2YADA

Brichos domain of surfactant protein c precursor protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
77
Chain Sequence
b'TTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLGMAVSTLCGEVPLYYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURFACTANT PROTEIN C BRICHOS DOMAIN
publication title High Resolution Structure of a Bricos Domain and its Implications for Anti-Amyloid Chaperone Activity on Lung Surgactant Protein C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Surfactant protein
total genus 14
structure length 77
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04089 BRICHOS BRICHOS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.460 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yadA00
2YADA
chains in the Genus database with same CATH superfamily
2DE5A 4NB8A 2IZ3A 3IR7A 1N8R2 3FQMA 4BY7I 2JIPA 2OTJ1 1K8A1 3CCRZ 3CC41 2IZ4A 1VLAA 4NOZA 1Y1VS 3KIFA 4E2YA 2R92I 3EEDA 4A3MI 1Q812 1I6HI 4AYBA 2QRDB 2P3YA 2J6AA 5LL6f 3MONA 1RQFA 1TFIA 3NH5A 4RVGA 2VPYA 3QWUA 3S16I 2V8JA 5T64A 2E2JI 3GTOI 4A3CI 4MD7A 1QF8A 3CCE1 1YJW1 1VQ71 3S1QI 1KD12 2VPWA 3CCMZ 2R7ZI 2KI7B 2OTLZ 3GTKI 3M4OI 1VQM1 4BY1I 5FLXf 3RZDI 4HGZA 4A3BI 3CCR1 1USPB 3HOXI 1VQPZ 2QRCB 3I551 3MZKB 4BXXI 2YADA 3F3FC 4NBGA 1WJ2A 1Q16A 3OW2Z 2JA8I 4MH4A 3H0GI 4EWCA 3I4NI 1YHQZ 3CMEZ 3HOVI 1S7MA 2Q4ZA 1I50I 4A3EI 2QEXZ 2WAQA 1X0TA 3CCM1 2RT9A 4DQYB 3GKQA 2OOYB 4RVFA 2OTL1 2OZKA 2QREB 1M902 1RO0A 1TWGI 3HKZA 3JAMb 5C4XI 1YUKA 3OW2Y 1VQNZ 3RZOI 3GTPI 3CD6Z 1VQP1 3D6WA 3CPWZ 3CCSZ 1YI21 2NVTI 2QKDA 1PFTA 1Q811 1YHQ1 1VQK1 3CME1 5A2Qf 4A3JI 1Q7Y2 1LQLA 4NB9A 2JA6I 1K83I 1ML8A 4HGYA 3CPWY 2B63I 1X3ZA 4RVHA 1DL6A 1WCMI 3LUSA 2M6NA 2NVYI 3EERA 2NVXI 1KD11 3NFZA 1VQN1 1KC81 4E2WA 1NP6A 3CCS1 3CCEZ 1K731 2JIOA 3IFUA 2PM9A 2RHBA 3BG0B 1Q821 3NH4A 1VQMZ 1VQ6Z 3U50C 4NBDA 3S14I 4Y7NI 3GTQI 4A3II 1VQ8Z 3HOUI 3FKII 3S17I 2HF1A 1KQSZ 3CQZI 2LIYA 3I55Z 