 2V8JA 1L1OC 3CMAZ 2GU2A 3NH4A 3S16I 4RVGA 3J81f 1N8R2 3GTOI 3S15I 1RNIA 2BJOA 2LEXA 2I3CA 3G4S1 4NBCA 5IP7I 4RVHA 2QLVB 4RV9A 5C4XI 2JA7I 3S1QI 4A3LI 4MONA 1VQN1 3D9XA 4E2WA 2JS4A 1VQLZ 1X3ZA 1VQM1 2IZ4A 2AKLA 2V8KA 4MXUA 5C4JI 3MZLB 3G711 3U50C 3I55Z 1M901 2W03A 2JIQA 4DQYB 2OTJ1 2ZAEB 4BY1I 3MONA 3CCRZ 1VQ6Z 3KIFA 4NB8A 1VQMZ 3VTNA 1Z03A 1YJWZ 3FQQA 4NB9A 3GTMS 3I551 1Z02A 4E2ZA 5LL6f 3D2LA 5C3EI 1NUIA 2M6NA 4RVDA 2JIMA 3CMA1 3G4SZ 5A2Qf 1K8A2 2JUBA 4MD9A 1YJW1 1I50I 3PO3S 1W2BZ 4NBDA 1TWGI 2K5RA 1KD11 2R92I 2VUMI 1RO0A 1VQK1 3PO3I 3IF8A 5CM2M 1FDIA 4A3JI 2LFUA 3HOYI 1Y8CA 1VQ61 2DE6A 3M3YI 3NH8A 3S14I 2RHBA 1KC81 2WB1A 1I3QI 1VQ7Z 4BXXI 4E32A 5D1OA 2P3YA 3NH5A 1NJI1 4BBSI 3BG0B 3CCR1 1QVGY 1LQLA 2E7ZA 2HF1A 2V45A 5T64A 1VQ41 4E30A 3I561 2NAPA 1YJN1 2J6AA 3CMEZ 3NDJA 2AYDA 2OTLZ 2R7ZI 3S1RI 5IT9b 3CC4Z 4MD8A 4EWCA 2IZ3A 1Y1VS 2WAQA 4E2YA 3BG1B 5A2Qb 4A3II 3KIHA 3VMHA 3JAMb 2E2HI 3ESWA 2YU9I 1Y1VI 3G6E1 1TWFI 3CCVZ 5IT9f 3GTKI 2NVQI 3RZDI 4A93I 1JJ2Y 2V3VA 1K9M1 1RO4A 3CC41 1Z01A 1VQP1 3IR7A 2NVYI 3M4OI 1VQ81 2JA5I 1VQ4Z 3CC7Z 1VQ5Z 2PM9A 1Q811 2RPRA 2V8IA 4X6AI 1TFIA 3H3VJ 3TE5B 1VLAA 5D1OB 1N2FA 2OTJZ 2PK7A 1VQPZ 2OTL1 1QVFZ 4MD7A 2LIYA 2OOYB 3CC71 1VQ51 1YJNZ 2OZKA 3CCJ1 2GTIA 3HOWI 4NBEA 4BBRI 5C44I 1Q812 1NP6A 1YJ91 3G6EZ 5FLMI 1QVFY 3J81b 2F4OA 3FQMA 3HOXI 4MRIA 4HGYA 2PMZA 3S17I 3CCM1 1Q861 1JJ2Z 4E31A 3VB9A 1VQ8Z 3CCS1 2JA6I 1PFTA 2KPIA 4A3BI 3CCV1 2QEXZ 3CCUZ 2QA41 1M1K2 4HH4A 3J80f 4A3KI 3CCQ1 1VQKZ 2R93I 1VQO1 3CCSZ 2QEX1 1NJI2 3F3PC 4NBAA 1K8A1 1N8R1 3CCQZ 1Q7Y1 1TWCI 3I07A 1YI2Z 3D6WA 5D1PA 2K3RA 2YADA 2VUGA 4BY7I 3J7A4 2QKDA 2JNYA 3CCMZ 3J80b 3CME1 1YITZ 3EERA 2RBLA 2QA4Z 2IV2X 1YHQ1 2VPYA 3GTQI 3TDHB 2QRDB 3CD61 1Y1WI 4QTTA 3I4MI 1QXFA 4XX2A 4DK1A 1P9NA 1VQ91 3CPWY 5FLXf 1ZB9A 2E2II 3K7AI 3CC2Z 4A3EI 3I4NI 4Y7NI 2Q4ZA 1WJ2A 3T4NB 1K83I 1S721 3IX0A 2B63I 1K731 3P5JB 5FLXb 1QF8A 3FKII 2R6MA 2E9HA 2NVXI 5AN9F 4DGLA 2H85A 1YI21 1YIT1 3CXCZ 