2YADA

Brichos domain of surfactant protein c precursor protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
77
Chain Sequence
TTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLGMAVSTLCGEVPLYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURFACTANT PROTEIN C BRICHOS DOMAIN
publication title High Resolution Structure of a Bricos Domain and its Implications for Anti-Amyloid Chaperone Activity on Lung Surgactant Protein C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Surfactant protein
total genus 14
structure length 77
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04089 BRICHOS BRICHOS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.460 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yadA00
2YADA
chains in the Genus database with same CATH superfamily
1L1OC 3NFZA 1YJ91 1YIJZ 1P9NA 5CM2M 1VQ6Z 1Y1VI 1QVFY 1M1K1 4A93I 2E2HI 2E2II 3CCQZ 3S15I 3S14I 2NVYI 2F4OA 3BG0B 3D2LA 3S17I 3I4NI 1NP6A 3Q87A 2JIRA 2K3RA 4NB9A 3RZDI 3GTMS 2BJOA 3J7A4 4A3EI 2JIOA 1S721 1QVGZ 1I50I 1N8R1 3CCRZ 2R6MA 4NBEA 4MRIA 2P3YA 4EWCA 1TWFI 2OTLZ 1FDOA 3H0GI 1WW9A 4A3CI 1PFTA 1RLYA 1Q822 2W03A 1Q861 2VUGA 3J81b 1WZNA 2DE7A 4XX2A 2F4MA 2B63I 5AN9F 3S1MI 4QTUA 4BXXI 3CCUZ 2QEXZ 2RBLA 3CXCZ 1YUAA 4NFRA 2JIPA 4A3DI 2K5RA 1KQSZ 2V8KA 5LL6f 1I6HI 1M1K2 4QTTA 1TWGI 1KC81 3I07A 4E31A 1VQ7Z 4NH1C 3T4NB 3VMHA 3MZLB 1VQ9Z 4S1TA 2RIQA 2OZKA 4NB8A 3I55Z 2QA4Z 4RVGA 2OTJ1 2VF1A 3D9XA 3VMGA 1N8R2 1X3ZA 3G711 5IP7I 3PO2I 3CCLZ 1TWHI 2DE6A 1NUIA 1VQKZ 3NH8A 2JIMA 3GTKI 1K9M1 1Q862 3GTPI 1Q811 3CC2Z 3GTGI 1ML8A 2W04A 2R93I 1KRLA 2H85A 4NOZA 2QRCB 1VQLZ 2WB1A 3S16I 4RVFA 4Y7NI 3TDHB 1K8A1 4HH4A 4NBFA 4E2ZA 1I3QI 4RV9A 3HOYI 4E32A 1W2BY 1WJ2A 5T64A 1KC82 1M901 3HOWI 4HGZA 2V3VA 3CMAZ 1YHQ1 1YUKA 2VPXA 3CPWY 1YJ9Z 1USPA 1YJN1 3G6E1 3CCV1 3D6WA 1YI21 3FQQA 3CD6Z 4A3KI 1YIJ1 1VQ61 1K731 3NH4A 2JA5I 2GTHA 2IZ4A 2PM9A 1YJW1 2LFUA 4RVHA 5D1OB 