2YADA

Brichos domain of surfactant protein c precursor protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
77
Chain Sequence
TTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLGMAVSTLCGEVPLYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Surfactant protein
molecule keywords SURFACTANT PROTEIN C BRICHOS DOMAIN
publication title High Resolution Structure of a Bricos Domain and its Implications for Anti-Amyloid Chaperone Activity on Lung Surgactant Protein C.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 77
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04089 BRICHOS BRICHOS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.460 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yadA00
2YADA
chains in the Genus database with same CATH superfamily
2JA7I 3D6WA 4MD9A 4A3EI 3IR7A 4BXXI 3CC7Z 1Y1WI 3GTPI 3PO2I 2G2KA 2R6MA 1VQLZ 4XX2A 3P5JB 1X3ZA 2YADA 3G6EZ 3T4NB 3BG1B 3K7AI 2LFUA 3CCRZ 2JUBA 1FDOA 1N2FA 3CCL1 3CCU1 2HU9A 3CC2Z 1VQO1 5A2Qb 4BBRI 2VF1A 1Y1VS 2V8IA 5C44I 3M4OI 2H85A 2W03A 5T67A 1WJ2A 1USPB 3CCQZ 2Q51A 3S1MI 4A3II 3FKII 3CCSZ 2VPWA 2JR6A 2O4HA 3I551 2JIQA 1YHQ1 1S721 3CD61 1WIIA 4BY1I 3HOXI 3GTMI 5C4XI 3CCV1 3S15I 1L1OC 3VMHA 2OZKA 4MD8A 1TWHI 2R92I 4NOZA 2BJOA 2IZ4A 1RO0A 3CCMZ 3J7A4 2JIMA 1ZB8A 2QEXZ 4DQYB 3LUSA 1VQMZ 4QTTA 1YIT1 2M6NA 1FDIA 3BG0B 3CMEZ 1VLAA 2E9HA 4DK1A 1YI21 3S2DI 4MRIA 1YJNZ 3QWUA 4RS4A 2E2JI 3CC4Z 1X3WA 3F3FC 2JA8I 4DGLA 3G711 1VQ4Z 2RT9A 1YJ91 1N8R1 5IT9f 3H3VJ 2VPYA 3MZLB 1KQSY 1TWGI 1LQLA 1M902 3GTGI 5IP9I 2PMZA 1K8A1 3GTKI 3JAMf 1AA6A 2JA5I 2VUMI 2F4OA 3CC71 4NBBA 4NBCA 1WCMI 4MXUA 4S1TA 1NJI2 4HGZA 1M1K1 1VQKZ 2PM9A 3GTOI 3G6E1 1KD11 3VMGA 1S7MA 3PO3S 4Y52I 4BY7I 3CCR1 4NH1C 4NBAA 3D2LA 1VQ5Z 3CC21 3S16I 2JIOA 1Q822 3MONA 2HF1A 2RHBA 2V8JA 1ZH1A 1VQNZ 1K731 3CPWY 3G4SZ 4TNUA 3CCQ1 3H0GI 1TWAI 3KIHA 5A2Qf 3I56Z 2NVTI 2KI7B 2B63I 1Q16A 3S14I 2W04A 3TDHB 3S1RI 