4A3DI 1AA6A 3MZKB 2GTHA 1ZH1A 2O4HA 3JAMf 3QWUA 3GTGI 1S72Z 4Y52I 1SFOI 5T6BA 4RS4A 2EGTA 3CCJZ 3HOUI 4NBGA 3CQZI 1TWHI 3CD6Z 2E2JI 1YJ9Z 2JMOA 1KD12 1S7MA 3RZOI 2VF1A 3GTJI 2O53A 4HGZA 1YHQZ 3S2HI 1ML8A 1M1K1 4NBFA 3CC21 4TNUA 3GKQA 1M902 3F3FC 4A3CI 4NOZA 2W04A 3CCU1 1Q862 2JR6A 1VQ9Z 2NVTI 3CPWZ 1YIJZ 3S1MI 1USPA 1X3WA 2DE5A 3G71Z 1KRLA 3NFZA 4AYBA 2JIOA 1VQOZ 1DL6A 4NBBA 3OW2Y 2Y0SA 3CCE1 1I6HI 3S1NI 3CCLZ 1QYPA 4A3MI 2JIPA 3NDIA 2VPXA 4E2XA 2F4MA 3IFUA 2RT9A 5T67A 1KQSY 2G2KA 2QRCB 2VPZA 1RLYA 3HOVI 2QR1B 1W2BY 3CCL1 5IP9I 3VMIA 1QVGZ 2P28A 1WZNA 1K9M2 1SIWA 2JIRA 1TWAI 1YIJ1 1WIIA 1Q16A 2M48A 4RVFA 4NH1C 1WW9A 4NBHA 1Q822 3EEDA 4A3GI 3VMGA 3H0GI 1KQSZ 1USPB 2VPWA 3PO2I 2OOXB 4CL1A 2DE7A 3HOZI 1YUAA 2JA8I 3OW2Z 1VQ71 3Q87A 4S1TA 4QTUA 1JWHC 1K732 4A3FI 2HU9A 1R9TI 3LUSA 3S2DI 1VQNZ 1RO2A 1Q821
chains in the Genus database with same CATH topology
3CCEZ 3GTLI 1VQL1 2KI7B 2QREB 3GTPI 3HKZA 3I56Z 1ZB8A 1YUKA 1RQFA 3GCFA 4E33A 2RIQA 3CXCY 1Q7Y2 4MH4A 3GTMI 4NFRA 1KC82 2Q51A 1X0TA 1WCMI 2V8JA 1L1OC 3CMAZ 2GU2A 3NH4A 3S16I 4RVGA 3J81f 1N8R2 3GTOI 3S15I 1RNIA 2BJOA 2I3CA 3G4S1 4NBCA 5IP7I 4RVHA 2QLVB 4RV9A 5C4XI 2JA7I 3S1QI 4A3LI 4MONA 1VQN1 3D9XA 4E2WA 2JS4A 1VQLZ 1X3ZA 1VQM1 2IZ4A 2AKLA 2V8KA 4MXUA 5C4JI 3MZLB 3G711 3U50C 3I55Z 1M901 2W03A 4DQYB 2OTJ1 2ZAEB 4BY1I 3MONA 3CCRZ 1VQ6Z 3KIFA 4NB8A 1VQMZ 3VTNA 1Z03A 1YJWZ 3FQQA 4NB9A 3GTMS 3I551 1Z02A 4E2ZA 5LL6f 5C3EI 1NUIA 2M6NA 4RVDA 3CMA1 3G4SZ 5A2Qf 1K8A2 2JUBA 4MD9A 1YJW1 1I50I 3PO3S 1W2BZ 4NBDA 1TWGI 2K5RA 1KD11 2R92I 2VUMI 1RO0A 1VQK1 3PO3I 3IF8A 5CM2M 4A3JI 2LFUA 3HOYI 1VQ61 2DE6A 3M3YI 3NH8A 3S14I 2RHBA 1KC81 2WB1A 1I3QI 1VQ7Z 4BXXI 4E32A 5D1OA 2P3YA 3NH5A 1NJI1 4BBSI 3BG0B 3CCR1 1QVGY 1LQLA 2HF1A 1VQ41 5T64A 4E30A 3I561 1YJN1 2J6AA 3CMEZ 3NDJA 2OTLZ 2R7ZI 3S1RI 5IT9b 3CC4Z 4MD8A 4EWCA 2IZ3A 1Y1VS 2WAQA 4E2YA 3BG1B 5A2Qb 4A3II 3KIHA 3VMHA 3JAMb 2E2HI 3ESWA 2YU9I 1Y1VI 3G6E1 1TWFI 3CCVZ 5IT9f 3GTKI 