1K9M2 3FKII 3G4SZ 3HKZA 1Q812 2M6NA 3GKQA 4MD7A 3GTJI 2QRDB 3CC41 2O4HA 4X6AI 2NAPA 3CCEZ 2LEXA 1WCMI 1YITZ 2JA8I 2G2KA 1N2FA 1K8A2 1AA6A 3RZOI 1USPB 4DK1A 2JNYA 3I56Z 1JJ2Y 3M4OI 1M902 3CCSZ 4NBAA 4NBBA 3OW2Y 2Q51A 2PMZA 1VQ41 2OTL1 1VQP1 2RPRA 3CC7Z 1RNIA 1VQMZ 2V8IA 3IX0A 2VUMI 3PO3S 3F3FC 1ZH1A 1KD11 2JR6A 2KI7B 2JUBA 2KPIA 2J6AA 3VTNA 2V8JA 4A3MI 3NDIA 4A3BI 3CCJ1 1K732 2OTJZ 3KIHA 4RS4A 2EGTA 4A3II 5FLXf 1VQ71 4DGLA 1VQ91 3GTMI 3G71Z 2GU2A 1QVFZ 1LQLA 3CPWZ 1VQ5Z 5C4JI 2HU9A 3M3YI 2RT9A 2E7ZA 2JIQA 3HOZI 4A3GI 5C44I 2E2JI 2OOYB 3CME1 3QWUA 3P5JB 1VQOZ 3CCL1 1QF8A 1Q16A 2AKLA 4MD9A 3K7AI 4MH4A 3JAMf 1VQNZ 4A3LI 3KIFA 2Q4ZA 1RO4A 3CXCY 1Z01A 2DE5A 3MZKB 2JA6I 4Y52I 3CC21 3CCM1 5C4XI 1KD12 2JS4A 4NBCA 4DQYB 2O53A 2IZ3A 3TE5B 1VQ81 3HOUI 4A3JI 2ZAEB 2LIYA 3MONA 1X3WA 2GTIA 4NBDA 2WAQA 2Y0SA 4BBSI 3NDJA 1RO2A 3J80f 1RQFA 1ZB9A 5D1PA 3HOXI 3ESWA 3S1QI 5FLMI 1R9TI 2I3CA 3S2HI 3I4MI 3VB9A 3LUSA 1VLAA 2QLVB 1YJWZ 3CCQ1 1S72Z 2NVTI 3CD61 2M48A 4NBHA 3CC4Z 1Y8CA 2HF1A 4MXUA 3IF8A 4BY1I 3EEDA 1Q7Y1 1NJI1 3U50C 1X0TA 4E2YA 2NVQI 3S1NI 2YU9I 3G4S1 3CCR1 1ZB8A 5A2Qf 4E33A 3JAMb 4AYBA 3GCFA 4E2XA 3CCE1 4BBRI 1WIIA 4A3FI 1VQ4Z 3CQZI 3IFUA 1VQPZ 1YIT1 1Y1WI 2JA7I 2NVXI 1FDIA 4BY7I 1TWAI 1TWCI 3I561 3CCS1 2VPYA 1SFOI 5T6BA 2IV2X 3CCU1 2V45A 3H3VJ 2QEX1 1QXFA 1TFIA 1Z02A 2YADA 1K83I 4E2WA 5IT9f 3J80b 3CC71 3CCJZ 1W2BZ 1VQM1 1Y1VS 1SIWA 3S1RI 5IP9I 4RVDA 2QKDA 2R92I 1QVGY 5T67A 3IR7A 2RHBA 5C3EI 3I551 2QA41 1Q7Y2 4CL1A 3GTOI 1NJI2 4E30A 3VMIA 1JWHC 2QREB 2R7ZI 3BG1B 3GTQI 3S2DI 2PK7A 2QR1B 3CMEZ 4NBGA 1VQ51 3FQMA 3HOVI 1VQK1 5A2Qb 2VPWA 2JMOA 1QYPA 2AYDA 1KQSY 4TNUA 1Z03A 4HGYA 3CCMZ 3F3PC 3GTLI 1VQO1 1VQL1 1YHQZ 3J81f 2VPZA 2E9HA 4MD8A 3NH5A 4MONA 1VQ8Z 3PO3I 3EERA 5D1OA 1S7MA 2P28A 1YJNZ 1Q821 3G6EZ 1JJ2Z 1VQN1 3CCVZ 1RO0A 2OOXB 1YI2Z 3OW2Z 5IT9b 3CMA1 1DL6A 5FLXb
chains in the Genus database with same CATH topology
