1YJWZ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjwZ00
1VQMZ 3CPWY 3CPWZ 1VQ5Z 1M1K2 1VQ41 3CCS1 3G4S1 2QA41 3CMA1 3CCUZ 1Q7Y2 3CCV1 3CC71 1Q861 2QA4Z 1KQSY 3CME1 1KQSZ 3CCVZ 1YJ9Z 1VQ7Z 3CMEZ 2QEX1 1KD12 1Q862 1W2BY 2QEXZ 1W2BZ 1VQN1 2OTLZ 1JJ2Y 1JJ2Z 1K8A1 1VQ4Z 1YIJ1 3CCSZ 3G4SZ 3CMAZ 1YIJZ 3CCR1 3CC7Z 3CCJ1 1K8A2 3CCRZ 3CC21 1VQP1 3CCJZ 3I551 2OTJ1 1YJN1 3CC2Z 1VQPZ 3CC41 3I55Z 2OTJZ 1YJNZ 3OW2Y 3OW2Z 1VQNZ 3G6E1 3CCE1 1VQO1 1YJW1 1VQ61 1K9M1 1QVFY 1YHQ1 1QVFZ 1VQL1 3CCEZ 3G711 1VQOZ 1YJWZ 1VQLZ 1VQ91 3G71Z 1YIT1 3CCL1 1K731 1M1K1 3CCM1 1VQM1 1K9M2 1VQ9Z 1YITZ 3CCLZ 1S721 1Q7Y1 3CD61 3CCMZ 1Q821 3CXCY 3CXCZ 1S72Z 3CCQ1 1KC81 1QVGY 3CCU1 3CD6Z 1K732 1QVGZ 1M901 3CCQZ 2OTL1 1KD11 3CC4Z 1YJ91 1Q822 1VQ71 1Q811 1YI21 1NJI1 1KC82 3G6EZ 1N8R1 1VQK1 1VQ6Z 1M902 1VQ81 1YHQZ 3I561 1YI2Z 1VQKZ 1VQ8Z 3I56Z 1Q812 1NJI2 1VQ51 1N8R2
chains in the Genus database with same CATH superfamily
4DGLA 3GTOI 3VMGA 4NFRA 2RPRA 2M6NA 3K7AI 1USPB 3MZLB 3GTJI 3CMA1 1WZNA 5LL6f 2JA8I 3HOXI 1Q861 4Y52I 3VMIA 1QXFA 3D9XA 2QEXZ 4RS4A 1QF8A 2QR1B 1L1OC 4A3LI 3I07A 4NBFA 2R6MA 4MONA 3S1MI 3P5JB 1Z01A 2M48A 3CMAZ 2VPZA 5D1PA 4BY7I 1USPA 4E32A 2RIQA 3FKII 2J6AA 1TWHI 2JR6A 3CCRZ 3S1NI 3CCJZ 2OTJ1 3S1RI 3I55Z 2JA6I 2V45A 3T4NB 1P9NA 4RVFA 2NVTI 4QTTA 2WB1A 1ZB8A 4NOZA 4MXUA 1WJ2A 5C4XI 2W03A 2K5RA 4BBRI 1VQM1 3S14I 4QTUA 1YITZ 3EEDA 1Q7Y1 1TFIA 1Y8CA 1YUAA 2VF1A 3CXCY 3CXCZ 1S72Z 3ESWA 3CCQ1 2W04A 3CCU1 1QVGY 3CQZI 1K732 1QVGZ 5T6BA 4E30A 2KI7B 4RVDA 2E7ZA 1WIIA 2QKDA 4XX2A 1ML8A 1VQK1 3HOUI 5IT9b 3J81f 3VB9A 2QREB 3KIFA 4A3EI 2JIMA 4MD9A 1NJI2 4NBAA 1VQMZ 4RVGA 1JWHC 2RHBA 3CPWY 3GTGI 3CPWZ 3TDHB 1Z02A 2BJOA 3IX0A 4A3BI 1VQ41 1I3QI 3LUSA 4BBSI 1ZB9A 1SIWA 4E2WA 3CCUZ 2JUBA 1KQSY 1KQSZ 3CCVZ 2AKLA 2QEX1 2Q51A 1RO0A 1KD12 1Y1WI 2F4MA 2B63I 3HOYI 2LFUA 2PMZA 1VQ51 1Q862 3GTLI 3D6WA 4MRIA 1X3ZA 4A3FI 5IT9f 3S15I 2PM9A 1Y1VS 3M3YI 4E33A 1VQ4Z 3GKQA 2Y0SA 1Y1VI 2JNYA 2JMOA 1YIJZ 3CCR1 2OOXB 2E2JI 3CCJ1 2VUMI 3I551 2JA5I 4MD8A 2DE6A 3CC2Z 1VQPZ 3PO3S 4NBEA 1YJNZ 3I4MI 5AN9F 3G6E1 2JIRA 1VQ61 2I3CA 3J7A4 3HKZA 