2NVQI 3RZDI 4A93I 1JJ2Y 1K9M1 1RO4A 3CC41 1Z01A 1VQP1 2NVYI 3M4OI 1VQ81 2JA5I 1VQ4Z 3CC7Z 1VQ5Z 2PM9A 1Q811 2RPRA 2V8IA 4X6AI 1TFIA 3H3VJ 3TE5B 1VLAA 5D1OB 1N2FA 2OTJZ 2PK7A 1VQPZ 2OTL1 1QVFZ 4MD7A 2LIYA 2OOYB 3CC71 1VQ51 1YJNZ 2OZKA 3CCJ1 2GTIA 3HOWI 4NBEA 4BBRI 5C44I 1Q812 1NP6A 1YJ91 3G6EZ 5FLMI 1QVFY 3J81b 2F4OA 3FQMA 3HOXI 4MRIA 4HGYA 2PMZA 3S17I 3CCM1 1Q861 1JJ2Z 4E31A 3VB9A 1VQ8Z 3CCS1 2JA6I 1PFTA 2KPIA 4A3BI 3CCV1 2QEXZ 3CCUZ 2QA41 1M1K2 4HH4A 3J80f 4A3KI 3CCQ1 1VQKZ 2R93I 1VQO1 3CCSZ 2QEX1 1NJI2 3F3PC 4NBAA 1K8A1 1N8R1 3CCQZ 1Q7Y1 1TWCI 3I07A 1YI2Z 3D6WA 5D1PA 2K3RA 2YADA 2VUGA 4BY7I 3J7A4 2QKDA 2JNYA 3CCMZ 3J80b 3CME1 1YITZ 3EERA 2RBLA 2QA4Z 1YHQ1 3GTQI 3TDHB 2QRDB 3CD61 1Y1WI 4QTTA 3I4MI 4XX2A 4DK1A 1P9NA 1VQ91 3CPWY 5FLXf 1ZB9A 2E2II 3K7AI 3CC2Z 4A3EI 3I4NI 4Y7NI 2Q4ZA 3T4NB 1K83I 1S721 3IX0A 2B63I 1K731 3P5JB 5FLXb 1QF8A 3FKII 2R6MA 2E9HA 2NVXI 5AN9F 4DGLA 2H85A 1YI21 1YIT1 3CXCZ 4A3DI 3MZKB 2GTHA 1ZH1A 2O4HA 3JAMf 3QWUA 3GTGI 1S72Z 4Y52I 1SFOI 5T6BA 4RS4A 2EGTA 3CCJZ 3HOUI 4NBGA 3CQZI 1TWHI 3CD6Z 2E2JI 1YJ9Z 2JMOA 1KD12 1S7MA 3RZOI 2VF1A 3GTJI 2O53A 4HGZA 1YHQZ 3S2HI 1ML8A 1M1K1 4NBFA 3CC21 4TNUA 3GKQA 1M902 3F3FC 4A3CI 4NOZA 2W04A 3CCU1 1Q862 2JR6A 1VQ9Z 2NVTI 3CPWZ 1YIJZ 3S1MI 1USPA 1X3WA 2DE5A 3G71Z 1KRLA 3NFZA 4AYBA 1VQOZ 1DL6A 4NBBA 3OW2Y 2Y0SA 3CCE1 1I6HI 3S1NI 3CCLZ 1QYPA 4A3MI 3NDIA 4E2XA 2F4MA 3IFUA 2RT9A 5T67A 1KQSY 2G2KA 2QRCB 1RLYA 3HOVI 2QR1B 1W2BY 3CCL1 5IP9I 3VMIA 1QVGZ 2P28A 1K9M2 1TWAI 1YIJ1 1WIIA 2M48A 4RVFA 4NH1C 1WW9A 4NBHA 1Q822 3EEDA 4A3GI 3VMGA 3H0GI 1KQSZ 1USPB 3PO2I 2OOXB 4CL1A 2DE7A 3HOZI 1YUAA 2JA8I 3OW2Z 1VQ71 3Q87A 4S1TA 4QTUA 1JWHC 1K732 4A3FI 1R9TI 2HU9A 3LUSA 3S2DI 1VQNZ 1RO2A 1Q821
