1YJWZ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjwZ00
3CCS1 2OTL1 3CCMZ 2QA41 1YJW1 3CCJZ 1N8R1 1K731 1Q862 3CCLZ 1VQ41 1S72Z 3G6EZ 3I551 1VQ81 1YJNZ 3CCJ1 3CME1 3CC7Z 3CCV1 3CCSZ 3G4SZ 1KC82 3CC41 2QA4Z 2QEX1 1VQL1 1NJI2 3G711 1VQ4Z 3CCE1 3G4S1 1VQP1 3I55Z 1VQ8Z 3CMEZ 1Q821 3CCVZ 1M902 1VQ61 3CXCZ 1Q7Y2 1JJ2Z 3CC4Z 2QEXZ 1YJ91 1VQLZ 3G71Z 3CC2Z 3CCEZ 1QVGY 1YHQZ 1VQN1 3CD61 1M1K1 1KQSZ 1VQ9Z 1VQPZ 1VQ71 1QVFZ 1K9M2 1VQ6Z 1VQK1 3CC21 1YHQ1 1YJ9Z 1Q861 1Q7Y1 1VQ91 1W2BZ 1YIT1 3CCRZ 3CPWZ 1YI21 1K732 2OTJZ 1KD12 1VQNZ 1VQO1 3CCQZ 1KQSY 3OW2Z 3CC71 1VQ7Z 1Q812 1KC81 3CCR1 1VQKZ 1VQ51 1NJI1 3CCQ1 1YITZ 1YI2Z 3I56Z 1K8A2 3CXCY 1VQOZ 1VQMZ 3OW2Y 1JJ2Y 1M901 1YIJZ 1KD11 3CCU1 2OTJ1 1N8R2 1VQ5Z 1Q822 3I561 1Q811 3CMAZ 3CCM1 1VQM1 1YIJ1 3CD6Z 1QVFY 2OTLZ 3CCL1 1S721 1YJWZ 1K9M1 3G6E1 3CMA1 1K8A1 1M1K2 1YJN1 3CCUZ 1W2BY 3CPWY 1QVGZ
chains in the Genus database with same CATH superfamily
2R6MA 2OTL1 2R7ZI 1TFIA 3NDJA 1FDOA 1FDIA 2VPXA 1Q862 3CCLZ 1S72Z 5D1OB 3PO2I 2V8JA 5T67A 5IP9I 1VQ81 1YJNZ 3CCV1 4NH1C 3D6WA 3FKII 2M6NA 3H0GI 3F3PC 3H3VJ 1NJI2 1RQFA 3EERA 2K5RA 1TWHI 3CCE1 3D9XA 3G4S1 1VQP1 1VQ8Z 1RNIA 2O4HA 3CCVZ 1VQ61 3S16I 2LEXA 3I4NI 4RV9A 1P9NA 2PMZA 3QWUA 4DK1A 3F3FC 1Y8CA 3CC2Z 3CCEZ 1M1K1 3MONA 1KQSZ 1VQPZ 1VQ71 2DE6A 1VQ6Z 2W04A 4NBBA 4Y7NI 2G2KA 5C4XI 1YI21 1K732 2JIOA 2R92I 1ZH1A 3CCQZ 3OW2Z 1VQ7Z 3J7A4 1RO4A 5A2Qb 1VQ51 4DGLA 3CPWY 4A3GI 3I56Z 1YI2Z 1I3QI 1TWAI 2DE5A 3CXCY 3MZLB 3IX0A 1YIJZ 3GCFA 5C3EI 2IZ4A 4NBGA 2JMOA 2JIPA 3GTJI 4A3MI 2HF1A 1VQ5Z 2K3RA 2NVTI 3CCM1 2VPYA 4DQYB 3S1MI 5C44I 2RBLA 1X0TA 3JAMb 1K9M1 3G6E1 4QTUA 1W2BY 3HOXI 3CCS1 1K83I 2EGTA 3CCMZ 1YJW1 3CCJZ 2JA8I 1WW9A 1VQ41 1S7MA 1WIIA 1Y1VI 4BXXI 3G6EZ 1RLYA 4HGZA 1I6HI 5T6BA 1I50I 4A3KI 1Z03A 3TE5B 3J81b 3K7AI 3CCSZ 2ZAEB 1KC82 3CC41 3P5JB 3IFUA 4HGYA 3G711 2E2II 3VMGA 1X3WA 1VQ4Z 1YUKA 2RIQA 1WZNA 2E9HA 4NBCA 2I3CA 1Q821 1DL6A 1M902 4E2XA 5LL6f 3S2DI 1Q7Y2 3HOYI 3CC4Z 4MH4A 4NBAA 4A3LI 3BG1B 1RO2A 4NFRA 3G71Z 1QVGY 5D1OA 2VUMI 4MD7A 1QVFZ 5CM2M 2JIMA 1VQK1 4BBRI 3CC21 4MD8A 3J80f 1Q861 1Q7Y1 2AKLA 