3CCJZ 1YUAA 2AYDA 2NVQI 2G2KA 5IT9f 4E32A 2PMZA 3GTMI 1JJ2Z 4A3KI 3PO3I 1M901 3S2DI 1QVGZ 1KQSY 2O4HA 2JA5I 2VPZA 1I3QI 4A3LI 1QVFZ 3S15I 2LEXA 1RLYA 1VQ61 3CC7Z 4MXUA 2Q51A 1K9M2 2E9HA 3G4S1 1TWAI 1M1K2 1VQ4Z 1Z03A 3IF8A 3G6E1 3J7A4 1VQ81 5IP9I 4NFRA 1KRLA 2NAPA 4A3FI 1NJI2 3CCJ1 4E2ZA 3J81f 2QA4Z 1JJ2Y 1YI2Z 1S721 4A3GI 3J80f 1ZB9A 2GTIA 1Q7Y1 2VF1A 1QVGY 1VQ9Z 4XX2A 2F4MA 3TE5B 1VQKZ 3CCU1 1QVFY 4NBBA 1L1OC 1ZH1A 2BJOA 4E30A 3I56Z 2R6MA 3S1NI 5T67A 3D9XA 3CC71 2JMOA 1VQ41 4BBRI 3GTMS 2V8IA 3F3PC 3PO3S 1N8R1 3NDIA 2QA41 2ZAEB 1Z02A 3CXCZ 1VQ91 1N2FA 5C3EI 4MD9A 5IP7I 3GTGI 1TWCI 4NBFA 1RNIA 5A2Qb 1QYPA 2V45A 4MRIA 4RS4A 3I561 1FDOA 2V3VA 1AA6A 5AN9F 4A3DI 2K3RA 3NDJA 4DK1A 4NBAA 5T6BA 2E7ZA 3GTLI 3TDHB 5C4JI 3K7AI 1VQOZ 2V8KA 3CXCY 1W2BZ 2JIMA 2AKLA 1YIT1 2JUBA 1K9M1 1VQ5Z 3VB9A 3CC2Z 2VPXA 4BBSI 2JIQA 3HOYI 1VQLZ 4MONA 4E33A 3G4SZ 3Q87A 4NBEA 3G6EZ 1YJNZ 4MD8A 4Y52I 1WW9A 1WIIA 2KPIA 2IV2X 1W2BY 2DE7A 5D1OB 1S72Z 3H3VJ 1JWHC 3T4NB 2F4OA 1SIWA 2HU9A 3PO2I 2H85A 4RV9A 2E2HI 3CCUZ 1VQO1 5IT9b 2VUMI 4TNUA 1QXFA 2RBLA 4CL1A 1VQ51 3CC21 3CCLZ 2JS4A 2JA7I 3G71Z 1VQL1 4NBHA 5D1PA 5FLXb 5C44I 3VMGA 3D2LA 1TWFI 3VMHA 1P9NA 1YJN1 1YIJZ 1Q862 2M48A 4RVDA 1Z01A 2R93I 3CCVZ 3CMA1 3J81b 1KC82 1ZB8A 3KIHA 5FLMI 3J80b 3IX0A 1K732 2QR1B 4X6AI 1Y1WI 2I3CA 4E31A 1Q822 2GU2A 1RO2A 3MZLB 1K8A2 3CCL1 2OOXB 4NBCA 2QLVB 5D1OA 3G711 1TWHI 2JR6A 2W04A 3BG1B 2O53A 1YIJ1 3NH8A 4S1TA 3P5JB 4NH1C 2JNYA 2RIQA 3CCV1 2WB1A 1YITZ 3S2HI 4QTUA 2EGTA 3JAMf 3ESWA 2YU9I 3I07A 1WZNA 3CCQZ 3S1MI 1YJ9Z 2E2II 3HOWI 2PK7A 1FDIA 2VUGA 4E2XA 1Y1VI 1NUIA 3FQQA 5CM2M 3HOZI 2GTHA 1R9TI 2OTJZ 3CC4Z 4QTTA 3VMIA 1USPA 1SFOI 4HH4A 3I4MI 1X3WA 2LFUA 1M1K1 2QEX1 1Y8CA 1Q861 2Y0SA 2P28A 1RO4A 3S1RI 1NJI1 3VTNA 3CCQ1 2RPRA 2JIRA 4DGLA 1YJ91 2DE6A 3GTJI 2W03A 3CD61 2K5RA 3CMAZ 1YJWZ 1VQ7Z 3M3YI 3GCFA 4A93I
chains in the Genus database with same CATH topology