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE Z;  3CCM 1;  1Q86 1;  1JJ2 Z;  1VQL 1;  3CCJ Z;  1VQ8 Z;  1VQ6 1;  3CCS 1;  3I56 Z;  3CD6 Z;  3CCV 1;  1KC8 1;  1YJ9 Z;  2QEX Z;  3CCU Z;  1KD1 2;  3CXC Y;  2QA4 1;  1M1K 2;  1VQ7 Z;  1YHQ Z;  1Q7Y 2;  3CCQ 1;  1VQK Z;  1NJI 1;  3CCR 1;  1QVG Y;  1KC8 2;  1VQO 1;  1M1K 1;  3CC2 1;  1VQ4 1;  3CCS Z;  3I56 1;  3CMA Z;  2QEX 1;  1NJI 2;  1M90 2;  1YJN 1;  3CCU 1;  3CME Z;  1Q86 2;  1N8R 2;  1VQ9 Z;  1K8A 1;  1N8R 1;  3CPW Z;  1YIJ Z;  3G71 Z;  3CCQ Z;  2OTL Z;  1Q7Y 1;  1YI2 Z;  1VQO Z;  3CC4 Z;  3G4S 1;  1VQN 1;  3OW2 Y;  3CCE 1;  3CCM Z;  1VQL Z;  3CCL Z;  3CME 1;  1VQM 1;  3G6E 1;  3CCV Z;  1YIT Z;  3G71 1;  3I55 Z;  1JJ2 Y;  1M90 1;  1K9M 1;  2QA4 Z;  2OTJ 1;  3CC4 1;  1YHQ 1;  1VQP 1;  1KQS Y;  3CCR Z;  1VQ8 1;  1VQ6 Z;  1W2B Y;  3CD6 1;  1VQ4 Z;  3CC7 Z;  1VQ5 Z;  3CCL 1;  1VQM Z;  1Q81 1;  1QVG Z;  1YJW Z;  3I55 1;  1K9M 2;  1VQ9 1;  3CPW Y;  2OTJ Z;  1YIJ 1;  1VQP Z;  3CC2 Z;  2OTL 1;  1QVF Z;  1S72 1;  1Q82 2;  3CMA 1;  3G4S Z;  3CC7 1;  1VQ5 1;  1YJN Z;  1KQS Z;  1K8A 2;  3CCJ 1;  1K73 1;  1Q81 2;  1YJW 1;  1YJ9 1;  3G6E Z;  1W2B Z;  3OW2 Z;  1KD1 1;  1YI2 1;  1YIT 1;  1VQ7 1;  3CXC Z;  1QVF Y;  1K73 2;  1VQK 1;  1S72 Z;  1VQN Z;  1Q82 1; 
#chains in the Genus database with same CATH topology
 3CCE Z;  3GTL I;  1VQL 1;  2KI7 B;  2QRE B;  3GTP I;  3HKZ A;  3I56 Z;  1ZB8 A;  1YUK A;  1RQF A;  3GCF A;  4E33 A;  2RIQ A;  3CXC Y;  1FDO A;  1Q7Y 2;  4MH4 A;  3GTM I;  4NFR A;  1KC8 2;  2Q51 A;  1X0T A;  1WCM I;  2V8J A;  1L1O C;  3CMA Z;  2GU2 A;  3NH4 A;  3S16 I;  4RVG A;  3J81 f;  1N8R 2;  3GTO I;  3S15 I;  1RNI A;  2BJO A;  2LEX A;  2I3C A;  3G4S 1;  4NBC A;  5IP7 I;  4RVH A;  2QLV B;  4RV9 A;  5C4X I;  2JA7 I;  3S1Q I;  4A3L I;  4MON A;  1VQN 1;  3D9X A;  4E2W A;  2JS4 A;  1VQL Z;  1X3Z A;  1VQM 1;  2IZ4 A;  2AKL A;  2V8K A;  4MXU A;  5C4J I;  3MZL B;  3G71 1;  3U50 C;  3I55 Z;  1M90 1;  2W03 A;  2JIQ A;  4DQY B;  2OTJ 1;  2ZAE B;  4BY1 I;  3MON A;  3CCR Z;  1VQ6 Z;  3KIF A;  4NB8 A;  1VQM Z;  3VTN A;  1Z03 A;  1YJW Z;  3FQQ A;  4NB9 A;  3GTM S;  3I55 1;  1Z02 A;  4E2Z A;  5LL6 f;  3D2L A;  5C3E I;  1NUI A;  2M6N A;  