1X3WA 4S1TA 2KPIA 3PO3I 1VLAA 3MONA 3CCEZ 3EERA 1TWCI 1VQLZ 3S1QI 1WW9A 3G71Z 1YIT1 2V3VA 1ZH1A 4A3KI 2P28A 3NDJA 1VQ9Z 1S721 2IV2X 1KC81 3CD6Z 1NP6A 3S16I 2JS4A 3J81b 2G2KA 2DE5A 3HOZI 1VQ71 5C44I 1Q811 2NVXI 2R7ZI 4A3CI 3G6EZ 5FLXb 1N8R1 1VQ6Z 2JIQA 5CM2M 1YI2Z 5T64A 3FQMA 1VQ8Z 2WAQA 2QRDB 3U50C 1I6HI 2F4OA 1RO2A 1X0TA 4AYBA 2LIYA 1M1K2 4E2XA 3IF8A 2RT9A 1Z03A 4EWCA 3G4S1 2YADA 3S17I 3NH8A 3CCV1 3NDIA 3CC71 1YUKA 4NBBA 1TWAI 2QA4Z 1SFOI 2JIPA 2IZ4A 3RZOI 1VQ7Z 3S2DI 3CMEZ 2NAPA 3TE5B 5FLXf 2H85A 4NH1C 4BXXI 3JAMb 4NB9A 3J80b 2GTHA 1JJ2Y 1JJ2Z 1K8A1 1YIJ1 3G4SZ 3CC7Z 4TNUA 3IR7A 3VMHA 2NVQI 2JIOA 2DE7A 3CC21 1VQP1 1R9TI 1DL6A 1YJN1 2NVYI 2PK7A 1K83I 4A3GI 3CC41 2E2II 3GTPI 4BY1I 1WCMI 4DQYB 2GU2A 3CCE1 4HGYA 1K9M1 1QVFY 1YHQ1 1QVFZ 1VQL1 5A2Qb 3G711 1VQOZ 1YJWZ 2QRCB 1VQ91 3H3VJ 3JAMf 4X6AI 3J80f 2R92I 4Y7NI 3GTKI 3NH5A 2ZAEB 3PO2I 3CCLZ 4NBGA 3CD61 1AA6A 2RBLA 3CCMZ 2O53A 1Q821 2V8JA 3S2HI 3H0GI 4DK1A 1M901 2VPXA 5T67A 2P3YA 1RNIA 1KD11 3CC4Z 1YJ91 4RV9A 5IP7I 1YI21 1KC82 1VQ81 4HGZA 1YHQZ 3QWUA 4E2YA 2V8KA 2HU9A 1RLYA 3I56Z 1Q812 2VPWA 4CL1A 4A93I 5A2Qf 1N8R2 2OTL1 5D1OB 2V8IA 2VPYA 2O4HA 1VQ5Z 5C3EI 1FDOA 3I4NI 3CCS1 3RZDI 2QA41 1Q7Y2 4NBCA 1RO4A 3CME1 3BG1B 1YJ9Z 4NB8A 4MD7A 5C4JI 4NBDA 3HOVI 2EGTA 1S7MA 1W2BY 1RQFA 5FLMI 1W2BZ 1VQN1 3M4OI 1KRLA 2OTLZ 2OZKA 2QLVB 4RVHA 5D1OA 3CCSZ 4MH4A 2K3RA 1TWGI 3D2LA 1K8A2 3VTNA 4A3MI 2HF1A 4NBHA 3BG0B 2AYDA 2Q4ZA 2JA7I 2R93I 2OTJZ 4HH4A 1QYPA 3OW2Y 4A3JI 3OW2Z 1VQNZ 1VQO1 1YJW1 2E2HI 3F3PC 1NUIA 4E2ZA 1FDIA 2OOYB 3Q87A 5IP9I 3HOWI 3CCL1 1K731 1M1K1 4A3DI 3GCFA 3CCM1 3F3FC 1K9M2 3FQQA 3KIHA 3NFZA 3GTMS 1N2FA 1LQLA 3MZKB 1I50I 3CCQZ 2LEXA 3IFUA 2GTIA 1Q822 2YU9I 1NJI1 3GTMI 4A3II 1M902 3NH4A 3I561 1TWFI 2IZ3A 1VQKZ 1PFTA 2E9HA 4E31A 1Q16A 3GTQI 2VUGA
chains in the Genus database with same CATH topology