4QTUA 2QRDB 1ML8A 2RPRA 3Q87A 4NB8A 3HOWI 1QF8A 1RNIA 5FLXb 4RVFA 5D1OA 5LL6f 5FLXf 2JIPA 4MH4A 3J80b 4A3LI 1Q7Y1 4NBDA 1Q812 3CCUZ 2QLVB 1VQOZ 2RBLA 3CCM1 3GTLI 1VQPZ 2QRCB 5C4JI 4A3GI 2WAQA 4NFRA 2OTLZ 2RIQA 2VUGA 4E2ZA 2QEX1 1KQSZ 4EWCA 3NDIA 1VQM1 3S17I 1I50I 1VQ9Z 5CM2M 1QXFA 3CME1 3CCJ1 1K9M2 1VQ6Z 4E32A 4MD7A 1YJN1 2IZ3A 3IX0A 3S1NI 2E7ZA 1JWHC 2EGTA 3CC41 3NFZA 4CL1A 5D1PA 2DE5A 3CCVZ 4A3FI 1VQ41 2YU9I 2QA4Z 4RVGA 2GU2A 2J6AA 2P3YA 1KRLA 2ZAEB 2LEXA 5IP7I 2QR1B 3FQQA 1K8A2 2V45A 1Q861 4E31A 3J81b 4A3DI 1VQ8Z 1YJWZ 1RO2A 1Z01A 2O53A 3GTMS 4NBFA 3HKZA 5D1OB 2Q4ZA 4X6AI 1M1K2 3CPWZ 3CMAZ 1I3QI 3HOVI 3S1QI 2OTJZ 1VQK1 1Y8CA 2LIYA 4NBGA 1WZNA 1R9TI 2OOYB 1KC81 1USPA 3GTQI 1JJ2Y 3NH4A 1YIJZ 1X0TA 1VQ7Z 2VPXA 3OW2Y 3RZOI 1VQ51 1NUIA 1VQL1 1Z03A 3MZKB 2E2II 1K732 2JNYA 3M3YI 4E30A 4E2WA 3S2HI 3VB9A 3IF8A 1VQN1 1P9NA 3VTNA 3G4S1 2R7ZI 4RVDA 5C3EI 2NAPA 1TWFI 2AKLA 3I561 1QYPA 2GTIA 3CCEZ 3HOUI 5AN9F 2NVYI 1M901 2K5RA 3CCS1 1QVFY 2JA6I 1Q7Y2 1NJI1 1RLYA 3I4NI 1QVGY 4E2YA 2NVXI 2Y0SA 3NH8A 2GTHA 3CQZI 2WB1A 1VQP1 2OOXB 1TWCI 2AYDA 2OTL1 4A3BI 1YUKA 1ZB9A 1Q821 3CCLZ 3J80f 5T6BA 3RZDI 4BBSI 4NBHA 4A93I 2DE6A 1VQ91 2JIRA 1W2BZ 3F3PC 4RVHA 1RQFA 1VQ61 2PK7A 3I4MI 3GCFA 3CXCZ 1NP6A 3D9XA 3I55Z 3HOYI 1SIWA 2VPZA 1YHQZ 2JMOA 1S72Z 2QA41 3I07A 3CD6Z 1Q862 3ESWA 2V8KA 1JJ2Z 1WW9A 3OW2Z 5T64A 1N8R2 2M48A 4A3JI 4HH4A 1DL6A 2QKDA 1VQ81 2V3VA 2F4MA 1YJW1 3NH5A 1Q811 3EERA 4NB9A 1K83I 2IV2X 3TE5B 3PO3I 2K3RA 3U50C 3CMA1 2E2HI 3VMIA 4Y7NI 1KC82 2OTJ1 3HOZI 3J81f 1W2BY 2DE7A 1TFIA 3CCJZ 2P28A 3GKQA 3GTJI 2R93I 3CXCY 2QREB 1YIJ1 1RO4A 1VQ71 1K9M1 1KD12 1YITZ 1SFOI 1QVFZ 4AYBA 3KIFA 1Z02A 4E2XA 4E33A 5IT9b 1YI2Z 1YUAA 4MONA 2I3CA 1Y1VI 3FQMA 1QVGZ 2KPIA 4A3MI 1I6HI 3EEDA 3JAMb 1PFTA 3G71Z 5FLMI 4NBEA 4RV9A 2NVQI 4A3KI 1YJ9Z 3CCE1 4A3CI 3IFUA 4HGYA 3NDJA 2JS4A
chains in the Genus database with same CATH topology