1L1OC 3NFZA 1YJ91 1YIJZ 1P9NA 5CM2M 1VQ6Z 1Y1VI 1QVFY 1M1K1 4A93I 2E2HI 2E2II 3CCQZ 3S15I 3S14I 2NVYI 2F4OA 3BG0B 3S17I 3I4NI 1NP6A 3Q87A 2K3RA 4NB9A 3RZDI 3GTMS 2BJOA 3J7A4 4A3EI 1S721 1QVGZ 1I50I 1N8R1 3CCRZ 2R6MA 4NBEA 4MRIA 2P3YA 4EWCA 1TWFI 2OTLZ 3H0GI 1WW9A 4A3CI 1PFTA 1RLYA 1Q822 2W03A 1Q861 2VUGA 3J81b 2DE7A 4XX2A 2F4MA 2B63I 5AN9F 3S1MI 4QTUA 4BXXI 3CCUZ 2QEXZ 2RBLA 3CXCZ 1YUAA 4NFRA 4A3DI 2K5RA 1KQSZ 2V8KA 5LL6f 1I6HI 1M1K2 4QTTA 1TWGI 1KC81 3I07A 4E31A 1VQ7Z 4NH1C 3T4NB 3VMHA 3MZLB 1VQ9Z 4S1TA 2RIQA 2OZKA 4NB8A 3I55Z 2QA4Z 4RVGA 2OTJ1 2VF1A 3D9XA 3VMGA 1N8R2 1X3ZA 3G711 5IP7I 3PO2I 3CCLZ 1TWHI 2DE6A 1NUIA 1VQKZ 3NH8A 3GTKI 1K9M1 1Q862 3GTPI 1Q811 3CC2Z 3GTGI 1ML8A 2W04A 2R93I 1KRLA 2H85A 4NOZA 2QRCB 1VQLZ 2WB1A 3S16I 4RVFA 4Y7NI 3TDHB 1K8A1 4HH4A 4NBFA 4E2ZA 1I3QI 4RV9A 3HOYI 4E32A 1W2BY 5T64A 1KC82 1M901 3HOWI 4HGZA 3CMAZ 1YHQ1 1YUKA 3CPWY 1YJ9Z 1USPA 1YJN1 3G6E1 3CCV1 3D6WA 1YI21 3FQQA 3CD6Z 4A3KI 1YIJ1 1VQ61 1K731 3NH4A 2JA5I 2GTHA 2IZ4A 2PM9A 1YJW1 2LFUA 4RVHA 5D1OB 1K9M2 3FKII 3G4SZ 3HKZA 1Q812 2M6NA 3GKQA 4MD7A 3GTJI 2QRDB 3CC41 2O4HA 4X6AI 3CCEZ 1WCMI 1YITZ 2JA8I 2G2KA 1N2FA 1K8A2 3RZOI 1USPB 4DK1A 2JNYA 3I56Z 1JJ2Y 3M4OI 1M902 3CCSZ 4NBAA 4NBBA 3OW2Y 2Q51A 2PMZA 1VQ41 2OTL1 1VQP1 2RPRA 3CC7Z 1RNIA 1VQMZ 2V8IA 3IX0A 2VUMI 3PO3S 3F3FC 1ZH1A 1KD11 2JR6A 2KI7B 2JUBA 2KPIA 2J6AA 3VTNA 2V8JA 4A3MI 3NDIA 4A3BI 3CCJ1 1K732 2OTJZ 3KIHA 4RS4A 2EGTA 4A3II 5FLXf 1VQ71 4DGLA 1VQ91 3GTMI 3G71Z 2GU2A 1QVFZ 1LQLA 3CPWZ 1VQ5Z 5C4JI 2HU9A 3M3YI 2RT9A 3HOZI 4A3GI 5C44I 2E2JI 2OOYB 3CME1 3QWUA 3P5JB 1VQOZ 3CCL1 1QF8A 2AKLA 4MD9A 3K7AI 4MH4A 3JAMf 1VQNZ 4A3LI 3KIFA 2Q4ZA 1RO4A 3CXCY 1Z01A 2DE5A 3MZKB 2JA6I 4Y52I 3CC21 3CCM1 5C4XI 1KD12 2JS4A 4NBCA 4DQYB 2O53A 2IZ3A 3TE5B 1VQ81 3HOUI 4A3JI 2ZAEB 2LIYA 3MONA 1X3WA 2GTIA 4NBDA 2WAQA 2Y0SA 4BBSI 3NDJA 1RO2A 3J80f 1RQFA 1ZB9A 5D1PA 3HOXI 3ESWA 3S1QI 5FLMI 1R9TI 2I3CA 3S2HI 3I4MI 3VB9A 3LUSA 1VLAA 2QLVB 1YJWZ 