3CPWZ 3CCRZ 2E2JI 1NUIA 1VQO1 2VPWA 1KQSY 2QRDB 2JR6A 4RVFA 3S17I 4MONA 1Q812 3CQZI 1WCMI 3KIHA 3VMIA 3S1NI 4A93I 1VQKZ 3S2HI 1NJI1 3CCQ1 1VLAA 4EWCA 2OOXB 1K8A2 1VQOZ 4HH4A 2KI7B 3OW2Y 1JJ2Y 3RZDI 3GKQA 1N8R2 3I561 1Q811 3S14I 1SIWA 2AYDA 3IF8A 1YIJ1 3CD6Z 3GTMI 4A3BI 5D1PA 1QXFA 2PK7A 1K8A1 2QRCB 2OOYB 3MZKB 5IT9b 2BJOA 5C4JI 2J6AA 3M4OI 1QF8A 4E32A 4NBEA 1N8R1 2Q51A 2JIRA 1K731 3NH5A 1X3ZA 3S15I 3PO3I 1Z02A 5FLXb 2JUBA 2M48A 3I551 3CCJ1 3CME1 2V45A 3Q87A 3GTKI 4MRIA 1LQLA 4E30A 4A3JI 3NH4A 1Y1VS 1WJ2A 3HOZI 2NAPA 2R93I 4NBDA 2RPRA 2O53A 3I55Z 3CMEZ 2VUGA 3CXCZ 5A2Qf 4A3CI 1JWHC 3FQQA 1YJ91 2P3YA 2QR1B 1YHQZ 1VQN1 3HOUI 2JA6I 1VQ9Z 1TWCI 3D2LA 1Y1WI 2GU2A 4CL1A 2VF1A 4E33A 1YJ9Z 4A3II 3HOVI 1W2BZ 1TWFI 2IZ3A 1Q16A 1KD12 1VQNZ 2IV2X 2LFUA 3JAMf 5FLMI 2W03A 3S1RI 1KC81 3CCR1 3RZOI 3HKZA 4NB9A 1VQMZ 2QKDA 1M901 1KD11 4A3EI 2JIQA 3CCU1 4RVDA 1NP6A 2OTJ1 2B63I 3J81f 3M3YI 3VTNA 3CMAZ 2DE7A 4MXUA 4A3DI 2F4MA 2OTLZ 1PFTA 1ZB9A 1M1K2 3CCUZ 3FQMA 3CC71 3CD61 1QVGZ 2VPZA 2OTJZ 3T4NB 2NVQI 3GTGI 3GTMS 2QA41 2JA5I 2V8KA 4BBSI 3HOWI 4E2WA 1SFOI 3NFZA 3ESWA 3U50C 2Y0SA 2LIYA 3CC7Z 2OZKA 4QTTA 3S1QI 3GTLI 3G4SZ 1ML8A 2QA4Z 2QEX1 1Z01A 2Q4ZA 4TNUA 1VQL1 3PO3S 3TDHB 2RHBA 2V8IA 1N2FA 4AYBA 2QLVB 3BG0B 4A3FI 2HU9A 3VMHA 1YUAA 3VB9A 1JJ2Z 2QEXZ 3I4MI 2YU9I 1VQLZ 4NOZA 4RS4A 5AN9F 2JA7I 3LUSA 3IR7A 2P28A 2H85A 3GTOI 1K9M2 2JS4A 1TWGI 1QYPA 2F4OA 1YHQ1 4BY7I 2KPIA 2JNYA 1VQ91 1YIT1 1USPB 2E7ZA 4NBHA 5T64A 3I07A 4Y52I 4BY1I 3NDIA 2V3VA 1USPA 3GTPI 4E2ZA 4X6AI 1AA6A 5IT9f 1YITZ 1R9TI 4NB8A 2E2HI 4E31A 2YADA 4RVGA 1KRLA 3GTQI 5FLXf 2WB1A 2PM9A 1ZB8A 3J80b 1Q822 3EEDA 2GTHA 4NBFA 2GTIA 2RT9A 1VQM1 2WAQA 4XX2A 2QREB 4S1TA 2NVYI 3NH8A 1QVFY 4RVHA 5IP7I 3CCL1 1S721 1YJWZ 2NVXI 3CMA1 1L1OC 3KIFA 1YJN1 1RO0A 4MD9A 4E2YA
chains in the Genus database with same CATH topology