2JA7I 3D6WA 4MD9A 4A3EI 4BXXI 3CC7Z 1Y1WI 3GTPI 3PO2I 2G2KA 2R6MA 1VQLZ 4XX2A 3P5JB 1X3ZA 2YADA 3G6EZ 3T4NB 3BG1B 3K7AI 2LFUA 3CCRZ 2JUBA 1N2FA 3CCL1 3CCU1 2HU9A 3CC2Z 1VQO1 5A2Qb 4BBRI 2VF1A 1Y1VS 2V8IA 5C44I 3M4OI 2H85A 2W03A 5T67A 1USPB 3CCQZ 2Q51A 3S1MI 4A3II 3FKII 3CCSZ 2JR6A 2O4HA 3I551 1YHQ1 1S721 3CD61 1WIIA 4BY1I 3HOXI 3GTMI 5C4XI 3CCV1 3S15I 1L1OC 3VMHA 2OZKA 4MD8A 1TWHI 2R92I 4NOZA 2BJOA 2IZ4A 1RO0A 3CCMZ 3J7A4 1ZB8A 2QEXZ 4DQYB 3LUSA 1VQMZ 4QTTA 1YIT1 2M6NA 3BG0B 3CMEZ 1VLAA 2E9HA 4DK1A 1YI21 3S2DI 4MRIA 1YJNZ 3QWUA 4RS4A 2E2JI 3CC4Z 1X3WA 3F3FC 2JA8I 4DGLA 3G711 1VQ4Z 2RT9A 1YJ91 1N8R1 5IT9f 3H3VJ 3MZLB 1KQSY 1TWGI 1LQLA 1M902 3GTGI 5IP9I 2PMZA 1K8A1 3GTKI 3JAMf 2JA5I 2VUMI 2F4OA 3CC71 4NBBA 4NBCA 1WCMI 4MXUA 4S1TA 1NJI2 4HGZA 1M1K1 1VQKZ 2PM9A 3GTOI 3G6E1 1KD11 3VMGA 1S7MA 3PO3S 4Y52I 4BY7I 3CCR1 4NH1C 4NBAA 1VQ5Z 3CC21 3S16I 1Q822 3MONA 2HF1A 2RHBA 2V8JA 1ZH1A 1VQNZ 1K731 3CPWY 3G4SZ 4TNUA 3CCQ1 3H0GI 1TWAI 3KIHA 5A2Qf 3I56Z 2NVTI 2KI7B 2B63I 3S14I 2W04A 3TDHB 3S1RI 4QTUA 2QRDB 1ML8A 2RPRA 3Q87A 4NB8A 3HOWI 1QF8A 1RNIA 5FLXb 4RVFA 5D1OA 5LL6f 5FLXf 4MH4A 3J80b 4A3LI 1Q7Y1 4NBDA 1Q812 3CCUZ 2QLVB 1VQOZ 2RBLA 3CCM1 3GTLI 1VQPZ 2QRCB 5C4JI 4A3GI 2WAQA 4NFRA 2OTLZ 2RIQA 2VUGA 4E2ZA 2QEX1 1KQSZ 4EWCA 3NDIA 1VQM1 3S17I 1I50I 1VQ9Z 5CM2M 3CME1 3CCJ1 1K9M2 1VQ6Z 4E32A 4MD7A 1YJN1 2IZ3A 3IX0A 3S1NI 1JWHC 2EGTA 3CC41 3NFZA 4CL1A 5D1PA 2DE5A 3CCVZ 4A3FI 1VQ41 2YU9I 2QA4Z 4RVGA 2GU2A 2J6AA 2P3YA 1KRLA 2ZAEB 5IP7I 2QR1B 3FQQA 1K8A2 1Q861 4E31A 3J81b 4A3DI 1VQ8Z 1YJWZ 1RO2A 1Z01A 2O53A 3GTMS 4NBFA 3HKZA 5D1OB 2Q4ZA 4X6AI 1M1K2 3CPWZ 3CMAZ 1I3QI 3HOVI 3S1QI 2OTJZ 1VQK1 2LIYA 4NBGA 1R9TI 2OOYB 1KC81 1USPA 3GTQI 1JJ2Y 3NH4A 1YIJZ 1X0TA 1VQ7Z 3OW2Y 3RZOI 1VQ51 1NUIA 1VQL1 1Z03A 3MZKB 2E2II 1K732 2JNYA 3M3YI 4E30A 4E2WA 3S2HI 3VB9A 3IF8A 1VQN1 1P9NA 3VTNA 3G4S1 2R7ZI 4RVDA 5C3EI 1TWFI 2AKLA 3I561 1QYPA 2GTIA 3CCEZ 3HOUI 5AN9F 2NVYI 1M901 2K5RA 3CCS1 1QVFY 