4DGLA 3GTOI 3VMGA 4NFRA 2RPRA 2M6NA 3K7AI 1USPB 3MZLB 3GTJI 3CMA1 2JA8I 5LL6f 3HOXI 1Q861 4Y52I 3VMIA 3D9XA 2QEXZ 4RS4A 1QF8A 2QR1B 1L1OC 4A3LI 3I07A 4NBFA 2R6MA 4MONA 3S1MI 3P5JB 1Z01A 2M48A 3CMAZ 5D1PA 4BY7I 1USPA 4E32A 2RIQA 3FKII 2J6AA 1TWHI 2JR6A 3CCRZ 3S1NI 3CCJZ 2OTJ1 3S1RI 3I55Z 2JA6I 3T4NB 1P9NA 4RVFA 2NVTI 4QTTA 2WB1A 1ZB8A 4NOZA 4MXUA 5C4XI 2W03A 2K5RA 4BBRI 1VQM1 3S14I 4QTUA 1YITZ 3EEDA 1Q7Y1 1TFIA 1YUAA 2VF1A 3CXCY 3CXCZ 1S72Z 3ESWA 3CCQ1 2W04A 3CCU1 1QVGY 3CQZI 1K732 1QVGZ 5T6BA 4E30A 2KI7B 4RVDA 1WIIA 2QKDA 4XX2A 1ML8A 1VQK1 3HOUI 5IT9b 3J81f 3VB9A 2QREB 3KIFA 4A3EI 1NJI2 4MD9A 4NBAA 1VQMZ 4RVGA 1JWHC 2RHBA 3CPWY 3GTGI 3CPWZ 3TDHB 1Z02A 2BJOA 3IX0A 4A3BI 1VQ41 1I3QI 3LUSA 4BBSI 1ZB9A 4E2WA 3CCUZ 2JUBA 1KQSY 1KQSZ 3CCVZ 2AKLA 2QEX1 2Q51A 1RO0A 1KD12 1Y1WI 2F4MA 2B63I 3HOYI 2LFUA 2PMZA 1Q862 3GTLI 3D6WA 4MRIA 1X3ZA 4A3FI 5IT9f 3S15I 2PM9A 1Y1VS 3M3YI 4E33A 1VQ4Z 3GKQA 2Y0SA 1Y1VI 2JNYA 2JMOA 1YIJZ 3CCR1 2OOXB 2E2JI 3CCJ1 2VUMI 3I551 2JA5I 4MD8A 2DE6A 3CC2Z 1VQPZ 3PO3S 4NBEA 1YJNZ 3I4MI 5AN9F 3G6E1 1VQ61 2I3CA 3J7A4 3HKZA 1X3WA 4S1TA 2KPIA 3PO3I 1VLAA 3MONA 3CCEZ 3EERA 1TWCI 1VQLZ 3S1QI 1WW9A 3G71Z 1YIT1 1ZH1A 4A3KI 2P28A 3NDJA 1VQ9Z 1S721 1KC81 3CD6Z 1NP6A 3S16I 2JS4A 3J81b 2G2KA 2DE5A 3HOZI 1VQ71 5C44I 1Q811 2NVXI 2R7ZI 4A3CI 3G6EZ 5FLXb 1N8R1 1VQ6Z 5CM2M 1YI2Z 5T64A 3FQMA 1VQ8Z 2WAQA 2QRDB 3U50C 1I6HI 2F4OA 1RO2A 1X0TA 4AYBA 2LIYA 1M1K2 4E2XA 3IF8A 2RT9A 1Z03A 4EWCA 3G4S1 2YADA 3S17I 3NH8A 3CCV1 3NDIA 3CC71 1YUKA 4NBBA 1TWAI 2QA4Z 1SFOI 2IZ4A 3RZOI 1VQ7Z 3S2DI 3CMEZ 3TE5B 5FLXf 2H85A 4NH1C 4BXXI 3JAMb 4NB9A 3J80b 2GTHA 1JJ2Y 1JJ2Z 1K8A1 1YIJ1 3G4SZ 3CC7Z 4TNUA 3VMHA 2NVQI 2DE7A 3CC21 1VQP1 1R9TI 1DL6A 1YJN1 2NVYI 2PK7A 1K83I 4A3GI 3CC41 2E2II 3GTPI 4BY1I 1WCMI 4DQYB 2GU2A 3CCE1 4HGYA 1K9M1 1QVFY 1YHQ1 1QVFZ 1VQL1 5A2Qb 3G711 1VQOZ 1YJWZ 2QRCB 1VQ91 3H3VJ 3JAMf 4X6AI 3J80f 2R92I 4Y7NI 3GTKI 3NH5A 2ZAEB 3PO2I 3CCLZ 4NBGA 3CD61 3CCMZ 2RBLA 1Q821 2O53A 2V8JA 3S2HI 3H0GI 4DK1A 1M901 5T67A 2P3YA 1RNIA 1KD11 3CC4Z 2VUGA 1YJ91 4RV9A 5IP7I 1YI21 1KC82 1VQ81 4HGZA 1YHQZ 3QWUA 4E2YA 2V8KA 2HU9A 1RLYA 3I56Z 1Q812 4CL1A 4A93I 5A2Qf 1N8R2 2OTL1 5D1OB 2V8IA 2O4HA 1VQ5Z 5C3EI 3I4NI 3CCS1 3RZDI 2QA41 1Q7Y2 4NBCA 1RO4A 3CME1 3BG1B 1YJ9Z 4NB8A 4MD7A 5C4JI 4NBDA 3HOVI 2EGTA 1S7MA 1W2BY 1RQFA 5FLMI 1W2BZ 1VQN1 3M4OI 1KRLA 