3CCQ1 1S72Z 2NVTI 3CD61 2M48A 4NBHA 3CC4Z 2HF1A 4MXUA 3IF8A 4BY1I 3EEDA 1Q7Y1 1NJI1 3U50C 1X0TA 4E2YA 2NVQI 3S1NI 2YU9I 3G4S1 3CCR1 1ZB8A 5A2Qf 4E33A 3JAMb 4AYBA 3GCFA 4E2XA 3CCE1 4BBRI 1WIIA 4A3FI 1VQ4Z 3CQZI 3IFUA 1VQPZ 1YIT1 1Y1WI 2JA7I 2NVXI 4BY7I 1TWAI 1TWCI 3I561 3CCS1 1SFOI 5T6BA 3CCU1 3H3VJ 2QEX1 1TFIA 1Z02A 2YADA 1K83I 4E2WA 5IT9f 3J80b 3CC71 3CCJZ 1W2BZ 1VQM1 1Y1VS 3S1RI 5IP9I 4RVDA 2QKDA 2R92I 1QVGY 5T67A 2RHBA 5C3EI 3I551 2QA41 1Q7Y2 4CL1A 3GTOI 1NJI2 4E30A 3VMIA 1JWHC 2QREB 2R7ZI 3BG1B 3GTQI 3S2DI 2PK7A 2QR1B 3CMEZ 4NBGA 1VQ51 3FQMA 3HOVI 1VQK1 5A2Qb 2JMOA 1QYPA 1KQSY 4TNUA 1Z03A 4HGYA 3CCMZ 3F3PC 3GTLI 1VQO1 1VQL1 1YHQZ 3J81f 2E9HA 4MD8A 3NH5A 4MONA 1VQ8Z 3PO3I 3EERA 5D1OA 1S7MA 2P28A 1YJNZ 1Q821 3G6EZ 1JJ2Z 1VQN1 3CCVZ 1RO0A 2OOXB 1YI2Z 3OW2Z 5IT9b 3CMA1 1DL6A 5FLXb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YAD A; 
#chains in the Genus database with same CATH topology
 1L1O C;  3NFZ A;  1YJ9 1;  1YIJ Z;  1P9N A;  5CM2 M;  1VQ6 Z;  1Y1V I;  1QVF Y;  1M1K 1;  4A93 I;  2E2H I;  2E2I I;  3CCQ Z;  3S15 I;  3S14 I;  2NVY I;  2F4O A;  3BG0 B;  3D2L A;  3S17 I;  3I4N I;  1NP6 A;  3Q87 A;  2JIR A;  2K3R A;  4NB9 A;  3RZD I;  3GTM S;  2BJO A;  3J7A 4;  4A3E I;  2JIO A;  1S72 1;  1QVG Z;  1I50 I;  1N8R 1;  3CCR Z;  2R6M A;  4NBE A;  4MRI A;  2P3Y A;  4EWC A;  1TWF I;  2OTL Z;  1FDO A;  3H0G I;  1WW9 A;  4A3C I;  1PFT A;  1RLY A;  1Q82 2;  2W03 A;  1Q86 1;  2VUG A;  3J81 b;  1WZN A;  2DE7 A;  4XX2 A;  2F4M A;  2B63 I;  5AN9 F;  3S1M I;  4QTU A;  4BXX I;  3CCU Z;  2QEX Z;  2RBL A;  3CXC Z;  1YUA A;  4NFR A;  2JIP A;  4A3D I;  2K5R A;  1KQS Z;  2V8K A;  5LL6 f;  1I6H I;  1M1K 2;  4QTT A;  1TWG I;  1KC8 1;  3I07 A;  4E31 A;  1VQ7 Z;  4NH1 C;  3T4N B;  3VMH A;  3MZL B;  1VQ9 Z;  4S1T A;  2RIQ A;  2OZK A;  4NB8 A;  3I55 Z;  2QA4 Z;  4RVG A;  2OTJ 1;  2VF1 A;  3D9X A;  3VMG A;  1N8R 2;  1X3Z A;  3G71 1;  5IP7 I;  3PO2 