2JA6I 1Q7Y2 1NJI1 1RLYA 3I4NI 1QVGY 4E2YA 2NVXI 2Y0SA 3NH8A 2GTHA 3CQZI 2WB1A 1VQP1 2OOXB 1TWCI 2OTL1 4A3BI 1YUKA 1ZB9A 1Q821 3CCLZ 3J80f 5T6BA 3RZDI 4BBSI 4NBHA 4A93I 2DE6A 1VQ91 1W2BZ 3F3PC 4RVHA 1RQFA 1VQ61 2PK7A 3I4MI 3GCFA 3CXCZ 1NP6A 3D9XA 3I55Z 3HOYI 1YHQZ 2JMOA 1S72Z 2QA41 3I07A 3CD6Z 1Q862 3ESWA 2V8KA 1JJ2Z 1WW9A 3OW2Z 5T64A 1N8R2 2M48A 4A3JI 4HH4A 1DL6A 2QKDA 1VQ81 2F4MA 1YJW1 3NH5A 1Q811 3EERA 4NB9A 1K83I 3TE5B 3PO3I 2K3RA 3U50C 3CMA1 2E2HI 3VMIA 4Y7NI 1KC82 2OTJ1 3HOZI 3J81f 1W2BY 2DE7A 1TFIA 3CCJZ 2P28A 3GKQA 3GTJI 2R93I 3CXCY 2QREB 1YIJ1 1RO4A 1VQ71 1K9M1 1KD12 1YITZ 1SFOI 1QVFZ 4AYBA 3KIFA 1Z02A 4E2XA 4E33A 5IT9b 1YI2Z 1YUAA 4MONA 2I3CA 1Y1VI 3FQMA 1QVGZ 2KPIA 4A3MI 1I6HI 3EEDA 3JAMb 1PFTA 3G71Z 5FLMI 4NBEA 4RV9A 2NVQI 4A3KI 1YJ9Z 3CCE1 4A3CI 3IFUA 4HGYA 3NDJA 2JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YAD A; 
#chains in the Genus database with same CATH topology
 2JA7 I;  3D6W A;  4MD9 A;  4A3E I;  3IR7 A;  4BXX I;  3CC7 Z;  1Y1W I;  3GTP I;  3PO2 I;  2G2K A;  2R6M A;  1VQL Z;  4XX2 A;  3P5J B;  1X3Z A;  2YAD A;  3G6E Z;  3T4N B;  3BG1 B;  3K7A I;  2LFU A;  3CCR Z;  2JUB A;  1FDO A;  1N2F A;  3CCL 1;  3CCU 1;  2HU9 A;  3CC2 Z;  1VQO 1;  5A2Q b;  4BBR I;  2VF1 A;  1Y1V S;  2V8I A;  5C44 I;  3M4O I;  2H85 A;  2W03 A;  5T67 A;  1WJ2 A;  1USP B;  3CCQ Z;  2Q51 A;  3S1M I;  4A3I I;  3FKI I;  3CCS Z;  2VPW A;  2JR6 A;  2O4H A;  3I55 1;  2JIQ A;  1YHQ 1;  1S72 1;  3CD6 1;  1WII A;  4BY1 I;  3HOX I;  3GTM I;  5C4X I;  3CCV 1;  3S15 I;  1L1O C;  3VMH A;  2OZK A;  4MD8 A;  1TWH I;  2R92 I;  4NOZ A;  2BJO A;  2IZ4 A;  1RO0 A;  3CCM Z;  3J7A 4;  2JIM A;  1ZB8 A;  2QEX Z;  4DQY B;  3LUS A;  1VQM Z;  4QTT A;  1YIT 1;  2M6N A;  1FDI A;  3BG0 B;  3CME Z;  1VLA A;  2E9H A;  4DK1 A;  1YI2 1;  3S2D I;  4MRI A;  1YJN Z;  3QWU A;  4RS4 A;  2E2J I;  3CC4 Z;  1X3W A;  3F3F C;  2JA8 I;  4DGL A;  3G71 1;  1VQ4 Z;  2RT9 A;  