2OTLZ 2OZKA 2QLVB 4RVHA 5D1OA 3CCSZ 4MH4A 2K3RA 1TWGI 1K8A2 3VTNA 4A3MI 2HF1A 4NBHA 3BG0B 2Q4ZA 2JA7I 2R93I 2OTJZ 4HH4A 1QYPA 3OW2Y 4A3JI 3OW2Z 1VQNZ 1VQO1 1YJW1 2E2HI 3F3PC 1NUIA 4E2ZA 2OOYB 3Q87A 5IP9I 3HOWI 3CCL1 1K731 1M1K1 4A3DI 3GCFA 3CCM1 3F3FC 1K9M2 3FQQA 3KIHA 3NFZA 3GTMS 1N2FA 1LQLA 3MZKB 1I50I 3CCQZ 3IFUA 2GTIA 1Q822 2YU9I 1NJI1 3GTMI 4A3II 1M902 3NH4A 3I561 1TWFI 2IZ3A 1VQKZ 1PFTA 2E9HA 4E31A 3GTQI 1VQ51
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM Z;  3CPW Y;  3CPW Z;  1VQ5 Z;  1M1K 2;  1VQ4 1;  3CCS 1;  3G4S 1;  2QA4 1;  3CMA 1;  3CCU Z;  1Q7Y 2;  3CCV 1;  3CC7 1;  1Q86 1;  2QA4 Z;  1KQS Y;  3CME 1;  1KQS Z;  3CCV Z;  1YJ9 Z;  1VQ7 Z;  3CME Z;  2QEX 1;  1KD1 2;  1Q86 2;  1W2B Y;  2QEX Z;  1W2B Z;  1VQN 1;  2OTL Z;  1JJ2 Y;  1JJ2 Z;  1K8A 1;  1VQ4 Z;  1YIJ 1;  3CCS Z;  3G4S Z;  3CMA Z;  1YIJ Z;  3CCR 1;  3CC7 Z;  3CCJ 1;  1K8A 2;  3CCR Z;  3CC2 1;  1VQP 1;  3CCJ Z;  3I55 1;  2OTJ 1;  1YJN 1;  3CC2 Z;  1VQP Z;  3CC4 1;  3I55 Z;  2OTJ Z;  1YJN Z;  3OW2 Y;  3OW2 Z;  1VQN Z;  3G6E 1;  3CCE 1;  1VQO 1;  1YJW 1;  1VQ6 1;  1K9M 1;  1QVF Y;  1YHQ 1;  1QVF Z;  1VQL 1;  3CCE Z;  3G71 1;  1VQO Z;  1YJW Z;  1VQL Z;  1VQ9 1;  3G71 Z;  1YIT 1;  3CCL 1;  1K73 1;  1M1K 1;  3CCM 1;  1VQM 1;  1K9M 2;  1VQ9 Z;  1YIT Z;  3CCL Z;  1S72 1;  1Q7Y 1;  3CD6 1;  3CCM Z;  1Q82 1;  3CXC Y;  3CXC Z;  1S72 Z;  3CCQ 1;  1KC8 1;  1QVG Y;  3CCU 1;  3CD6 Z;  1K73 2;  1QVG Z;  1M90 1;  3CCQ Z;  2OTL 1;  1KD1 1;  3CC4 Z;  1YJ9 1;  1Q82 2;  1VQ7 1;  1Q81 1;  1YI2 1;  1NJI 1;  1KC8 2;  3G6E Z;  1N8R 1;  1VQK 1;  1VQ6 Z;  1M90 2;  1VQ8 1;  1YHQ Z;  3I56 1;  1YI2 Z;  1VQK Z;  1VQ8 Z;  3I56 Z;  1Q81 2;  1NJI 2;  1VQ5 1;  1N8R 2; 
#chains in the Genus database with same CATH topology
 4DGL A;  3GTO I;  3VMG A;  4NFR A;  2RPR A;  2M6N A;  3K7A I;  1USP B;  3MZL B;  3GTJ I;  3CMA 1;  1WZN A;  5LL6 f;  2JA8 I;  3HOX I;  1Q86 1;  4Y52 I;  3VMI A;  1QXF A;  3D9X A;  2QEX Z;  4RS4 A;  1QF8 A;  2QR1 B;  1L1O C;  4A3L I;  3I07 A;  4NBF A;  2R6M A;  4MON A;  3S1M I;  3P5J B;  1Z01 A;  2M48 A;  3CMA Z;  2VPZ A;  5D1P A;  4BY7 I;  1USP A;  4E32 A;  2RIQ A;  3FKI I;  2J6A A;  1TWH I;  2JR6 A;  3CCR Z;  3S1N I;  3CCJ Z;  2OTJ 1;  3S1R I;  3I55 Z;  2JA6 I;  2V45 A;  3T4N B;  1P9N A;  4RVF A;  2NVT I;  4QTT A;  2WB1 A;  1ZB8 A;  4NOZ A;  4MXU A;  1WJ2 A;  5C4X I;  2W03 A;  2K5R A;  4BBR I;  1VQM 1;  3S14 I;  4QTU A;  1YIT Z;  3EED A;  1Q7Y 1;  1TFI A;  1Y8C A;  1YUA A;  2VF1 A;  3CXC Y;  3CXC Z;  1S72 Z;  3ESW A;  3CCQ 1;  2W04 A;  3CCU 1;  1QVG Y;  3CQZ I;  1K73 2;  1QVG Z;  5T6B A;  4E30 A;  2KI7 B;  4RVD A;  2E7Z A;  1WII A;  2QKD A;  4XX2 A;  1ML8 A;  1VQK 1;  3HOU I;  5IT9 b;  3J81 f;  3VB9 A;  2QRE B;  3KIF A;  4A3E I;  2JIM A;  4MD9 A;  1NJI 2;  4NBA A;  1VQM Z;  4RVG A;  1JWH C;  2RHB A;  3CPW Y;  3GTG I;  3CPW Z;  3TDH B;  1Z02 A;  2BJO A;  3IX0 A;  4A3B I;  1VQ4 1;  1I3Q I;  3LUS A;  4BBS I;  1ZB9 A;  1SIW A;  4E2W A;  3CCU Z;  2JUB A;  1KQS Y;  1KQS Z;  3CCV Z;  2AKL A;  2QEX 1;  2Q51 A;  1RO0 A;  1KD1 2;  1Y1W I;  2F4M A;  2B63 I;  3HOY I;  2LFU A;  2PMZ A;  1VQ5 1;  1Q86 2;  3GTL I;  3D6W A;  4MRI A;  1X3Z A;  4A3F I;  5IT9 f;  3S15 I;  2PM9 A;  1Y1V S;  3M3Y I;  4E33 A;  1VQ4 Z;  3GKQ A;  2Y0S A;  1Y1V I;  2JNY A;  2JMO A;  1YIJ Z;  3CCR 1;  2OOX B;  2E2J I;  3CCJ 1;  2VUM I;  3I55 1;  2JA5 I;  4MD8 A;  2DE6 A;  3CC2 Z;  1VQP Z;  3PO3 S;  4NBE A;  1YJN Z;  3I4M I;  5AN9 F;  3G6E 1;  2JIR A;  1VQ6 1;  2I3C A;  3J7A 4;  3HKZ A;  1X3W A;  4S1T A;  2KPI A;  3PO3 I;  1VLA A;  3MON A;  3CCE Z;  3EER A;  1TWC I;  1VQL Z;  3S1Q I;  1WW9 A;  3G71 Z;  1YIT 1;  2V3V A;  1ZH1 A;  4A3K I;  2P28 A;  3NDJ A;  1VQ9 Z;  1S72 1;  2IV2 X;  1KC8 1;  3CD6 Z;  1NP6 A;  3S16 I;  2JS4 A;  3J81 b;  2G2K A;  2DE5 A;  3HOZ I;  1VQ7 1;  5C44 I;  1Q81 1;  2NVX I;  2R7Z I;  4A3C I;  3G6E Z;  5FLX b;  1N8R 1;  1VQ6 Z;  2JIQ A;  5CM2 M;  1YI2 Z;  5T64 A;  3FQM A;  1VQ8 Z;  2WAQ A;  2QRD B;  3U50 C;  1I6H I;  2F4O A;  1RO2 A;  1X0T A;  4AYB A;  2LIY A;  1M1K 2;  4E2X A;  3IF8 A;  2RT9 A;  1Z03 A;  4EWC A;  3G4S 1;  2YAD A;  3S17 I;  3NH8 A;  3CCV 1;  3NDI A;  3CC7 1;  1YUK A;  4NBB A;  1TWA I;  2QA4 Z;  