2DE5A 4NB8A 2IZ3A 1N8R2 3FQMA 4BY7I 2OTJ1 1K8A1 3CCRZ 3CC41 2IZ4A 1VLAA 4NOZA 1Y1VS 3KIFA 4E2YA 2R92I 3EEDA 4A3MI 1Q812 1I6HI 4AYBA 2QRDB 2P3YA 2J6AA 5LL6f 3MONA 1RQFA 1TFIA 3NH5A 4RVGA 3QWUA 3S16I 2V8JA 5T64A 2E2JI 3GTOI 4A3CI 4MD7A 1QF8A 3CCE1 1YJW1 1VQ71 3S1QI 1KD12 3CCMZ 2R7ZI 2KI7B 2OTLZ 3GTKI 3M4OI 1VQM1 4BY1I 5FLXf 3RZDI 4HGZA 4A3BI 3CCR1 1USPB 3HOXI 1VQPZ 2QRCB 3I551 3MZKB 4BXXI 2YADA 3F3FC 4NBGA 3OW2Z 2JA8I 4MH4A 3H0GI 4EWCA 3I4NI 1YHQZ 3CMEZ 3HOVI 1S7MA 2Q4ZA 1I50I 4A3EI 2QEXZ 2WAQA 1X0TA 3CCM1 2RT9A 4DQYB 3GKQA 2OOYB 4RVFA 2OTL1 2OZKA 2QREB 1M902 1RO0A 1TWGI 3HKZA 3JAMb 5C4XI 1YUKA 3OW2Y 1VQNZ 3RZOI 3GTPI 3CD6Z 1VQP1 3D6WA 3CPWZ 3CCSZ 1YI21 2NVTI 2QKDA 1PFTA 1Q811 1YHQ1 1VQK1 3CME1 5A2Qf 4A3JI 1Q7Y2 1LQLA 4NB9A 2JA6I 1K83I 1ML8A 4HGYA 3CPWY 2B63I 1X3ZA 4RVHA 1DL6A 1WCMI 3LUSA 2M6NA 2NVYI 3EERA 2NVXI 1KD11 3NFZA 1VQN1 1KC81 4E2WA 1NP6A 3CCS1 3CCEZ 1K731 3IFUA 2PM9A 2RHBA 3BG0B 1Q821 3NH4A 1VQMZ 1VQ6Z 3U50C 4NBDA 3S14I 4Y7NI 3GTQI 4A3II 1VQ8Z 3HOUI 3FKII 3S17I 2HF1A 1KQSZ 3CQZI 2LIYA 3I55Z 3CCJZ 1YUAA 2NVQI 2G2KA 5IT9f 4E32A 2PMZA 3GTMI 1JJ2Z 4A3KI 3PO3I 1M901 3S2DI 1QVGZ 1KQSY 2O4HA 2JA5I 1I3QI 4A3LI 1QVFZ 3S15I 1RLYA 1VQ61 3CC7Z 4MXUA 2Q51A 1K9M2 2E9HA 3G4S1 1TWAI 1M1K2 1VQ4Z 1Z03A 3IF8A 3G6E1 3J7A4 1VQ81 5IP9I 4NFRA 1KRLA 4A3FI 1NJI2 3CCJ1 4E2ZA 3J81f 2QA4Z 1JJ2Y 1YI2Z 1S721 4A3GI 3J80f 1ZB9A 2GTIA 1Q7Y1 2VF1A 1QVGY 1VQ9Z 4XX2A 2F4MA 3TE5B 1VQKZ 3CCU1 1QVFY 4NBBA 1L1OC 1ZH1A 2BJOA 4E30A 3I56Z 2R6MA 3S1NI 5T67A 3D9XA 3CC71 2JMOA 1VQ41 4BBRI 3GTMS 2V8IA 3F3PC 3PO3S 1N8R1 3NDIA 2QA41 2ZAEB 1Z02A 3CXCZ 1VQ91 1N2FA 5C3EI 4MD9A 5IP7I 3GTGI 1TWCI 4NBFA 1RNIA 5A2Qb 1QYPA 4MRIA 4RS4A 3I561 5AN9F 4A3DI 2K3RA 3NDJA 4DK1A 4NBAA 5T6BA 3GTLI 3TDHB 5C4JI 3K7AI 1VQOZ 2V8KA 3CXCY 1W2BZ 2AKLA 1YIT1 2JUBA 1K9M1 1VQ5Z 3VB9A 3CC2Z 4BBSI 3HOYI 1VQLZ 4MONA 4E33A 3G4SZ 3Q87A 4NBEA 3G6EZ 1YJNZ 4MD8A 4Y52I 1WW9A 1WIIA 2KPIA 1W2BY 2DE7A 5D1OB 1S72Z 3H3VJ 1JWHC 3T4NB 2F4OA 2HU9A 3PO2I 2H85A 4RV9A 2E2HI 3CCUZ 1VQO1 5IT9b 2VUMI 4TNUA 2RBLA 4CL1A 1VQ51 3CC21 3CCLZ 2JS4A 2JA7I 3G71Z 1VQL1 4NBHA 5D1PA 5FLXb 5C44I 3VMGA 1TWFI 3VMHA 1P9NA 1YJN1 1YIJZ 1Q862 2M48A 4RVDA 1Z01A 2R93I 3CCVZ 3CMA1 3J81b 1KC82 1ZB8A 3KIHA 5FLMI 3J80b 3IX0A 1K732 2QR1B 4X6AI 1Y1WI 2I3CA 4E31A 1Q822 2GU2A 1RO2A 3MZLB 1K8A2 3CCL1 2OOXB 4NBCA 2QLVB 5D1OA 3G711 1TWHI 2JR6A 2W04A 3BG1B 2O53A 1YIJ1 3NH8A 4S1TA 3P5JB 4NH1C 2JNYA 2RIQA 3CCV1 2WB1A 1YITZ 3S2HI 4QTUA 2EGTA 3JAMf 3ESWA 2YU9I 3I07A 3CCQZ 3S1MI 1YJ9Z 2E2II 3HOWI 2PK7A 2VUGA 4E2XA 1Y1VI 1NUIA 3FQQA 5CM2M 3HOZI 2GTHA 1R9TI 2OTJZ 3CC4Z 4QTTA 3VMIA 1USPA 1SFOI 4HH4A 3I4MI 1X3WA 2LFUA 1M1K1 2QEX1 1Q861 2Y0SA 2P28A 1RO4A 3S1RI 1NJI1 3VTNA 3CCQ1 2RPRA 4DGLA 1YJ91 2DE6A 3GTJI 2W03A 3CD61 2K5RA 3CMAZ 1YJWZ 1VQ7Z 3M3YI 3GCFA 4A93I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YAD A; 
#chains in the Genus database with same CATH topology
 2DE5 A;  4NB8 A;  2IZ3 A;  3IR7 A;  1N8R 2;  3FQM A;  4BY7 I;  2JIP A;  2OTJ 1;  1K8A 1;  3CCR Z;  3CC4 1;  2IZ4 A;  1VLA A;  4NOZ A;  1Y1V S;  3KIF A;  4E2Y A;  2R92 I;  3EED A;  4A3M I;  1Q81 2;  1I6H I;  4AYB A;  2QRD B;  2P3Y A;  2J6A A;  5LL6 f;  3MON A;  1RQF A;  1TFI A;  3NH5 A;  4RVG A;  2VPY A;  3QWU A;  3S16 I;  2V8J A;  5T64 A;  2E2J I;  3GTO I;  4A3C I;  4MD7 A;  1QF8 A;  3CCE 1;  1YJW 1;  1VQ7 1;  3S1Q I;  1KD1 2;  2VPW A;  3CCM Z;  2R7Z I;  2KI7 B;  2OTL Z;  3GTK I;  3M4O I;  1VQM 1;  4BY1 I;  5FLX f;  3RZD I;  4HGZ A;  4A3B I;  3CCR 1;  1USP B;  3HOX I;  1VQP Z;  2QRC B;  3I55 1;  3MZK B;  4BXX I;  2YAD A;  3F3F C;  4NBG A;  1WJ2 A;  1Q16 A;  3OW2 Z;  2JA8 I;  4MH4 A;  3H0G I;  4EWC A;  3I4N I;  1YHQ Z;  3CME Z;  3HOV I;  1S7M A;  2Q4Z A;  1I50 I;  4A3E I;  2QEX Z;  2WAQ A;  1X0T A;  3CCM 1;  2RT9 A;  4DQY B;  3GKQ A;  2OOY B;  4RVF A;  2OTL 1;  2OZK A;  2QRE B;  1M90 2;  1RO0 A;  1TWG I;  3HKZ A;  3JAM b;  5C4X I;  