2R6MA 2OTL1 2R7ZI 1TFIA 3NDJA 1Q862 3CCLZ 1S72Z 5D1OB 3PO2I 2V8JA 5T67A 5IP9I 1VQ81 1YJNZ 3CCV1 4NH1C 3D6WA 3FKII 2M6NA 3H0GI 3F3PC 3H3VJ 1NJI2 1RQFA 3EERA 2K5RA 1TWHI 3CCE1 3D9XA 3G4S1 1VQP1 1VQ8Z 1RNIA 2O4HA 3CCVZ 1VQ61 3S16I 3I4NI 4RV9A 1P9NA 2PMZA 3QWUA 4DK1A 3F3FC 3CC2Z 3CCEZ 1M1K1 3MONA 1KQSZ 1VQPZ 1VQ71 2DE6A 1VQ6Z 2W04A 4NBBA 4Y7NI 2G2KA 5C4XI 1YI21 1K732 2R92I 1ZH1A 3CCQZ 3OW2Z 1VQ7Z 3J7A4 1RO4A 5A2Qb 1VQ51 4DGLA 3CPWY 4A3GI 3I56Z 1YI2Z 1I3QI 1TWAI 2DE5A 3CXCY 3MZLB 3IX0A 1YIJZ 3GCFA 5C3EI 2IZ4A 4NBGA 2JMOA 3GTJI 4A3MI 2HF1A 1VQ5Z 2K3RA 2NVTI 3CCM1 4DQYB 3S1MI 5C44I 2RBLA 1X0TA 3JAMb 1K9M1 3G6E1 4QTUA 1W2BY 3HOXI 3CCS1 1K83I 2EGTA 3CCMZ 1YJW1 3CCJZ 2JA8I 1WW9A 1VQ41 1S7MA 1WIIA 1Y1VI 4BXXI 3G6EZ 1RLYA 4HGZA 1I6HI 5T6BA 1I50I 4A3KI 1Z03A 3TE5B 3J81b 3K7AI 3CCSZ 2ZAEB 1KC82 3CC41 3P5JB 3IFUA 4HGYA 3G711 2E2II 3VMGA 1X3WA 1VQ4Z 1YUKA 2RIQA 2E9HA 4NBCA 2I3CA 1Q821 1DL6A 1M902 4E2XA 5LL6f 3S2DI 1Q7Y2 3HOYI 3CC4Z 4MH4A 4NBAA 4A3LI 3BG1B 1RO2A 4NFRA 3G71Z 1QVGY 5D1OA 2VUMI 4MD7A 1QVFZ 5CM2M 1VQK1 4BBRI 3CC21 4MD8A 3J80f 1Q861 1Q7Y1 2AKLA 3CPWZ 3CCRZ 2E2JI 1NUIA 1VQO1 1KQSY 2QRDB 2JR6A 4RVFA 3S17I 4MONA 1Q812 3CQZI 1WCMI 3KIHA 3VMIA 3S1NI 4A93I 1VQKZ 3S2HI 1NJI1 3CCQ1 1VLAA 4EWCA 2OOXB 1K8A2 1VQOZ 4HH4A 2KI7B 3OW2Y 1JJ2Y 3RZDI 3GKQA 1N8R2 3I561 1Q811 3S14I 3IF8A 1YIJ1 3CD6Z 3GTMI 4A3BI 5D1PA 2PK7A 1K8A1 2QRCB 2OOYB 3MZKB 5IT9b 2BJOA 5C4JI 2J6AA 3M4OI 1QF8A 4E32A 4NBEA 1N8R1 2Q51A 1K731 3NH5A 1X3ZA 3S15I 3PO3I 1Z02A 5FLXb 2JUBA 2M48A 3I551 3CCJ1 3CME1 3Q87A 3GTKI 4MRIA 1LQLA 4E30A 4A3JI 3NH4A 1Y1VS 3HOZI 2R93I 4NBDA 2RPRA 2O53A 3I55Z 3CMEZ 2VUGA 3CXCZ 5A2Qf 4A3CI 1JWHC 3FQQA 1YJ91 2P3YA 2QR1B 1YHQZ 1VQN1 3HOUI 2JA6I 1VQ9Z 1TWCI 1Y1WI 2GU2A 4CL1A 2VF1A 4E33A 1YJ9Z 4A3II 3HOVI 1W2BZ 1TWFI 2IZ3A 1KD12 1VQNZ 2LFUA 3JAMf 5FLMI 2W03A 3S1RI 1KC81 3CCR1 3RZOI 3HKZA 4NB9A 1VQMZ 2QKDA 1M901 1KD11 4A3EI 3CCU1 4RVDA 1NP6A 2OTJ1 2B63I 3J81f 3M3YI 3VTNA 3CMAZ 2DE7A 4MXUA 4A3DI 2F4MA 2OTLZ 1PFTA 1ZB9A 1M1K2 3CCUZ 3FQMA 3CC71 3CD61 1QVGZ 2OTJZ 3T4NB 2NVQI 3GTGI 3GTMS 2QA41 2JA5I 2V8KA 4BBSI 3HOWI 4E2WA 1SFOI 3NFZA 3ESWA 3U50C 2Y0SA 2LIYA 3CC7Z 2OZKA 4QTTA 3S1QI 3GTLI 3G4SZ 1ML8A 2QA4Z 2QEX1 1Z01A 2Q4ZA 4TNUA 1VQL1 3PO3S 3TDHB 2RHBA 2V8IA 1N2FA 4AYBA 2QLVB 3BG0B 4A3FI 2HU9A 3VMHA 1YUAA 3VB9A 1JJ2Z 2QEXZ 3I4MI 2YU9I 1VQLZ 4NOZA 