I;  3CCL Z;  1TWH I;  2DE6 A;  1NUI A;  1VQK Z;  3NH8 A;  2JIM A;  3GTK I;  1K9M 1;  1Q86 2;  3GTP I;  1Q81 1;  3CC2 Z;  3GTG I;  1ML8 A;  2W04 A;  2R93 I;  1KRL A;  2H85 A;  4NOZ A;  2QRC B;  1VQL Z;  2WB1 A;  3S16 I;  4RVF A;  4Y7N I;  3TDH B;  1K8A 1;  4HH4 A;  4NBF A;  4E2Z A;  1I3Q I;  4RV9 A;  3HOY I;  4E32 A;  1W2B Y;  1WJ2 A;  5T64 A;  1KC8 2;  1M90 1;  3HOW I;  4HGZ A;  2V3V A;  3CMA Z;  1YHQ 1;  1YUK A;  2VPX A;  3CPW Y;  1YJ9 Z;  1USP A;  1YJN 1;  3G6E 1;  3CCV 1;  3D6W A;  1YI2 1;  3FQQ A;  3CD6 Z;  4A3K I;  1YIJ 1;  1VQ6 1;  1K73 1;  3NH4 A;  2JA5 I;  2GTH A;  2IZ4 A;  2PM9 A;  1YJW 1;  2LFU A;  4RVH A;  5D1O B;  1K9M 2;  3FKI I;  3G4S Z;  3HKZ A;  1Q81 2;  2M6N A;  3GKQ A;  4MD7 A;  3GTJ I;  2QRD B;  3CC4 1;  2O4H A;  4X6A I;  2NAP A;  3CCE Z;  2LEX A;  1WCM I;  1YIT Z;  2JA8 I;  2G2K A;  1N2F A;  1K8A 2;  1AA6 A;  3RZO I;  1USP B;  4DK1 A;  2JNY A;  3I56 Z;  1JJ2 Y;  3M4O I;  1M90 2;  3CCS Z;  4NBA A;  4NBB A;  3OW2 Y;  2Q51 A;  2PMZ A;  1VQ4 1;  2OTL 1;  1VQP 1;  2RPR A;  3CC7 Z;  1RNI A;  1VQM Z;  2V8I A;  3IX0 A;  2VUM I;  3PO3 S;  3F3F C;  1ZH1 A;  1KD1 1;  2JR6 A;  2KI7 B;  2JUB A;  2KPI A;  2J6A A;  3VTN A;  2V8J A;  4A3M I;  3NDI A;  4A3B I;  3CCJ 1;  1K73 2;  2OTJ Z;  3KIH A;  4RS4 A;  2EGT A;  4A3I I;  5FLX f;  1VQ7 1;  4DGL A;  1VQ9 1;  3GTM I;  3G71 Z;  2GU2 A;  1QVF Z;  1LQL A;  3CPW Z;  1VQ5 Z;  5C4J I;  2HU9 A;  3M3Y I;  2RT9 A;  2E7Z A;  2JIQ A;  3HOZ I;  4A3G I;  5C44 I;  2E2J I;  2OOY B;  3CME 1;  3QWU A;  3P5J B;  1VQO Z;  3CCL 1;  1QF8 A;  1Q16 A;  2AKL A;  4MD9 A;  3K7A I;  4MH4 A;  3JAM f;  1VQN Z;  4A3L I;  3KIF A;  2Q4Z A;  1RO4 A;  3CXC Y;  1Z01 A;  2DE5 A;  3MZK B;  2JA6 I;  4Y52 I;  3CC2 1;  3CCM 1;  5C4X I;  1KD1 2;  2JS4 A;  4NBC A;  4DQY B;  2O53 A;  2IZ3 A;  3TE5 B;  1VQ8 1;  3HOU I;  4A3J I;  2ZAE B;  2LIY A;  3MON A;  1X3W A;  2GTI A;  4NBD A;  2WAQ A;  2Y0S A;  4BBS I;  3NDJ A;  1RO2 A;  3J80 f;  1RQF A;  1ZB9 A;  5D1P A;  3HOX I;  3ESW A;  3S1Q I;  5FLM I;  1R9T I;  2I3C A;  3S2H I;  3I4M I;  3VB9 A;  3LUS A;  1VLA A;  2QLV B;  1YJW Z;  3CCQ 1;  1S72 Z;  2NVT I;  3CD6 1;  2M48 A;  4NBH A;  3CC4 Z;  1Y8C A;  2HF1 A;  4MXU A;  3IF8 A;  4BY1 I;  3EED A;  1Q7Y 1;  1NJI 1;  3U50 C;  1X0T A;  4E2Y A;  2NVQ I;  3S1N I;  2YU9 I;  3G4S 1;  3CCR 1;  1ZB8 A;  5A2Q f;  4E33 A;  3JAM b;  4AYB A;  3GCF A;  4E2X A;  3CCE 1;  4BBR I;  1WII A;  4A3F I;  1VQ4 Z;  3CQZ I;  3IFU A;  1VQP Z;  1YIT 1;  1Y1W I;  2JA7 I;  2NVX I;  1FDI A;  4BY7 I;  1TWA I;  1TWC I;  3I56 1;  3CCS 1;  2VPY A;  1SFO I;  5T6B A;  2IV2 X;  3CCU 1;  2V45 A;  3H3V J;  2QEX 1;  1QXF A;  1TFI A;  1Z02 A;  2YAD A;  1K83 I;  4E2W A;  5IT9 f;  3J80 b;  3CC7 1;  3CCJ Z;  1W2B Z;  1VQM 1;  1Y1V S;  1SIW A;  3S1R I;  5IP9 I;  4RVD A;  2QKD A;  2R92 I;  1QVG Y;  5T67 A;  3IR7 A;  2RHB A;  5C3E I;  3I55 1;  2QA4 1;  1Q7Y 2;  4CL1 A;  3GTO I;  1NJI 2;  4E30 A;  3VMI A;  1JWH C;  2QRE B;  2R7Z I;  3BG1 B;  3GTQ I;  3S2D I;  2PK7 A;  2QR1 B;  3CME Z;  4NBG A;  1VQ5 1;  3FQM A;  3HOV I;  1VQK 1;  5A2Q b;  2VPW A;  2JMO A;  1QYP A;  2AYD A;  1KQS Y;  4TNU A;  1Z03 A;  4HGY A;  3CCM Z;  3F3P C;  3GTL I;  1VQO 1;  1VQL 1;  1YHQ Z;  3J81 f;  2VPZ A;  2E9H A;  4MD8 A;  3NH5 A;  4MON A;  1VQ8 Z;  3PO3 I;  3EER A;  5D1O A;  1S7M A;  2P28 A;  1YJN Z;  1Q82 1;  3G6E Z;  1JJ2 Z;  1VQN 1;  3CCV Z;  1RO0 A;  2OOX B;  1YI2 Z;  3OW2 Z;  5IT9 b;  3CMA 1;  1DL6 A;  5FLX b; 
#chains in the Genus database with same CATH homology
 1L1O C;  3NFZ A;  1YJ9 1;  1YIJ Z;  1P9N A;  5CM2 M;  1VQ6 Z;  1Y1V I;  1QVF Y;  1M1K 1;  4A93 I;  2E2H I;  2E2I I;  3CCQ Z;  3S15 I;  3S14 I;  2NVY I;  2F4O A;  3BG0 B;  3S17 I;  3I4N I;  1NP6 A;  3Q87 A;  2K3R A;  4NB9 A;  3RZD I;  3GTM S;  2BJO A;  3J7A 4;  4A3E I;  1S72 1;  1QVG Z;  1I50 I;  1N8R 1;  3CCR Z;  2R6M A;  4NBE A;  4MRI A;  2P3Y A;  