1SFO I;  2JIP A;  2IZ4 A;  3RZO I;  1VQ7 Z;  3S2D I;  3CME Z;  2NAP A;  3TE5 B;  5FLX f;  2H85 A;  4NH1 C;  4BXX I;  3JAM b;  4NB9 A;  3J80 b;  2GTH A;  1JJ2 Y;  1JJ2 Z;  1K8A 1;  1YIJ 1;  3G4S Z;  3CC7 Z;  4TNU A;  3IR7 A;  3VMH A;  2NVQ I;  2JIO A;  2DE7 A;  3CC2 1;  1VQP 1;  1R9T I;  1DL6 A;  1YJN 1;  2NVY I;  2PK7 A;  1K83 I;  4A3G I;  3CC4 1;  2E2I I;  3GTP I;  4BY1 I;  1WCM I;  4DQY B;  2GU2 A;  3CCE 1;  4HGY A;  1K9M 1;  1QVF Y;  1YHQ 1;  1QVF Z;  1VQL 1;  5A2Q b;  3G71 1;  1VQO Z;  1YJW Z;  2QRC B;  1VQ9 1;  3H3V J;  3JAM f;  4X6A I;  3J80 f;  2R92 I;  4Y7N I;  3GTK I;  3NH5 A;  2ZAE B;  3PO2 I;  3CCL Z;  4NBG A;  3CD6 1;  1AA6 A;  2RBL A;  3CCM Z;  2O53 A;  1Q82 1;  2V8J A;  3S2H I;  3H0G I;  4DK1 A;  1M90 1;  2VPX A;  5T67 A;  2P3Y A;  1RNI A;  1KD1 1;  3CC4 Z;  1YJ9 1;  4RV9 A;  5IP7 I;  1YI2 1;  1KC8 2;  1VQ8 1;  4HGZ A;  1YHQ Z;  3QWU A;  4E2Y A;  2V8K A;  2HU9 A;  1RLY A;  3I56 Z;  1Q81 2;  2VPW A;  4CL1 A;  4A93 I;  5A2Q f;  1N8R 2;  2OTL 1;  5D1O B;  2V8I A;  2VPY A;  2O4H A;  1VQ5 Z;  5C3E I;  1FDO A;  3I4N I;  3CCS 1;  3RZD I;  2QA4 1;  1Q7Y 2;  4NBC A;  1RO4 A;  3CME 1;  3BG1 B;  1YJ9 Z;  4NB8 A;  4MD7 A;  5C4J I;  4NBD A;  3HOV I;  2EGT A;  1S7M A;  1W2B Y;  1RQF A;  5FLM I;  1W2B Z;  1VQN 1;  3M4O I;  1KRL A;  2OTL Z;  2OZK A;  2QLV B;  4RVH A;  5D1O A;  3CCS Z;  4MH4 A;  2K3R A;  1TWG I;  3D2L A;  1K8A 2;  3VTN A;  4A3M I;  2HF1 A;  4NBH A;  3BG0 B;  2AYD A;  2Q4Z A;  2JA7 I;  2R93 I;  2OTJ Z;  4HH4 A;  1QYP A;  3OW2 Y;  4A3J I;  3OW2 Z;  1VQN Z;  1VQO 1;  1YJW 1;  2E2H I;  3F3P C;  1NUI A;  4E2Z A;  1FDI A;  2OOY B;  3Q87 A;  5IP9 I;  3HOW I;  3CCL 1;  1K73 1;  1M1K 1;  4A3D I;  3GCF A;  3CCM 1;  3F3F C;  1K9M 2;  3FQQ A;  3KIH A;  3NFZ A;  3GTM S;  1N2F A;  1LQL A;  3MZK B;  1I50 I;  3CCQ Z;  2LEX A;  3IFU A;  2GTI A;  1Q82 2;  2YU9 I;  1NJI 1;  3GTM I;  4A3I I;  1M90 2;  3NH4 A;  3I56 1;  1TWF I;  2IZ3 A;  1VQK Z;  1PFT A;  2E9H A;  4E31 A;  1Q16 A;  3GTQ I;  2VUG A; 
#chains in the Genus database with same CATH homology