4RS4A 5AN9F 2JA7I 3LUSA 2P28A 2H85A 3GTOI 1K9M2 2JS4A 1TWGI 1QYPA 2F4OA 1YHQ1 4BY7I 2KPIA 2JNYA 1VQ91 1YIT1 1USPB 5T64A 4NBHA 3I07A 4Y52I 4BY1I 3NDIA 1USPA 3GTPI 4E2ZA 4X6AI 5IT9f 1YITZ 1R9TI 4NB8A 2E2HI 4E31A 2YADA 4RVGA 1KRLA 3GTQI 5FLXf 2WB1A 2PM9A 1ZB8A 3J80b 1Q822 3EEDA 2GTHA 4NBFA 2GTIA 2RT9A 1VQM1 2WAQA 4XX2A 2QREB 4S1TA 2NVYI 3NH8A 1QVFY 4RVHA 5IP7I 3CCL1 1S721 1YJWZ 2NVXI 3CMA1 1L1OC 3KIFA 1YJN1 1RO0A 4MD9A 4E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS 1;  2OTL 1;  3CCM Z;  2QA4 1;  1YJW 1;  3CCJ Z;  1N8R 1;  1K73 1;  1Q86 2;  3CCL Z;  1VQ4 1;  1S72 Z;  3G6E Z;  3I55 1;  1VQ8 1;  1YJN Z;  3CCJ 1;  3CME 1;  3CC7 Z;  3CCV 1;  3CCS Z;  3G4S Z;  1KC8 2;  3CC4 1;  2QA4 Z;  2QEX 1;  1VQL 1;  1NJI 2;  3G71 1;  1VQ4 Z;  3CCE 1;  3G4S 1;  1VQP 1;  3I55 Z;  1VQ8 Z;  3CME Z;  1Q82 1;  3CCV Z;  1M90 2;  1VQ6 1;  3CXC Z;  1Q7Y 2;  1JJ2 Z;  3CC4 Z;  2QEX Z;  1YJ9 1;  1VQL Z;  3G71 Z;  3CC2 Z;  3CCE Z;  1QVG Y;  1YHQ Z;  1VQN 1;  3CD6 1;  1M1K 1;  1KQS Z;  1VQ9 Z;  1VQP Z;  1VQ7 1;  1QVF Z;  1K9M 2;  1VQ6 Z;  1VQK 1;  3CC2 1;  1YHQ 1;  1YJ9 Z;  1Q86 1;  1Q7Y 1;  1VQ9 1;  1W2B Z;  1YIT 1;  3CCR Z;  3CPW Z;  1YI2 1;  1K73 2;  2OTJ Z;  1KD1 2;  1VQN Z;  1VQO 1;  3CCQ Z;  1KQS Y;  3OW2 Z;  3CC7 1;  1VQ7 Z;  1Q81 2;  1KC8 1;  3CCR 1;  1VQK Z;  1VQ5 1;  1NJI 1;  3CCQ 1;  1YIT Z;  1YI2 Z;  3I56 Z;  1K8A 2;  3CXC Y;  1VQO Z;  1VQM Z;  3OW2 Y;  1JJ2 Y;  1M90 1;  1YIJ Z;  1KD1 1;  3CCU 1;  2OTJ 1;  1N8R 2;  1VQ5 Z;  1Q82 2;  3I56 1;  1Q81 1;  3CMA Z;  3CCM 1;  1VQM 1;  1YIJ 1;  3CD6 Z;  1QVF Y;  2OTL Z;  3CCL 1;  1S72 1;  1YJW Z;  1K9M 1;  3G6E 1;  3CMA 1;  1K8A 1;  1M1K 2;  1YJN 1;  3CCU Z;  1W2B Y;  3CPW Y;  1QVG Z; 
#chains in the Genus database with same CATH topology
 2R6M A;  2OTL 1;  2R7Z I;  1TFI A;  3NDJ A;  1FDO A;  1FDI A;  2VPX A;  1Q86 2;  3CCL Z;  1S72 Z;  5D1O B;  3PO2 I;  2V8J A;  5T67 A;  5IP9 I;  1VQ8 1;  1YJN Z;  3CCV 1;  4NH1 C;  3D6W A;  3FKI I;  2M6N A;  3H0G I;  3F3P C;  3H3V J;  1NJI 2;  1RQF A;  3EER A;  2K5R A;  1TWH I;  3CCE 1;  3D9X A;  3G4S 1;  1VQP 1;  1VQ8 