4EWC A;  1TWF I;  2OTL Z;  3H0G I;  1WW9 A;  4A3C I;  1PFT A;  1RLY A;  1Q82 2;  2W03 A;  1Q86 1;  2VUG A;  3J81 b;  2DE7 A;  4XX2 A;  2F4M A;  2B63 I;  5AN9 F;  3S1M I;  4QTU A;  4BXX I;  3CCU Z;  2QEX Z;  2RBL A;  3CXC Z;  1YUA A;  4NFR A;  4A3D I;  2K5R A;  1KQS Z;  2V8K A;  5LL6 f;  1I6H I;  1M1K 2;  4QTT A;  1TWG I;  1KC8 1;  3I07 A;  4E31 A;  1VQ7 Z;  4NH1 C;  3T4N B;  3VMH A;  3MZL B;  1VQ9 Z;  4S1T A;  2RIQ A;  2OZK A;  4NB8 A;  3I55 Z;  2QA4 Z;  4RVG A;  2OTJ 1;  2VF1 A;  3D9X A;  3VMG A;  1N8R 2;  1X3Z A;  3G71 1;  5IP7 I;  3PO2 I;  3CCL Z;  1TWH I;  2DE6 A;  1NUI A;  1VQK Z;  3NH8 A;  3GTK I;  1K9M 1;  1Q86 2;  3GTP I;  1Q81 1;  3CC2 Z;  3GTG I;  1ML8 A;  2W04 A;  2R93 I;  1KRL A;  2H85 A;  4NOZ A;  2QRC B;  1VQL Z;  2WB1 A;  3S16 I;  4RVF A;  4Y7N I;  3TDH B;  1K8A 1;  4HH4 A;  4NBF A;  4E2Z A;  1I3Q I;  4RV9 A;  3HOY I;  4E32 A;  1W2B Y;  5T64 A;  1KC8 2;  1M90 1;  3HOW I;  4HGZ A;  3CMA Z;  1YHQ 1;  1YUK A;  3CPW Y;  1YJ9 Z;  1USP A;  1YJN 1;  3G6E 1;  3CCV 1;  3D6W A;  1YI2 1;  3FQQ A;  3CD6 Z;  4A3K I;  1YIJ 1;  1VQ6 1;  1K73 1;  3NH4 A;  2JA5 I;  2GTH A;  2IZ4 A;  2PM9 A;  1YJW 1;  2LFU A;  4RVH A;  5D1O B;  1K9M 2;  3FKI I;  3G4S Z;  3HKZ A;  1Q81 2;  2M6N A;  3GKQ A;  4MD7 A;  3GTJ I;  2QRD B;  3CC4 1;  2O4H A;  4X6A I;  3CCE Z;  1WCM I;  1YIT Z;  2JA8 I;  2G2K A;  1N2F A;  1K8A 2;  3RZO I;  1USP B;  4DK1 A;  2JNY A;  3I56 Z;  1JJ2 Y;  3M4O I;  1M90 2;  3CCS Z;  4NBA A;  4NBB A;  3OW2 Y;  2Q51 A;  2PMZ A;  1VQ4 1;  2OTL 1;  1VQP 1;  2RPR A;  3CC7 Z;  1RNI A;  1VQM Z;  2V8I A;  3IX0 A;  2VUM I;  3PO3 S;  3F3F C;  1ZH1 A;  1KD1 1;  2JR6 A;  2KI7 B;  2JUB A;  2KPI A;  2J6A A;  3VTN A;  2V8J A;  4A3M I;  3NDI A;  4A3B I;  3CCJ 1;  1K73 2;  2OTJ Z;  3KIH A;  4RS4 A;  2EGT A;  4A3I I;  5FLX f;  1VQ7 1;  4DGL A;  1VQ9 1;  3GTM I;  3G71 Z;  2GU2 A;  1QVF Z;  1LQL A;  3CPW Z;  1VQ5 Z;  5C4J I;  2HU9 A;  3M3Y I;  2RT9 