1YJ9 1;  1N8R 1;  5IT9 f;  3H3V J;  2VPY A;  3MZL B;  1KQS Y;  1TWG I;  1LQL A;  1M90 2;  3GTG I;  5IP9 I;  2PMZ A;  1K8A 1;  3GTK I;  3JAM f;  1AA6 A;  2JA5 I;  2VUM I;  2F4O A;  3CC7 1;  4NBB A;  4NBC A;  1WCM I;  4MXU A;  4S1T A;  1NJI 2;  4HGZ A;  1M1K 1;  1VQK Z;  2PM9 A;  3GTO I;  3G6E 1;  1KD1 1;  3VMG A;  1S7M A;  3PO3 S;  4Y52 I;  4BY7 I;  3CCR 1;  4NH1 C;  4NBA A;  3D2L A;  1VQ5 Z;  3CC2 1;  3S16 I;  2JIO A;  1Q82 2;  3MON A;  2HF1 A;  2RHB A;  2V8J A;  1ZH1 A;  1VQN Z;  1K73 1;  3CPW Y;  3G4S Z;  4TNU A;  3CCQ 1;  3H0G I;  1TWA I;  3KIH A;  5A2Q f;  3I56 Z;  2NVT I;  2KI7 B;  2B63 I;  1Q16 A;  3S14 I;  2W04 A;  3TDH B;  3S1R I;  4QTU A;  2QRD B;  1ML8 A;  2RPR A;  3Q87 A;  4NB8 A;  3HOW I;  1QF8 A;  1RNI A;  5FLX b;  4RVF A;  5D1O A;  5LL6 f;  5FLX f;  2JIP A;  4MH4 A;  3J80 b;  4A3L I;  1Q7Y 1;  4NBD A;  1Q81 2;  3CCU Z;  2QLV B;  1VQO Z;  2RBL A;  3CCM 1;  3GTL I;  1VQP Z;  2QRC B;  5C4J I;  4A3G I;  2WAQ A;  4NFR A;  2OTL Z;  2RIQ A;  2VUG A;  4E2Z A;  2QEX 1;  1KQS Z;  4EWC A;  3NDI A;  1VQM 1;  3S17 I;  1I50 I;  1VQ9 Z;  5CM2 M;  1QXF A;  3CME 1;  3CCJ 1;  1K9M 2;  1VQ6 Z;  4E32 A;  4MD7 A;  1YJN 1;  2IZ3 A;  3IX0 A;  3S1N I;  2E7Z A;  1JWH C;  2EGT A;  3CC4 1;  3NFZ A;  4CL1 A;  5D1P A;  2DE5 A;  3CCV Z;  4A3F I;  1VQ4 1;  2YU9 I;  2QA4 Z;  4RVG A;  2GU2 A;  2J6A A;  2P3Y A;  1KRL A;  2ZAE B;  2LEX A;  5IP7 I;  2QR1 B;  3FQQ A;  1K8A 2;  2V45 A;  1Q86 1;  4E31 A;  3J81 b;  4A3D I;  1VQ8 Z;  1YJW Z;  1RO2 A;  1Z01 A;  2O53 A;  3GTM S;  4NBF A;  3HKZ A;  5D1O B;  2Q4Z A;  4X6A I;  1M1K 2;  3CPW Z;  3CMA Z;  1I3Q I;  3HOV I;  3S1Q I;  2OTJ Z;  1VQK 1;  1Y8C A;  2LIY A;  4NBG A;  1WZN A;  1R9T I;  2OOY B;  1KC8 1;  1USP A;  3GTQ I;  1JJ2 Y;  3NH4 A;  1YIJ Z;  1X0T A;  1VQ7 Z;  2VPX A;  3OW2 Y;  3RZO I;  1VQ5 1;  1NUI A;  1VQL 1;  1Z03 A;  3MZK B;  2E2I I;  1K73 2;  2JNY A;  3M3Y I;  4E30 A;  4E2W A;  3S2H I;  