4RVD A;  2JIM A;  3CMA 1;  3G4S Z;  5A2Q f;  1K8A 2;  2JUB A;  4MD9 A;  1YJW 1;  1I50 I;  3PO3 S;  1W2B Z;  4NBD A;  1TWG I;  2K5R A;  1KD1 1;  2R92 I;  2VUM I;  1RO0 A;  1VQK 1;  3PO3 I;  3IF8 A;  5CM2 M;  1FDI A;  4A3J I;  2LFU A;  3HOY I;  1Y8C A;  1VQ6 1;  2DE6 A;  3M3Y I;  3NH8 A;  3S14 I;  2RHB A;  1KC8 1;  2WB1 A;  1I3Q I;  1VQ7 Z;  4BXX I;  4E32 A;  5D1O A;  2P3Y A;  3NH5 A;  1NJI 1;  4BBS I;  3BG0 B;  3CCR 1;  1QVG Y;  1LQL A;  2E7Z A;  2HF1 A;  2V45 A;  5T64 A;  1VQ4 1;  4E30 A;  3I56 1;  2NAP A;  1YJN 1;  2J6A A;  3CME Z;  3NDJ A;  2AYD A;  2OTL Z;  2R7Z I;  3S1R I;  5IT9 b;  3CC4 Z;  4MD8 A;  4EWC A;  2IZ3 A;  1Y1V S;  2WAQ A;  4E2Y A;  3BG1 B;  5A2Q b;  4A3I I;  3KIH A;  3VMH A;  3JAM b;  2E2H I;  3ESW A;  2YU9 I;  1Y1V I;  3G6E 1;  1TWF I;  3CCV Z;  5IT9 f;  3GTK I;  2NVQ I;  3RZD I;  4A93 I;  1JJ2 Y;  2V3V A;  1K9M 1;  1RO4 A;  3CC4 1;  1Z01 A;  1VQP 1;  3IR7 A;  2NVY I;  3M4O I;  1VQ8 1;  2JA5 I;  1VQ4 Z;  3CC7 Z;  1VQ5 Z;  2PM9 A;  1Q81 1;  2RPR A;  2V8I A;  4X6A I;  1TFI A;  3H3V J;  3TE5 B;  1VLA A;  5D1O B;  1N2F A;  2OTJ Z;  2PK7 A;  1VQP Z;  2OTL 1;  1QVF Z;  4MD7 A;  2LIY A;  2OOY B;  3CC7 1;  1VQ5 1;  1YJN Z;  2OZK A;  3CCJ 1;  2GTI A;  3HOW I;  4NBE A;  4BBR I;  5C44 I;  1Q81 2;  1NP6 A;  1YJ9 1;  3G6E Z;  5FLM I;  1QVF Y;  3J81 b;  2F4O A;  3FQM A;  3HOX I;  4MRI A;  4HGY A;  2PMZ A;  3S17 I;  3CCM 1;  1Q86 1;  1JJ2 Z;  4E31 A;  3VB9 A;  1VQ8 Z;  3CCS 1;  2JA6 I;  1PFT A;  2KPI A;  4A3B I;  3CCV 1;  2QEX Z;  3CCU Z;  2QA4 1;  1M1K 2;  4HH4 A;  3J80 f;  4A3K I;  3CCQ 1;  1VQK Z;  2R93 I;  1VQO 1;  3CCS Z;  2QEX 1;  1NJI 2;  3F3P C;  4NBA A;  1K8A 1;  1N8R 1;  3CCQ Z;  1Q7Y 1;  1TWC I;  3I07 A;  1YI2 Z;  3D6W A;  5D1P A;  2K3R A;  2YAD A;  2VUG A;  4BY7 I;  3J7A 4;  2QKD A;  2JNY A;  3CCM Z;  3J80 b;  3CME 1;  1YIT Z;  3EER A;  2RBL A;  2QA4 Z;  2IV2 X;  1YHQ 1;  2VPY A;  3GTQ I;  3TDH B;  2QRD B;  3CD6 1;  1Y1W I;  4QTT A;  3I4M