1YUK A;  3OW2 Y;  1VQN Z;  3RZO I;  3GTP I;  3CD6 Z;  1VQP 1;  3D6W A;  3CPW Z;  3CCS Z;  1YI2 1;  2NVT I;  2QKD A;  1PFT A;  1Q81 1;  1YHQ 1;  1VQK 1;  3CME 1;  5A2Q f;  4A3J I;  1Q7Y 2;  1LQL A;  4NB9 A;  2JA6 I;  1K83 I;  1ML8 A;  4HGY A;  3CPW Y;  2B63 I;  1X3Z A;  4RVH A;  1DL6 A;  1WCM I;  3LUS A;  2M6N A;  2NVY I;  3EER A;  2NVX I;  1KD1 1;  3NFZ A;  1VQN 1;  1KC8 1;  4E2W A;  1NP6 A;  3CCS 1;  3CCE Z;  1K73 1;  2JIO A;  3IFU A;  2PM9 A;  2RHB A;  3BG0 B;  1Q82 1;  3NH4 A;  1VQM Z;  1VQ6 Z;  3U50 C;  4NBD A;  3S14 I;  4Y7N I;  3GTQ I;  4A3I I;  1VQ8 Z;  3HOU I;  3FKI I;  3S17 I;  2HF1 A;  1KQS Z;  3CQZ I;  2LIY A;  3I55 Z;  3CCJ Z;  1YUA A;  2AYD A;  2NVQ I;  2G2K A;  5IT9 f;  4E32 A;  2PMZ A;  3GTM I;  1JJ2 Z;  4A3K I;  3PO3 I;  1M90 1;  3S2D I;  1QVG Z;  1KQS Y;  2O4H A;  2JA5 I;  2VPZ A;  1I3Q I;  4A3L I;  1QVF Z;  3S15 I;  2LEX A;  1RLY A;  1VQ6 1;  3CC7 Z;  4MXU A;  2Q51 A;  1K9M 2;  2E9H A;  3G4S 1;  1TWA I;  1M1K 2;  1VQ4 Z;  1Z03 A;  3IF8 A;  3G6E 1;  3J7A 4;  1VQ8 1;  5IP9 I;  4NFR A;  1KRL A;  2NAP A;  4A3F I;  1NJI 2;  3CCJ 1;  4E2Z A;  3J81 f;  2QA4 Z;  1JJ2 Y;  1YI2 Z;  1S72 1;  4A3G I;  3J80 f;  1ZB9 A;  2GTI A;  1Q7Y 1;  2VF1 A;  1QVG Y;  1VQ9 Z;  4XX2 A;  2F4M A;  3TE5 B;  1VQK Z;  3CCU 1;  1QVF Y;  4NBB A;  1L1O C;  1ZH1 A;  2BJO A;  4E30 A;  3I56 Z;  2R6M A;  3S1N I;  5T67 A;  3D9X A;  3CC7 1;  2JMO A;  1VQ4 1;  4BBR I;  3GTM S;  2V8I A;  3F3P C;  3PO3 S;  1N8R 1;  3NDI A;  2QA4 1;  2ZAE B;  1Z02 A;  3CXC Z;  1VQ9 1;  1N2F A;  5C3E I;  4MD9 A;  5IP7 I;  3GTG I;  1TWC I;  4NBF A;  1RNI A;  5A2Q b;  1QYP A;  2V45 A;  4MRI A;  4RS4 A;  3I56 1;  1FDO A;  2V3V A;  1AA6 A;  5AN9 F;  4A3D I;  2K3R A;  3NDJ A;  4DK1 A;  4NBA A;  5T6B A;  2E7Z A;  3GTL I;  3TDH B;  5C4J I;  3K7A I;  1VQO Z;  2V8K A;  3CXC Y;  1W2B Z;  2JIM A;  2AKL A;  1YIT 1;  2JUB A;  1K9M 1;  1VQ5 Z;  3VB9 A;  3CC2 Z;  2VPX A;  4BBS I;  2JIQ A;  3HOY I;  1VQL Z;  4MON A;  4E33 A;  3G4S Z;  3Q87 A;  4NBE A;  3G6E Z;  1YJN Z;  4MD8 A;  4Y52 I;  1WW9 A;  1WII A;  2KPI A;  2IV2 X;  1W2B Y;  2DE7 A;  5D1O B;  1S72 Z;  3H3V J;  1JWH C;  3T4N B;  2F4O A;  1SIW A;  2HU9 A;  3PO2 I;  2H85 A;  4RV9 A;  2E2H I;  3CCU Z;  1VQO 1;  5IT9 b;  2VUM I;  4TNU A;  1QXF A;  2RBL A;  4CL1 A;  1VQ5 1;  3CC2 1;  3CCL Z;  2JS4 A;  2JA7 I;  3G71 Z;  1VQL 1;  4NBH A;  5D1P A;  5FLX b;  5C44 I;  3VMG A;  3D2L A;  1TWF I;  3VMH A;  1P9N A;  1YJN 1;  1YIJ Z;  1Q86 2;  2M48 A;  4RVD A;  1Z01 A;  2R93 I;  3CCV Z;  3CMA 1;  3J81 b;  1KC8 2;  1ZB8 A;  3KIH A;  5FLM I;  3J80 b;  3IX0 A;  1K73 2;  2QR1 B;  4X6A I;  1Y1W I;  2I3C A;  4E31 A;  1Q82 2;  2GU2 A;  1RO2 A;  3MZL B;  1K8A 2;  3CCL 1;  2OOX B;  4NBC A;  2QLV B;  5D1O A;  3G71 1;  1TWH I;  2JR6 A;  2W04 A;  3BG1 B;  2O53 A;  1YIJ 1;  3NH8 A;  4S1T A;  3P5J B;  4NH1 C;  2JNY A;  2RIQ A;  3CCV 1;  2WB1 A;  1YIT Z;  3S2H I;  4QTU A;  2EGT A;  3JAM f;  3ESW A;  2YU9 I;  3I07 A;  1WZN A;  3CCQ Z;  3S1M I;  1YJ9 Z;  2E2I I;  3HOW I;  2PK7 A;  1FDI A;  2VUG A;  4E2X A;  1Y1V I;  1NUI A;  3FQQ A;  5CM2 M;  3HOZ I;  2GTH A;  1R9T I;  2OTJ Z;  3CC4 Z;  4QTT A;  3VMI A;  1USP A;  1SFO I;  4HH4 A;  3I4M I;  1X3W A;  2LFU A;  1M1K 1;  2QEX 1;  1Y8C A;  1Q86 1;  2Y0S A;  2P28 A;  1RO4 A;  3S1R I;  1NJI 1;  3VTN A;  3CCQ 1;  2RPR A;  2JIR A;  4DGL A;  1YJ9 1;  2DE6 A;  3GTJ I;  2W03 A;  3CD6 1;  2K5R A;  3CMA Z;  1YJW Z;  1VQ7 Z;  3M3Y I;  3GCF A;  4A93 I; 
#chains in the Genus database with same CATH homology
 2DE5 A;  4NB8 A;  2IZ3 A;  1N8R 2;  3FQM A;  4BY7 I;  2OTJ 1;  1K8A 1;  3CCR Z;  3CC4 1;  2IZ4 A;  1VLA A;  4NOZ A;  1Y1V S;  3KIF A;  4E2Y A;  2R92 I;  3EED A;  4A3M I;  1Q81 2;  1I6H I;  4AYB A;  2QRD B;  2P3Y A;  2J6A A;  5LL6 f;  3MON A;  1RQF A;  1TFI A;  3NH5 A;  4RVG A;  3QWU A;  3S16 I;  2V8J A;  5T64 A;  2E2J I;  3GTO I;  4A3C I;  4MD7 A;  