Z;  1RNI A;  2O4H A;  3CCV Z;  1VQ6 1;  3S16 I;  2LEX A;  3I4N I;  4RV9 A;  1P9N A;  2PMZ A;  3QWU A;  4DK1 A;  3F3F C;  1Y8C A;  3CC2 Z;  3CCE Z;  1M1K 1;  3MON A;  1KQS Z;  1VQP Z;  1VQ7 1;  2DE6 A;  1VQ6 Z;  2W04 A;  4NBB A;  4Y7N I;  2G2K A;  5C4X I;  1YI2 1;  1K73 2;  2JIO A;  2R92 I;  1ZH1 A;  3CCQ Z;  3OW2 Z;  1VQ7 Z;  3J7A 4;  1RO4 A;  5A2Q b;  1VQ5 1;  4DGL A;  3CPW Y;  4A3G I;  3I56 Z;  1YI2 Z;  1I3Q I;  1TWA I;  2DE5 A;  3CXC Y;  3MZL B;  3IX0 A;  1YIJ Z;  3GCF A;  5C3E I;  2IZ4 A;  4NBG A;  2JMO A;  2JIP A;  3GTJ I;  4A3M I;  2HF1 A;  1VQ5 Z;  2K3R A;  2NVT I;  3CCM 1;  2VPY A;  4DQY B;  3S1M I;  5C44 I;  2RBL A;  1X0T A;  3JAM b;  1K9M 1;  3G6E 1;  4QTU A;  1W2B Y;  3HOX I;  3CCS 1;  1K83 I;  2EGT A;  3CCM Z;  1YJW 1;  3CCJ Z;  2JA8 I;  1WW9 A;  1VQ4 1;  1S7M A;  1WII A;  1Y1V I;  4BXX I;  3G6E Z;  1RLY A;  4HGZ A;  1I6H I;  5T6B A;  1I50 I;  4A3K I;  1Z03 A;  3TE5 B;  3J81 b;  3K7A I;  3CCS Z;  2ZAE B;  1KC8 2;  3CC4 1;  3P5J B;  3IFU A;  4HGY A;  3G71 1;  2E2I I;  3VMG A;  1X3W A;  1VQ4 Z;  1YUK A;  2RIQ A;  1WZN A;  2E9H A;  4NBC A;  2I3C A;  1Q82 1;  1DL6 A;  1M90 2;  4E2X A;  5LL6 f;  3S2D I;  1Q7Y 2;  3HOY I;  3CC4 Z;  4MH4 A;  4NBA A;  4A3L I;  3BG1 B;  1RO2 A;  4NFR A;  3G71 Z;  1QVG Y;  5D1O A;  2VUM I;  4MD7 A;  1QVF Z;  5CM2 M;  2JIM A;  1VQK 1;  4BBR I;  3CC2 1;  4MD8 A;  3J80 f;  1Q86 1;  1Q7Y 1;  2AKL A;  3CPW Z;  3CCR Z;  2E2J I;  1NUI A;  1VQO 1;  2VPW A;  1KQS Y;  2QRD B;  2JR6 A;  4RVF A;  3S17 I;  4MON A;  1Q81 2;  3CQZ I;  1WCM I;  3KIH A;  3VMI A;  3S1N I;  4A93 I;  1VQK Z;  3S2H I;  1NJI 1;  3CCQ 1;  1VLA A;  4EWC A;  2OOX B;  1K8A 2;  1VQO Z;  4HH4 A;  2KI7 B;  3OW2 Y;  1JJ2 Y;  3RZD I;  3GKQ A;  1N8R 2;  3I56 1;  1Q81 1;  3S14 I;  1SIW A;  2AYD A;  3IF8 A;  1YIJ 1;  3CD6 Z;  3GTM I;  4A3B I;  5D1P A;  1QXF A;  2PK7 A;  1K8A 1;  2QRC B;  2OOY B;  3MZK B;  5IT9 b;  2BJO A;  5C4J I;  2J6A A;  3M4O I;  1QF8 A;  4E32 A;  4NBE A;  1N8R 1;  2Q51 A;  2JIR A;  1K73 1;  3NH5 A;  1X3Z A;  3S15 I;  3PO3 I;  1Z02 A;  5FLX b;  2JUB A;  2M48 A;  3I55 1;  