 4DGL A;  3GTO I;  3VMG A;  4NFR A;  2RPR A;  2M6N A;  3K7A I;  1USP B;  3MZL B;  3GTJ I;  3CMA 1;  2JA8 I;  5LL6 f;  3HOX I;  1Q86 1;  4Y52 I;  3VMI A;  3D9X A;  2QEX Z;  4RS4 A;  1QF8 A;  2QR1 B;  1L1O C;  4A3L I;  3I07 A;  4NBF A;  2R6M A;  4MON A;  3S1M I;  3P5J B;  1Z01 A;  2M48 A;  3CMA Z;  5D1P A;  4BY7 I;  1USP A;  4E32 A;  2RIQ A;  3FKI I;  2J6A A;  1TWH I;  2JR6 A;  3CCR Z;  3S1N I;  3CCJ Z;  2OTJ 1;  3S1R I;  3I55 Z;  2JA6 I;  3T4N B;  1P9N A;  4RVF A;  2NVT I;  4QTT A;  2WB1 A;  1ZB8 A;  4NOZ A;  4MXU A;  5C4X I;  2W03 A;  2K5R A;  4BBR I;  1VQM 1;  3S14 I;  4QTU A;  1YIT Z;  3EED A;  1Q7Y 1;  1TFI A;  1YUA A;  2VF1 A;  3CXC Y;  3CXC Z;  1S72 Z;  3ESW A;  3CCQ 1;  2W04 A;  3CCU 1;  1QVG Y;  3CQZ I;  1K73 2;  1QVG Z;  5T6B A;  4E30 A;  2KI7 B;  4RVD A;  1WII A;  2QKD A;  4XX2 A;  1ML8 A;  1VQK 1;  3HOU I;  5IT9 b;  3J81 f;  3VB9 A;  2QRE B;  3KIF A;  4A3E I;  1NJI 2;  4MD9 A;  4NBA A;  1VQM Z;  4RVG A;  1JWH C;  2RHB A;  3CPW Y;  3GTG I;  3CPW Z;  3TDH B;  1Z02 A;  2BJO A;  3IX0 A;  4A3B I;  1VQ4 1;  1I3Q I;  3LUS A;  4BBS I;  1ZB9 A;  4E2W A;  3CCU Z;  2JUB A;  1KQS Y;  1KQS Z;  3CCV Z;  2AKL A;  2QEX 1;  2Q51 A;  1RO0 A;  1KD1 2;  1Y1W I;  2F4M A;  2B63 I;  3HOY I;  2LFU A;  2PMZ A;  1Q86 2;  3GTL I;  3D6W A;  4MRI A;  1X3Z A;  4A3F I;  5IT9 f;  3S15 I;  2PM9 A;  1Y1V S;  3M3Y I;  4E33 A;  1VQ4 Z;  3GKQ A;  2Y0S A;  1Y1V I;  2JNY A;  2JMO A;  1YIJ Z;  3CCR 1;  2OOX B;  2E2J I;  3CCJ 1;  2VUM I;  3I55 1;  2JA5 I;  4MD8 A;  2DE6 A;  3CC2 Z;  1VQP Z;  3PO3 S;  4NBE A;  1YJN Z;  3I4M I;  5AN9 F;  3G6E 1;  1VQ6 1;  2I3C A;  3J7A 4;  3HKZ A;  1X3W A;  4S1T A;  2KPI A;  3PO3 I;  1VLA A;  3MON A;  3CCE Z;  3EER A;  1TWC I;  1VQL Z;  3S1Q I;  1WW9 A;  3G71 Z;  1YIT 1;  1ZH1 A;  4A3K I;  2P28 A;  3NDJ A;  1VQ9 Z;  1S72 1;  1KC8 1;  3CD6 Z;  1NP6 A;  3S16 I;  2JS4 A;  3J81 b;  2G2K A;  2DE5 A;  3HOZ I;  1VQ7 1;  5C44 I;  1Q81 1;  2NVX I;  2R7Z I;  4A3C I;  3G6E Z;  5FLX b;  1N8R 1;  1VQ6 Z;  5CM2 M;  1YI2 Z;  5T64 A;  3FQM A;  1VQ8 Z;  2WAQ A;  2QRD B;  3U50 C;  1I6H I;  2F4O A;  1RO2 A;  1X0T A;  4AYB A;  2LIY A;  