3VB9 A;  3IF8 A;  1VQN 1;  1P9N A;  3VTN A;  3G4S 1;  2R7Z I;  4RVD A;  5C3E I;  2NAP A;  1TWF I;  2AKL A;  3I56 1;  1QYP A;  2GTI A;  3CCE Z;  3HOU I;  5AN9 F;  2NVY I;  1M90 1;  2K5R A;  3CCS 1;  1QVF Y;  2JA6 I;  1Q7Y 2;  1NJI 1;  1RLY A;  3I4N I;  1QVG Y;  4E2Y A;  2NVX I;  2Y0S A;  3NH8 A;  2GTH A;  3CQZ I;  2WB1 A;  1VQP 1;  2OOX B;  1TWC I;  2AYD A;  2OTL 1;  4A3B I;  1YUK A;  1ZB9 A;  1Q82 1;  3CCL Z;  3J80 f;  5T6B A;  3RZD I;  4BBS I;  4NBH A;  4A93 I;  2DE6 A;  1VQ9 1;  2JIR A;  1W2B Z;  3F3P C;  4RVH A;  1RQF A;  1VQ6 1;  2PK7 A;  3I4M I;  3GCF A;  3CXC Z;  1NP6 A;  3D9X A;  3I55 Z;  3HOY I;  1SIW A;  2VPZ A;  1YHQ Z;  2JMO A;  1S72 Z;  2QA4 1;  3I07 A;  3CD6 Z;  1Q86 2;  3ESW A;  2V8K A;  1JJ2 Z;  1WW9 A;  3OW2 Z;  5T64 A;  1N8R 2;  2M48 A;  4A3J I;  4HH4 A;  1DL6 A;  2QKD A;  1VQ8 1;  2V3V A;  2F4M A;  1YJW 1;  3NH5 A;  1Q81 1;  3EER A;  4NB9 A;  1K83 I;  2IV2 X;  3TE5 B;  3PO3 I;  2K3R A;  3U50 C;  3CMA 1;  2E2H I;  3VMI A;  4Y7N I;  1KC8 2;  2OTJ 1;  3HOZ I;  3J81 f;  1W2B Y;  2DE7 A;  1TFI A;  3CCJ Z;  2P28 A;  3GKQ A;  3GTJ I;  2R93 I;  3CXC Y;  2QRE B;  1YIJ 1;  1RO4 A;  1VQ7 1;  1K9M 1;  1KD1 2;  1YIT Z;  1SFO I;  1QVF Z;  4AYB A;  3KIF A;  1Z02 A;  4E2X A;  4E33 A;  5IT9 b;  1YI2 Z;  1YUA A;  4MON A;  2I3C A;  1Y1V I;  3FQM A;  1QVG Z;  2KPI A;  4A3M I;  1I6H I;  3EED A;  3JAM b;  1PFT A;  3G71 Z;  5FLM I;  4NBE A;  4RV9 A;  2NVQ I;  4A3K I;  1YJ9 Z;  3CCE 1;  4A3C I;  3IFU A;  4HGY A;  3NDJ A;  2JS4 A; 
#chains in the Genus database with same CATH homology
 2JA7 I;  3D6W A;  4MD9 A;  4A3E I;  4BXX I;  3CC7 Z;  1Y1W I;  3GTP I;  3PO2 I;  2G2K A;  2R6M A;  1VQL Z;  4XX2 A;  3P5J B;  1X3Z A;  2YAD A;  3G6E Z;  3T4N B;  3BG1 B;  3K7A I;  2LFU A;  3CCR Z;  2JUB A;  1N2F A;  3CCL 1;  3CCU 1;  2HU9 A;  3CC2 Z;  1VQO 1;  5A2Q b;  4BBR I;  2VF1 A;  1Y1V S;  2V8I A;  5C44 I;  3M4O I;  2H85 A;  2W03 A;  5T67 A;  