3CCJ 1;  3CME 1;  2V45 A;  3Q87 A;  3GTK I;  4MRI A;  1LQL A;  4E30 A;  4A3J I;  3NH4 A;  1Y1V S;  1WJ2 A;  3HOZ I;  2NAP A;  2R93 I;  4NBD A;  2RPR A;  2O53 A;  3I55 Z;  3CME Z;  2VUG A;  3CXC Z;  5A2Q f;  4A3C I;  1JWH C;  3FQQ A;  1YJ9 1;  2P3Y A;  2QR1 B;  1YHQ Z;  1VQN 1;  3HOU I;  2JA6 I;  1VQ9 Z;  1TWC I;  3D2L A;  1Y1W I;  2GU2 A;  4CL1 A;  2VF1 A;  4E33 A;  1YJ9 Z;  4A3I I;  3HOV I;  1W2B Z;  1TWF I;  2IZ3 A;  1Q16 A;  1KD1 2;  1VQN Z;  2IV2 X;  2LFU A;  3JAM f;  5FLM I;  2W03 A;  3S1R I;  1KC8 1;  3CCR 1;  3RZO I;  3HKZ A;  4NB9 A;  1VQM Z;  2QKD A;  1M90 1;  1KD1 1;  4A3E I;  2JIQ A;  3CCU 1;  4RVD A;  1NP6 A;  2OTJ 1;  2B63 I;  3J81 f;  3M3Y I;  3VTN A;  3CMA Z;  2DE7 A;  4MXU A;  4A3D I;  2F4M A;  2OTL Z;  1PFT A;  1ZB9 A;  1M1K 2;  3CCU Z;  3FQM A;  3CC7 1;  3CD6 1;  1QVG Z;  2VPZ A;  2OTJ Z;  3T4N B;  2NVQ I;  3GTG I;  3GTM S;  2QA4 1;  2JA5 I;  2V8K A;  4BBS I;  3HOW I;  4E2W A;  1SFO I;  3NFZ A;  3ESW A;  3U50 C;  2Y0S A;  2LIY A;  3CC7 Z;  2OZK A;  4QTT A;  3S1Q I;  3GTL I;  3G4S Z;  1ML8 A;  2QA4 Z;  2QEX 1;  1Z01 A;  2Q4Z A;  4TNU A;  1VQL 1;  3PO3 S;  3TDH B;  2RHB A;  2V8I A;  1N2F A;  4AYB A;  2QLV B;  3BG0 B;  4A3F I;  2HU9 A;  3VMH A;  1YUA A;  3VB9 A;  1JJ2 Z;  2QEX Z;  3I4M I;  2YU9 I;  1VQL Z;  4NOZ A;  4RS4 A;  5AN9 F;  2JA7 I;  3LUS A;  3IR7 A;  2P28 A;  2H85 A;  3GTO I;  1K9M 2;  2JS4 A;  1TWG I;  1QYP A;  2F4O A;  1YHQ 1;  4BY7 I;  2KPI A;  2JNY A;  1VQ9 1;  1YIT 1;  1USP B;  2E7Z A;  4NBH A;  5T64 A;  3I07 A;  4Y52 I;  4BY1 I;  3NDI A;  2V3V A;  1USP A;  3GTP I;  4E2Z A;  4X6A I;  1AA6 A;  5IT9 f;  1YIT Z;  1R9T I;  4NB8 A;  2E2H I;  4E31 A;  2YAD A;  4RVG A;  1KRL A;  3GTQ I;  5FLX f;  2WB1 A;  2PM9 A;  1ZB8 A;  3J80 b;  1Q82 2;  3EED A;  2GTH A;  4NBF A;  2GTI A;  2RT9 A;  1VQM 1;  2WAQ A;  4XX2 A;  2QRE B;  4S1T A;  2NVY I;  3NH8 A;  1QVF Y;  4RVH A;  5IP7 I;  3CCL 1;  1S72 1;  1YJW Z;  2NVX I;  3CMA 1;  1L1O C;  3KIF A;  1YJN 1;  1RO0 A;  4MD9 A;  4E2Y A; 
#chains in the Genus database with same CATH homology