1M1K 2;  4E2X A;  3IF8 A;  2RT9 A;  1Z03 A;  4EWC A;  3G4S 1;  2YAD A;  3S17 I;  3NH8 A;  3CCV 1;  3NDI A;  3CC7 1;  1YUK A;  4NBB A;  1TWA I;  2QA4 Z;  1SFO I;  2IZ4 A;  3RZO I;  1VQ7 Z;  3S2D I;  3CME Z;  3TE5 B;  5FLX f;  2H85 A;  4NH1 C;  4BXX I;  3JAM b;  4NB9 A;  3J80 b;  2GTH A;  1JJ2 Y;  1JJ2 Z;  1K8A 1;  1YIJ 1;  3G4S Z;  3CC7 Z;  4TNU A;  3VMH A;  2NVQ I;  2DE7 A;  3CC2 1;  1VQP 1;  1R9T I;  1DL6 A;  1YJN 1;  2NVY I;  2PK7 A;  1K83 I;  4A3G I;  3CC4 1;  2E2I I;  3GTP I;  4BY1 I;  1WCM I;  4DQY B;  2GU2 A;  3CCE 1;  4HGY A;  1K9M 1;  1QVF Y;  1YHQ 1;  1QVF Z;  1VQL 1;  5A2Q b;  3G71 1;  1VQO Z;  1YJW Z;  2QRC B;  1VQ9 1;  3H3V J;  3JAM f;  4X6A I;  3J80 f;  2R92 I;  4Y7N I;  3GTK I;  3NH5 A;  2ZAE B;  3PO2 I;  3CCL Z;  4NBG A;  3CD6 1;  3CCM Z;  2RBL A;  1Q82 1;  2O53 A;  2V8J A;  3S2H I;  3H0G I;  4DK1 A;  1M90 1;  5T67 A;  2P3Y A;  1RNI A;  1KD1 1;  3CC4 Z;  2VUG A;  1YJ9 1;  4RV9 A;  5IP7 I;  1YI2 1;  1KC8 2;  1VQ8 1;  4HGZ A;  1YHQ Z;  3QWU A;  4E2Y A;  2V8K A;  2HU9 A;  1RLY A;  3I56 Z;  1Q81 2;  4CL1 A;  4A93 I;  5A2Q f;  1N8R 2;  2OTL 1;  5D1O B;  2V8I A;  2O4H A;  1VQ5 Z;  5C3E I;  3I4N I;  3CCS 1;  3RZD I;  2QA4 1;  1Q7Y 2;  4NBC A;  1RO4 A;  3CME 1;  3BG1 B;  1YJ9 Z;  4NB8 A;  4MD7 A;  5C4J I;  4NBD A;  3HOV I;  2EGT A;  1S7M A;  1W2B Y;  1RQF A;  5FLM I;  1W2B Z;  1VQN 1;  3M4O I;  1KRL A;  2OTL Z;  2OZK A;  2QLV B;  4RVH A;  5D1O A;  3CCS Z;  4MH4 A;  2K3R A;  1TWG I;  1K8A 2;  3VTN A;  4A3M I;  2HF1 A;  4NBH A;  3BG0 B;  2Q4Z A;  2JA7 I;  2R93 I;  2OTJ Z;  4HH4 A;  1QYP A;  3OW2 Y;  4A3J I;  3OW2 Z;  1VQN Z;  1VQO 1;  1YJW 1;  2E2H I;  3F3P C;  1NUI A;  4E2Z A;  2OOY B;  3Q87 A;  5IP9 I;  3HOW I;  3CCL 1;  1K73 1;  1M1K 1;  4A3D I;  3GCF A;  3CCM 1;  3F3F C;  1K9M 2;  3FQQ A;  3KIH A;  3NFZ A;  3GTM S;  1N2F A;  1LQL A;  3MZK B;  1I50 I;  3CCQ Z;  3IFU A;  2GTI A;  1Q82 2;  2YU9 I;  1NJI 1;  3GTM I;  4A3I I;  1M90 2;  3NH4 A;  3I56 1;  1TWF I;  2IZ3 A;  1VQK Z;  1PFT A;  2E9H A;  4E31 A;  3GTQ I;  1VQ5 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...