1USP B;  3CCQ Z;  2Q51 A;  3S1M I;  4A3I I;  3FKI I;  3CCS Z;  2JR6 A;  2O4H A;  3I55 1;  1YHQ 1;  1S72 1;  3CD6 1;  1WII A;  4BY1 I;  3HOX I;  3GTM I;  5C4X I;  3CCV 1;  3S15 I;  1L1O C;  3VMH A;  2OZK A;  4MD8 A;  1TWH I;  2R92 I;  4NOZ A;  2BJO A;  2IZ4 A;  1RO0 A;  3CCM Z;  3J7A 4;  1ZB8 A;  2QEX Z;  4DQY B;  3LUS A;  1VQM Z;  4QTT A;  1YIT 1;  2M6N A;  3BG0 B;  3CME Z;  1VLA A;  2E9H A;  4DK1 A;  1YI2 1;  3S2D I;  4MRI A;  1YJN Z;  3QWU A;  4RS4 A;  2E2J I;  3CC4 Z;  1X3W A;  3F3F C;  2JA8 I;  4DGL A;  3G71 1;  1VQ4 Z;  2RT9 A;  1YJ9 1;  1N8R 1;  5IT9 f;  3H3V J;  3MZL B;  1KQS Y;  1TWG I;  1LQL A;  1M90 2;  3GTG I;  5IP9 I;  2PMZ A;  1K8A 1;  3GTK I;  3JAM f;  2JA5 I;  2VUM I;  2F4O A;  3CC7 1;  4NBB A;  4NBC A;  1WCM I;  4MXU A;  4S1T A;  1NJI 2;  4HGZ A;  1M1K 1;  1VQK Z;  2PM9 A;  3GTO I;  3G6E 1;  1KD1 1;  3VMG A;  1S7M A;  3PO3 S;  4Y52 I;  4BY7 I;  3CCR 1;  4NH1 C;  4NBA A;  1VQ5 Z;  3CC2 1;  3S16 I;  1Q82 2;  3MON A;  2HF1 A;  2RHB A;  2V8J A;  1ZH1 A;  1VQN Z;  1K73 1;  3CPW Y;  3G4S Z;  4TNU A;  3CCQ 1;  3H0G I;  1TWA I;  3KIH A;  5A2Q f;  3I56 Z;  2NVT I;  2KI7 B;  2B63 I;  3S14 I;  2W04 A;  3TDH B;  3S1R I;  4QTU A;  2QRD B;  1ML8 A;  2RPR A;  3Q87 A;  4NB8 A;  3HOW I;  1QF8 A;  1RNI A;  5FLX b;  4RVF A;  5D1O A;  5LL6 f;  5FLX f;  4MH4 A;  3J80 b;  4A3L I;  1Q7Y 1;  4NBD A;  1Q81 2;  3CCU Z;  2QLV B;  1VQO Z;  2RBL A;  3CCM 1;  3GTL I;  1VQP Z;  2QRC B;  5C4J I;  4A3G I;  2WAQ A;  4NFR A;  2OTL Z;  2RIQ A;  2VUG A;  4E2Z A;  2QEX 1;  1KQS Z;  4EWC A;  3NDI A;  1VQM 1;  3S17 I;  1I50 I;  1VQ9 Z;  5CM2 M;  3CME 1;  3CCJ 1;  1K9M 2;  1VQ6 Z;  4E32 A;  4MD7 A;  1YJN 1;  2IZ3 A;  3IX0 A;  3S1N I;  1JWH C;  2EGT A;  3CC4 1;  3NFZ A;  4CL1 A;  5D1P A;  2DE5 A;  3CCV Z;  4A3F I;  1VQ4 1;  2YU9 I;  2QA4 Z;  4RVG A;  2GU2 A;  2J6A A;  2P3Y A;  1KRL A;  2ZAE B;  5IP7 I;  2QR1 B;  3FQQ A;  1K8A 2;  1Q86 1;  4E31 A;  3J81 