 2R6M A;  2OTL 1;  2R7Z I;  1TFI A;  3NDJ A;  1Q86 2;  3CCL Z;  1S72 Z;  5D1O B;  3PO2 I;  2V8J A;  5T67 A;  5IP9 I;  1VQ8 1;  1YJN Z;  3CCV 1;  4NH1 C;  3D6W A;  3FKI I;  2M6N A;  3H0G I;  3F3P C;  3H3V J;  1NJI 2;  1RQF A;  3EER A;  2K5R A;  1TWH I;  3CCE 1;  3D9X A;  3G4S 1;  1VQP 1;  1VQ8 Z;  1RNI A;  2O4H A;  3CCV Z;  1VQ6 1;  3S16 I;  3I4N I;  4RV9 A;  1P9N A;  2PMZ A;  3QWU A;  4DK1 A;  3F3F C;  3CC2 Z;  3CCE Z;  1M1K 1;  3MON A;  1KQS Z;  1VQP Z;  1VQ7 1;  2DE6 A;  1VQ6 Z;  2W04 A;  4NBB A;  4Y7N I;  2G2K A;  5C4X I;  1YI2 1;  1K73 2;  2R92 I;  1ZH1 A;  3CCQ Z;  3OW2 Z;  1VQ7 Z;  3J7A 4;  1RO4 A;  5A2Q b;  1VQ5 1;  4DGL A;  3CPW Y;  4A3G I;  3I56 Z;  1YI2 Z;  1I3Q I;  1TWA I;  2DE5 A;  3CXC Y;  3MZL B;  3IX0 A;  1YIJ Z;  3GCF A;  5C3E I;  2IZ4 A;  4NBG A;  2JMO A;  3GTJ I;  4A3M I;  2HF1 A;  1VQ5 Z;  2K3R A;  2NVT I;  3CCM 1;  4DQY B;  3S1M I;  5C44 I;  2RBL A;  1X0T A;  3JAM b;  1K9M 1;  3G6E 1;  4QTU A;  1W2B Y;  3HOX I;  3CCS 1;  1K83 I;  2EGT A;  3CCM Z;  1YJW 1;  3CCJ Z;  2JA8 I;  1WW9 A;  1VQ4 1;  1S7M A;  1WII A;  1Y1V I;  4BXX I;  3G6E Z;  1RLY A;  4HGZ A;  1I6H I;  5T6B A;  1I50 I;  4A3K I;  1Z03 A;  3TE5 B;  3J81 b;  3K7A I;  3CCS Z;  2ZAE B;  1KC8 2;  3CC4 1;  3P5J B;  3IFU A;  4HGY A;  3G71 1;  2E2I I;  3VMG A;  1X3W A;  1VQ4 Z;  1YUK A;  2RIQ A;  2E9H A;  4NBC A;  2I3C A;  1Q82 1;  1DL6 A;  1M90 2;  4E2X A;  5LL6 f;  3S2D I;  1Q7Y 2;  3HOY I;  3CC4 Z;  4MH4 A;  4NBA A;  4A3L I;  3BG1 B;  1RO2 A;  4NFR A;  3G71 Z;  1QVG Y;  5D1O A;  2VUM I;  4MD7 A;  1QVF Z;  5CM2 M;  1VQK 1;  4BBR I;  3CC2 1;  4MD8 A;  3J80 f;  1Q86 1;  1Q7Y 1;  2AKL A;  3CPW Z;  3CCR Z;  2E2J I;  1NUI A;  1VQO 1;  1KQS Y;  2QRD B;  2JR6 A;  4RVF A;  3S17 I;  4MON A;  1Q81 2;  3CQZ I;  1WCM I;  3KIH A;  3VMI A;  3S1N I;  4A93 I;  1VQK Z;  3S2H I;  1NJI 1;  3CCQ 1;  1VLA A;  4EWC A;  2OOX B;  1K8A 2;  1VQO Z;  4HH4 A;  2KI7 B;  3OW2 Y;  1JJ2 Y;  3RZD I;  3GKQ A;  1N8R 2;  3I56 1;  1Q81 1;  3S14 I;  3IF8 A;  1YIJ 1;  3CD6 Z;  3GTM I;  4A3B I;  5D1P A;  2PK7 A;  1K8A 1;  2QRC B;  2OOY B;  3MZK B;  5IT9 b;  2BJO A;  5C4J I;  2J6A