A;  3HOZ I;  4A3G I;  5C44 I;  2E2J I;  2OOY B;  3CME 1;  3QWU A;  3P5J B;  1VQO Z;  3CCL 1;  1QF8 A;  2AKL A;  4MD9 A;  3K7A I;  4MH4 A;  3JAM f;  1VQN Z;  4A3L I;  3KIF A;  2Q4Z A;  1RO4 A;  3CXC Y;  1Z01 A;  2DE5 A;  3MZK B;  2JA6 I;  4Y52 I;  3CC2 1;  3CCM 1;  5C4X I;  1KD1 2;  2JS4 A;  4NBC A;  4DQY B;  2O53 A;  2IZ3 A;  3TE5 B;  1VQ8 1;  3HOU I;  4A3J I;  2ZAE B;  2LIY A;  3MON A;  1X3W A;  2GTI A;  4NBD A;  2WAQ A;  2Y0S A;  4BBS I;  3NDJ A;  1RO2 A;  3J80 f;  1RQF A;  1ZB9 A;  5D1P A;  3HOX I;  3ESW A;  3S1Q I;  5FLM I;  1R9T I;  2I3C A;  3S2H I;  3I4M I;  3VB9 A;  3LUS A;  1VLA A;  2QLV B;  1YJW Z;  3CCQ 1;  1S72 Z;  2NVT I;  3CD6 1;  2M48 A;  4NBH A;  3CC4 Z;  2HF1 A;  4MXU A;  3IF8 A;  4BY1 I;  3EED A;  1Q7Y 1;  1NJI 1;  3U50 C;  1X0T A;  4E2Y A;  2NVQ I;  3S1N I;  2YU9 I;  3G4S 1;  3CCR 1;  1ZB8 A;  5A2Q f;  4E33 A;  3JAM b;  4AYB A;  3GCF A;  4E2X A;  3CCE 1;  4BBR I;  1WII A;  4A3F I;  1VQ4 Z;  3CQZ I;  3IFU A;  1VQP Z;  1YIT 1;  1Y1W I;  2JA7 I;  2NVX I;  4BY7 I;  1TWA I;  1TWC I;  3I56 1;  3CCS 1;  1SFO I;  5T6B A;  3CCU 1;  3H3V J;  2QEX 1;  1TFI A;  1Z02 A;  2YAD A;  1K83 I;  4E2W A;  5IT9 f;  3J80 b;  3CC7 1;  3CCJ Z;  1W2B Z;  1VQM 1;  1Y1V S;  3S1R I;  5IP9 I;  4RVD A;  2QKD A;  2R92 I;  1QVG Y;  5T67 A;  2RHB A;  5C3E I;  3I55 1;  2QA4 1;  1Q7Y 2;  4CL1 A;  3GTO I;  1NJI 2;  4E30 A;  3VMI A;  1JWH C;  2QRE B;  2R7Z I;  3BG1 B;  3GTQ I;  3S2D I;  2PK7 A;  2QR1 B;  3CME Z;  4NBG A;  1VQ5 1;  3FQM A;  3HOV I;  1VQK 1;  5A2Q b;  2JMO A;  1QYP A;  1KQS Y;  4TNU A;  1Z03 A;  4HGY A;  3CCM Z;  3F3P C;  3GTL I;  1VQO 1;  1VQL 1;  1YHQ Z;  3J81 f;  2E9H A;  4MD8 A;  3NH5 A;  4MON A;  1VQ8 Z;  3PO3 I;  3EER A;  5D1O A;  1S7M A;  2P28 A;  1YJN Z;  1Q82 1;  3G6E Z;  1JJ2 Z;  1VQN 1;  3CCV Z;  1RO0 A;  2OOX B;  1YI2 Z;  3OW2 Z;  5IT9 b;  3CMA 1;  1DL6 A;  5FLX b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...