1QF8 A;  3CCE 1;  1YJW 1;  1VQ7 1;  3S1Q I;  1KD1 2;  3CCM Z;  2R7Z I;  2KI7 B;  2OTL Z;  3GTK I;  3M4O I;  1VQM 1;  4BY1 I;  5FLX f;  3RZD I;  4HGZ A;  4A3B I;  3CCR 1;  1USP B;  3HOX I;  1VQP Z;  2QRC B;  3I55 1;  3MZK B;  4BXX I;  2YAD A;  3F3F C;  4NBG A;  3OW2 Z;  2JA8 I;  4MH4 A;  3H0G I;  4EWC A;  3I4N I;  1YHQ Z;  3CME Z;  3HOV I;  1S7M A;  2Q4Z A;  1I50 I;  4A3E I;  2QEX Z;  2WAQ A;  1X0T A;  3CCM 1;  2RT9 A;  4DQY B;  3GKQ A;  2OOY B;  4RVF A;  2OTL 1;  2OZK A;  2QRE B;  1M90 2;  1RO0 A;  1TWG I;  3HKZ A;  3JAM b;  5C4X I;  1YUK A;  3OW2 Y;  1VQN Z;  3RZO I;  3GTP I;  3CD6 Z;  1VQP 1;  3D6W A;  3CPW Z;  3CCS Z;  1YI2 1;  2NVT I;  2QKD A;  1PFT A;  1Q81 1;  1YHQ 1;  1VQK 1;  3CME 1;  5A2Q f;  4A3J I;  1Q7Y 2;  1LQL A;  4NB9 A;  2JA6 I;  1K83 I;  1ML8 A;  4HGY A;  3CPW Y;  2B63 I;  1X3Z A;  4RVH A;  1DL6 A;  1WCM I;  3LUS A;  2M6N A;  2NVY I;  3EER A;  2NVX I;  1KD1 1;  3NFZ A;  1VQN 1;  1KC8 1;  4E2W A;  1NP6 A;  3CCS 1;  3CCE Z;  1K73 1;  3IFU A;  2PM9 A;  2RHB A;  3BG0 B;  1Q82 1;  3NH4 A;  1VQM Z;  1VQ6 Z;  3U50 C;  4NBD A;  3S14 I;  4Y7N I;  3GTQ I;  4A3I I;  1VQ8 Z;  3HOU I;  3FKI I;  3S17 I;  2HF1 A;  1KQS Z;  3CQZ I;  2LIY A;  3I55 Z;  3CCJ Z;  1YUA A;  2NVQ I;  2G2K A;  5IT9 f;  4E32 A;  2PMZ A;  3GTM I;  1JJ2 Z;  4A3K I;  3PO3 I;  1M90 1;  3S2D I;  1QVG Z;  1KQS Y;  2O4H A;  2JA5 I;  1I3Q I;  4A3L I;  1QVF Z;  3S15 I;  1RLY A;  1VQ6 1;  3CC7 Z;  4MXU A;  2Q51 A;  1K9M 2;  2E9H A;  3G4S 1;  1TWA I;  1M1K 2;  1VQ4 Z;  1Z03 A;  3IF8 A;  3G6E 1;  3J7A 4;  1VQ8 1;  5IP9 I;  4NFR A;  1KRL A;  4A3F I;  1NJI 2;  3CCJ 1;  4E2Z A;  3J81 f;  2QA4 Z;  1JJ2 Y;  1YI2 Z;  1S72 1;  4A3G I;  3J80 f;  1ZB9 A;  2GTI A;  1Q7Y 1;  2VF1 A;  1QVG Y;  1VQ9 Z;  4XX2 A;  2F4M A;  3TE5 B;  1VQK Z;  3CCU 1;  1QVF Y;  4NBB A;  1L1O C;  1ZH1 A;  2BJO A;  4E30 A;  3I56 Z;  2R6M A;  3S1N I;  5T67 A;  3D9X A;  3CC7 1;  2JMO A;  1VQ4 1;  4BBR