I;  1QXF A;  4XX2 A;  4DK1 A;  1P9N A;  1VQ9 1;  3CPW Y;  5FLX f;  1ZB9 A;  2E2I I;  3K7A I;  3CC2 Z;  4A3E I;  3I4N I;  4Y7N I;  2Q4Z A;  1WJ2 A;  3T4N B;  1K83 I;  1S72 1;  3IX0 A;  2B63 I;  1K73 1;  3P5J B;  5FLX b;  1QF8 A;  3FKI I;  2R6M A;  2E9H A;  2NVX I;  5AN9 F;  4DGL A;  2H85 A;  1YI2 1;  1YIT 1;  3CXC Z;  4A3D I;  1AA6 A;  3MZK B;  2GTH A;  1ZH1 A;  2O4H A;  3JAM f;  3QWU A;  3GTG I;  1S72 Z;  4Y52 I;  1SFO I;  5T6B A;  4RS4 A;  2EGT A;  3CCJ Z;  3HOU I;  4NBG A;  3CQZ I;  1TWH I;  3CD6 Z;  2E2J I;  1YJ9 Z;  2JMO A;  1KD1 2;  1S7M A;  3RZO I;  2VF1 A;  3GTJ I;  2O53 A;  4HGZ A;  1YHQ Z;  3S2H I;  1ML8 A;  1M1K 1;  4NBF A;  3CC2 1;  4TNU A;  3GKQ A;  1M90 2;  3F3F C;  4A3C I;  4NOZ A;  2W04 A;  3CCU 1;  1Q86 2;  2JR6 A;  1VQ9 Z;  2NVT I;  3CPW Z;  1YIJ Z;  3S1M I;  1USP A;  1X3W A;  2DE5 A;  3G71 Z;  1KRL A;  3NFZ A;  4AYB A;  2JIO A;  1VQO Z;  1DL6 A;  4NBB A;  3OW2 Y;  2Y0S A;  3CCE 1;  1I6H I;  3S1N I;  3CCL Z;  1QYP A;  4A3M I;  2JIP A;  3NDI A;  2VPX A;  4E2X A;  2F4M A;  3IFU A;  2RT9 A;  5T67 A;  1KQS Y;  2G2K A;  2QRC B;  2VPZ A;  1RLY A;  3HOV I;  2QR1 B;  1W2B Y;  3CCL 1;  5IP9 I;  3VMI A;  1QVG Z;  2P28 A;  1WZN A;  1K9M 2;  1SIW A;  2JIR A;  1TWA I;  1YIJ 1;  1WII A;  1Q16 A;  2M48 A;  4RVF A;  4NH1 C;  1WW9 A;  4NBH A;  1Q82 2;  3EED A;  4A3G I;  3VMG A;  3H0G I;  1KQS Z;  1USP B;  2VPW A;  3PO2 I;  2OOX B;  4CL1 A;  2DE7 A;  3HOZ I;  1YUA A;  2JA8 I;  3OW2 Z;  1VQ7 1;  3Q87 A;  4S1T A;  4QTU A;  1JWH C;  1K73 2;  4A3F I;  2HU9 A;  1R9T I;  3LUS A;  3S2D I;  1VQN Z;  1RO2 A;  1Q82 1; 
#chains in the Genus database with same CATH homology
 3CCE Z;  3GTL I;  1VQL 1;  2KI7 B;  2QRE B;  3GTP I;  3HKZ A;  3I56 Z;  1ZB8 A;  1YUK A;  1RQF A;  3GCF A;  4E33 A;  2RIQ A;  3CXC Y;  1Q7Y 2;  4MH4 A;  3GTM I;  4NFR A;  1KC8 2;  2Q51 A;  1X0T A;  1WCM I;  2V8J A;  1L1O C;  3CMA Z;  2GU2 A;  3NH4 A;  3S16 I;  4RVG A;  3J81 f;  1N8R 2;  3GTO I;  