b;  4A3D I;  1VQ8 Z;  1YJW Z;  1RO2 A;  1Z01 A;  2O53 A;  3GTM S;  4NBF A;  3HKZ A;  5D1O B;  2Q4Z A;  4X6A I;  1M1K 2;  3CPW Z;  3CMA Z;  1I3Q I;  3HOV I;  3S1Q I;  2OTJ Z;  1VQK 1;  2LIY A;  4NBG A;  1R9T I;  2OOY B;  1KC8 1;  1USP A;  3GTQ I;  1JJ2 Y;  3NH4 A;  1YIJ Z;  1X0T A;  1VQ7 Z;  3OW2 Y;  3RZO I;  1VQ5 1;  1NUI A;  1VQL 1;  1Z03 A;  3MZK B;  2E2I I;  1K73 2;  2JNY A;  3M3Y I;  4E30 A;  4E2W A;  3S2H I;  3VB9 A;  3IF8 A;  1VQN 1;  1P9N A;  3VTN A;  3G4S 1;  2R7Z I;  4RVD A;  5C3E I;  1TWF I;  2AKL A;  3I56 1;  1QYP A;  2GTI A;  3CCE Z;  3HOU I;  5AN9 F;  2NVY I;  1M90 1;  2K5R A;  3CCS 1;  1QVF Y;  2JA6 I;  1Q7Y 2;  1NJI 1;  1RLY A;  3I4N I;  1QVG Y;  4E2Y A;  2NVX I;  2Y0S A;  3NH8 A;  2GTH A;  3CQZ I;  2WB1 A;  1VQP 1;  2OOX B;  1TWC I;  2OTL 1;  4A3B I;  1YUK A;  1ZB9 A;  1Q82 1;  3CCL Z;  3J80 f;  5T6B A;  3RZD I;  4BBS I;  4NBH A;  4A93 I;  2DE6 A;  1VQ9 1;  1W2B Z;  3F3P C;  4RVH A;  1RQF A;  1VQ6 1;  2PK7 A;  3I4M I;  3GCF A;  3CXC Z;  1NP6 A;  3D9X A;  3I55 Z;  3HOY I;  1YHQ Z;  2JMO A;  1S72 Z;  2QA4 1;  3I07 A;  3CD6 Z;  1Q86 2;  3ESW A;  2V8K A;  1JJ2 Z;  1WW9 A;  3OW2 Z;  5T64 A;  1N8R 2;  2M48 A;  4A3J I;  4HH4 A;  1DL6 A;  2QKD A;  1VQ8 1;  2F4M A;  1YJW 1;  3NH5 A;  1Q81 1;  3EER A;  4NB9 A;  1K83 I;  3TE5 B;  3PO3 I;  2K3R A;  3U50 C;  3CMA 1;  2E2H I;  3VMI A;  4Y7N I;  1KC8 2;  2OTJ 1;  3HOZ I;  3J81 f;  1W2B Y;  2DE7 A;  1TFI A;  3CCJ Z;  2P28 A;  3GKQ A;  3GTJ I;  2R93 I;  3CXC Y;  2QRE B;  1YIJ 1;  1RO4 A;  1VQ7 1;  1K9M 1;  1KD1 2;  1YIT Z;  1SFO I;  1QVF Z;  4AYB A;  3KIF A;  1Z02 A;  4E2X A;  4E33 A;  5IT9 b;  1YI2 Z;  1YUA A;  4MON A;  2I3C A;  1Y1V I;  3FQM A;  1QVG Z;  2KPI A;  4A3M I;  1I6H I;  3EED A;  3JAM b;  1PFT A;  3G71 Z;  5FLM I;  4NBE A;  4RV9 A;  2NVQ I;  4A3K I;  1YJ9 Z;  3CCE 1;  4A3C I;  3IFU A;  4HGY A;  3NDJ A;  2JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...