I;  3GTM S;  2V8I A;  3F3P C;  3PO3 S;  1N8R 1;  3NDI A;  2QA4 1;  2ZAE B;  1Z02 A;  3CXC Z;  1VQ9 1;  1N2F A;  5C3E I;  4MD9 A;  5IP7 I;  3GTG I;  1TWC I;  4NBF A;  1RNI A;  5A2Q b;  1QYP A;  4MRI A;  4RS4 A;  3I56 1;  5AN9 F;  4A3D I;  2K3R A;  3NDJ A;  4DK1 A;  4NBA A;  5T6B A;  3GTL I;  3TDH B;  5C4J I;  3K7A I;  1VQO Z;  2V8K A;  3CXC Y;  1W2B Z;  2AKL A;  1YIT 1;  2JUB A;  1K9M 1;  1VQ5 Z;  3VB9 A;  3CC2 Z;  4BBS I;  3HOY I;  1VQL Z;  4MON A;  4E33 A;  3G4S Z;  3Q87 A;  4NBE A;  3G6E Z;  1YJN Z;  4MD8 A;  4Y52 I;  1WW9 A;  1WII A;  2KPI A;  1W2B Y;  2DE7 A;  5D1O B;  1S72 Z;  3H3V J;  1JWH C;  3T4N B;  2F4O A;  2HU9 A;  3PO2 I;  2H85 A;  4RV9 A;  2E2H I;  3CCU Z;  1VQO 1;  5IT9 b;  2VUM I;  4TNU A;  2RBL A;  4CL1 A;  1VQ5 1;  3CC2 1;  3CCL Z;  2JS4 A;  2JA7 I;  3G71 Z;  1VQL 1;  4NBH A;  5D1P A;  5FLX b;  5C44 I;  3VMG A;  1TWF I;  3VMH A;  1P9N A;  1YJN 1;  1YIJ Z;  1Q86 2;  2M48 A;  4RVD A;  1Z01 A;  2R93 I;  3CCV Z;  3CMA 1;  3J81 b;  1KC8 2;  1ZB8 A;  3KIH A;  5FLM I;  3J80 b;  3IX0 A;  1K73 2;  2QR1 B;  4X6A I;  1Y1W I;  2I3C A;  4E31 A;  1Q82 2;  2GU2 A;  1RO2 A;  3MZL B;  1K8A 2;  3CCL 1;  2OOX B;  4NBC A;  2QLV B;  5D1O A;  3G71 1;  1TWH I;  2JR6 A;  2W04 A;  3BG1 B;  2O53 A;  1YIJ 1;  3NH8 A;  4S1T A;  3P5J B;  4NH1 C;  2JNY A;  2RIQ A;  3CCV 1;  2WB1 A;  1YIT Z;  3S2H I;  4QTU A;  2EGT A;  3JAM f;  3ESW A;  2YU9 I;  3I07 A;  3CCQ Z;  3S1M I;  1YJ9 Z;  2E2I I;  3HOW I;  2PK7 A;  2VUG A;  4E2X A;  1Y1V I;  1NUI A;  3FQQ A;  5CM2 M;  3HOZ I;  2GTH A;  1R9T I;  2OTJ Z;  3CC4 Z;  4QTT A;  3VMI A;  1USP A;  1SFO I;  4HH4 A;  3I4M I;  1X3W A;  2LFU A;  1M1K 1;  2QEX 1;  1Q86 1;  2Y0S A;  2P28 A;  1RO4 A;  3S1R I;  1NJI 1;  3VTN A;  3CCQ 1;  2RPR A;  4DGL A;  1YJ9 1;  2DE6 A;  3GTJ I;  2W03 A;  3CD6 1;  2K5R A;  3CMA Z;  1YJW Z;  1VQ7 Z;  3M3Y I;  3GCF A;  4A93 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...