3S15 I;  1RNI A;  2BJO A;  2I3C A;  3G4S 1;  4NBC A;  5IP7 I;  4RVH A;  2QLV B;  4RV9 A;  5C4X I;  2JA7 I;  3S1Q I;  4A3L I;  4MON A;  1VQN 1;  3D9X A;  4E2W A;  2JS4 A;  1VQL Z;  1X3Z A;  1VQM 1;  2IZ4 A;  2AKL A;  2V8K A;  4MXU A;  5C4J I;  3MZL B;  3G71 1;  3U50 C;  3I55 Z;  1M90 1;  2W03 A;  4DQY B;  2OTJ 1;  2ZAE B;  4BY1 I;  3MON A;  3CCR Z;  1VQ6 Z;  3KIF A;  4NB8 A;  1VQM Z;  3VTN A;  1Z03 A;  1YJW Z;  3FQQ A;  4NB9 A;  3GTM S;  3I55 1;  1Z02 A;  4E2Z A;  5LL6 f;  5C3E I;  1NUI A;  2M6N A;  4RVD A;  3CMA 1;  3G4S Z;  5A2Q f;  1K8A 2;  2JUB A;  4MD9 A;  1YJW 1;  1I50 I;  3PO3 S;  1W2B Z;  4NBD A;  1TWG I;  2K5R A;  1KD1 1;  2R92 I;  2VUM I;  1RO0 A;  1VQK 1;  3PO3 I;  3IF8 A;  5CM2 M;  4A3J I;  2LFU A;  3HOY I;  1VQ6 1;  2DE6 A;  3M3Y I;  3NH8 A;  3S14 I;  2RHB A;  1KC8 1;  2WB1 A;  1I3Q I;  1VQ7 Z;  4BXX I;  4E32 A;  5D1O A;  2P3Y A;  3NH5 A;  1NJI 1;  4BBS I;  3BG0 B;  3CCR 1;  1QVG Y;  1LQL A;  2HF1 A;  1VQ4 1;  5T64 A;  4E30 A;  3I56 1;  1YJN 1;  2J6A A;  3CME Z;  3NDJ A;  2OTL Z;  2R7Z I;  3S1R I;  5IT9 b;  3CC4 Z;  4MD8 A;  4EWC A;  2IZ3 A;  1Y1V S;  2WAQ A;  4E2Y A;  3BG1 B;  5A2Q b;  4A3I I;  3KIH A;  3VMH A;  3JAM b;  2E2H I;  3ESW A;  2YU9 I;  1Y1V I;  3G6E 1;  1TWF I;  3CCV Z;  5IT9 f;  3GTK I;  2NVQ I;  3RZD I;  4A93 I;  1JJ2 Y;  1K9M 1;  1RO4 A;  3CC4 1;  1Z01 A;  1VQP 1;  2NVY I;  3M4O I;  1VQ8 1;  2JA5 I;  1VQ4 Z;  3CC7 Z;  1VQ5 Z;  2PM9 A;  1Q81 1;  2RPR A;  2V8I A;  4X6A I;  1TFI A;  3H3V J;  3TE5 B;  1VLA A;  5D1O B;  1N2F A;  2OTJ Z;  2PK7 A;  1VQP Z;  2OTL 1;  1QVF Z;  4MD7 A;  2LIY A;  2OOY B;  3CC7 1;  1VQ5 1;  1YJN Z;  2OZK A;  3CCJ 1;  2GTI A;  3HOW I;  4NBE A;  4BBR I;  5C44 I;  1Q81 2;  1NP6 A;  1YJ9 1;  3G6E Z;  5FLM I;  1QVF Y;  3J81 b;  2F4O A;  3FQM A;  3HOX I;  4MRI A;  4HGY A;  2PMZ A;  3S17 I;  3CCM 1;  1Q86 1;  1JJ2 Z;  4E31 A;  3VB9 A;  1VQ8 Z;  3CCS 1;  2JA6 I;  1PFT A;  2KPI A;  4A3B I;  3CCV 1;  2QEX Z;  3CCU