A;  3M4O I;  1QF8 A;  4E32 A;  4NBE A;  1N8R 1;  2Q51 A;  1K73 1;  3NH5 A;  1X3Z A;  3S15 I;  3PO3 I;  1Z02 A;  5FLX b;  2JUB A;  2M48 A;  3I55 1;  3CCJ 1;  3CME 1;  3Q87 A;  3GTK I;  4MRI A;  1LQL A;  4E30 A;  4A3J I;  3NH4 A;  1Y1V S;  3HOZ I;  2R93 I;  4NBD A;  2RPR A;  2O53 A;  3I55 Z;  3CME Z;  2VUG A;  3CXC Z;  5A2Q f;  4A3C I;  1JWH C;  3FQQ A;  1YJ9 1;  2P3Y A;  2QR1 B;  1YHQ Z;  1VQN 1;  3HOU I;  2JA6 I;  1VQ9 Z;  1TWC I;  1Y1W I;  2GU2 A;  4CL1 A;  2VF1 A;  4E33 A;  1YJ9 Z;  4A3I I;  3HOV I;  1W2B Z;  1TWF I;  2IZ3 A;  1KD1 2;  1VQN Z;  2LFU A;  3JAM f;  5FLM I;  2W03 A;  3S1R I;  1KC8 1;  3CCR 1;  3RZO I;  3HKZ A;  4NB9 A;  1VQM Z;  2QKD A;  1M90 1;  1KD1 1;  4A3E I;  3CCU 1;  4RVD A;  1NP6 A;  2OTJ 1;  2B63 I;  3J81 f;  3M3Y I;  3VTN A;  3CMA Z;  2DE7 A;  4MXU A;  4A3D I;  2F4M A;  2OTL Z;  1PFT A;  1ZB9 A;  1M1K 2;  3CCU Z;  3FQM A;  3CC7 1;  3CD6 1;  1QVG Z;  2OTJ Z;  3T4N B;  2NVQ I;  3GTG I;  3GTM S;  2QA4 1;  2JA5 I;  2V8K A;  4BBS I;  3HOW I;  4E2W A;  1SFO I;  3NFZ A;  3ESW A;  3U50 C;  2Y0S A;  2LIY A;  3CC7 Z;  2OZK A;  4QTT A;  3S1Q I;  3GTL I;  3G4S Z;  1ML8 A;  2QA4 Z;  2QEX 1;  1Z01 A;  2Q4Z A;  4TNU A;  1VQL 1;  3PO3 S;  3TDH B;  2RHB A;  2V8I A;  1N2F A;  4AYB A;  2QLV B;  3BG0 B;  4A3F I;  2HU9 A;  3VMH A;  1YUA A;  3VB9 A;  1JJ2 Z;  2QEX Z;  3I4M I;  2YU9 I;  1VQL Z;  4NOZ A;  4RS4 A;  5AN9 F;  2JA7 I;  3LUS A;  2P28 A;  2H85 A;  3GTO I;  1K9M 2;  2JS4 A;  1TWG I;  1QYP A;  2F4O A;  1YHQ 1;  4BY7 I;  2KPI A;  2JNY A;  1VQ9 1;  1YIT 1;  1USP B;  5T64 A;  4NBH A;  3I07 A;  4Y52 I;  4BY1 I;  3NDI A;  1USP A;  3GTP I;  4E2Z A;  4X6A I;  5IT9 f;  1YIT Z;  1R9T I;  4NB8 A;  2E2H I;  4E31 A;  2YAD A;  4RVG A;  1KRL A;  3GTQ I;  5FLX f;  2WB1 A;  2PM9 A;  1ZB8 A;  3J80 b;  1Q82 2;  3EED A;  2GTH A;  4NBF A;  2GTI A;  2RT9 A;  1VQM 1;  2WAQ A;  4XX2 A;  2QRE B;  4S1T A;  2NVY I;  3NH8 A;  1QVF Y;  4RVH A;  5IP7 I;  3CCL 1;  1S72 1;  1YJW Z;  2NVX I;  3CMA 1;  1L1O C;  3KIF A;  1YJN 1;  1RO0 A;  4MD9 A;  4E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...