Z;  2QA4 1;  1M1K 2;  4HH4 A;  3J80 f;  4A3K I;  3CCQ 1;  1VQK Z;  2R93 I;  1VQO 1;  3CCS Z;  2QEX 1;  1NJI 2;  3F3P C;  4NBA A;  1K8A 1;  1N8R 1;  3CCQ Z;  1Q7Y 1;  1TWC I;  3I07 A;  1YI2 Z;  3D6W A;  5D1P A;  2K3R A;  2YAD A;  2VUG A;  4BY7 I;  3J7A 4;  2QKD A;  2JNY A;  3CCM Z;  3J80 b;  3CME 1;  1YIT Z;  3EER A;  2RBL A;  2QA4 Z;  1YHQ 1;  3GTQ I;  3TDH B;  2QRD B;  3CD6 1;  1Y1W I;  4QTT A;  3I4M I;  4XX2 A;  4DK1 A;  1P9N A;  1VQ9 1;  3CPW Y;  5FLX f;  1ZB9 A;  2E2I I;  3K7A I;  3CC2 Z;  4A3E I;  3I4N I;  4Y7N I;  2Q4Z A;  3T4N B;  1K83 I;  1S72 1;  3IX0 A;  2B63 I;  1K73 1;  3P5J B;  5FLX b;  1QF8 A;  3FKI I;  2R6M A;  2E9H A;  2NVX I;  5AN9 F;  4DGL A;  2H85 A;  1YI2 1;  1YIT 1;  3CXC Z;  4A3D I;  3MZK B;  2GTH A;  1ZH1 A;  2O4H A;  3JAM f;  3QWU A;  3GTG I;  1S72 Z;  4Y52 I;  1SFO I;  5T6B A;  4RS4 A;  2EGT A;  3CCJ Z;  3HOU I;  4NBG A;  3CQZ I;  1TWH I;  3CD6 Z;  2E2J I;  1YJ9 Z;  2JMO A;  1KD1 2;  1S7M A;  3RZO I;  2VF1 A;  3GTJ I;  2O53 A;  4HGZ A;  1YHQ Z;  3S2H I;  1ML8 A;  1M1K 1;  4NBF A;  3CC2 1;  4TNU A;  3GKQ A;  1M90 2;  3F3F C;  4A3C I;  4NOZ A;  2W04 A;  3CCU 1;  1Q86 2;  2JR6 A;  1VQ9 Z;  2NVT I;  3CPW Z;  1YIJ Z;  3S1M I;  1USP A;  1X3W A;  2DE5 A;  3G71 Z;  1KRL A;  3NFZ A;  4AYB A;  1VQO Z;  1DL6 A;  4NBB A;  3OW2 Y;  2Y0S A;  3CCE 1;  1I6H I;  3S1N I;  3CCL Z;  1QYP A;  4A3M I;  3NDI A;  4E2X A;  2F4M A;  3IFU A;  2RT9 A;  5T67 A;  1KQS Y;  2G2K A;  2QRC B;  1RLY A;  3HOV I;  2QR1 B;  1W2B Y;  3CCL 1;  5IP9 I;  3VMI A;  1QVG Z;  2P28 A;  1K9M 2;  1TWA I;  1YIJ 1;  1WII A;  2M48 A;  4RVF A;  4NH1 C;  1WW9 A;  4NBH A;  1Q82 2;  3EED A;  4A3G I;  3VMG A;  3H0G I;  1KQS Z;  1USP B;  3PO2 I;  2OOX B;  4CL1 A;  2DE7 A;  3HOZ I;  1YUA A;  2JA8 I;  3OW2 Z;  1VQ7 1;  3Q87 A;  4S1T A;  4QTU A;  1JWH C;  1K73 2;  4A3F I;  1R9T I;  2HU9 A;  3LUS A;  3S2D I;  1VQN Z;  1RO2 A;  1Q82 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...