2YADA

Brichos domain of surfactant protein c precursor protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
77
Chain Sequence
TTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLGMAVSTLCGEVPLYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURFACTANT PROTEIN C BRICHOS DOMAIN
publication title High Resolution Structure of a Bricos Domain and its Implications for Anti-Amyloid Chaperone Activity on Lung Surgactant Protein C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Surfactant protein
total genus 14
structure length 77
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04089 BRICHOS BRICHOS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.460 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2yadA00
2YADA
chains in the Genus database with same CATH superfamily
1QVGZ 4A93I 1QVGY 3KIFA 3H3VJ 4X6AI 1X0TA 1Z01A 2JA7I 1RLYA 1K83I 2M6NA 1AA6A 5D1OB 1K9M1 3CMAZ 1N8R2 2VPXA 1Q812 1K8A2 3S1MI 1VQOZ 3S1NI 3HOXI 1USPB 2WAQA 1VQM1 3PO3I 1VQL1 3J7A4 4DGLA 3CCQ1 4CL1A 3CCM1 1NJI2 1VQ8Z 3HOVI 2NVTI 3MZLB 4E33A 2ZAEB 2AYDA 2RHBA 1S7MA 4DK1A 3G6E1 3D9XA 2P28A 2YADA 2NVQI 4NBBA 2OTJZ 1Q862 2V3VA 1WW9A 3CCV1 2Q4ZA 2JNYA 4A3MI 1RO4A 1TWHI 2RBLA 1YIJ1 3S16I 2QEX1 3CCS1 4NOZA 1VQ41 1ZH1A 2F4MA 4MD7A 1VQ5Z 3CME1 2E7ZA 1KD12 2O53A 2VUMI 4BBSI 1YJW1 3I07A 3T4NB 3CC71 3FQQA 1SIWA 3GTLI 2QA41 2H85A 1Y8CA 1NJI1 2OOYB 3GTGI 5FLMI 4NH1C 4A3EI 3VMGA 4TNUA 2Y0SA 2KPIA 3CMA1 1K9M2 5FLXb 2B63I 3CQZI 2E2JI 2JA8I 2O4HA 1VQO1 1N2FA 2BJOA 1Y1VS 3ESWA 1WZNA 1VQ81 3GTPI 1KQSZ 2QRCB 4MD9A 1X3ZA 1ML8A 4NBCA 2VUGA 2JIRA 1PFTA 2W03A 3RZDI 1QVFY 1TFIA 4Y7NI 2OTJ1 2PMZA 3GTMS 3CD61 3G4SZ 4E2ZA 4E2WA 5C3EI 1VQ6Z 5C4XI 2QR1B 1YITZ 3CC4Z 3IR7A 4MONA 5T67A 3J81b 3CC2Z 1VQKZ 4E32A 1USPA 1W2BZ 3CXCZ 2OOXB 4NB8A 1W2BY 4HGYA 4EWCA 5CM2M 3CXCY 3KIHA 3I55Z 1VQ51 3F3FC 5T64A 2VPZA 3G71Z 3QWUA 1RO2A 2I3CA 4MH4A 4RV9A 3FQMA 3MZKB 1VLAA 2R7ZI 4RVGA 3BG1B 1LQLA 2HU9A 2OTLZ 4E31A 3VTNA 5A2Qb 2E9HA 4E2YA 3JAMb 3S1QI 1TWGI 2JUBA 2RPRA 3NH5A 3CCLZ 4A3FI 2IZ3A 3CCUZ 3HOWI 5FLXf 3Q87A 3FKII 1NUIA 2G2KA 2GU2A 4NBAA 1Z03A 2PK7A 5T6BA 3PO3S 3MONA 4HH4A 5AN9F 1VQ7Z 3GTQI 4RVDA 3M3YI 5IP9I 2JA5I 4QTTA 2IV2X 3G4S1 2JR6A 1QYPA 1FDIA 1M902 1ZB8A 3NH8A 1VQ61 3HOUI 1JJ2Z 1DL6A 1YIT1 3CC41 3H0GI 1JJ2Y 1YUKA 3M4OI 1I50I 3NDIA 3IF8A 2NAPA 4RVHA 1VQ9Z 3CC21 1VQK1 4RVFA 3TDHB 4DQYB 3J81f 3PO2I 1JWHC 2VPWA 4MD8A 5IT9f 3I551 4A3BI 5IP7I 3CCEZ 1R9TI 3G711 1SFOI 2JMOA 4E30A 1Y1WI 3J80b 3HOZI 3S2DI 3S15I 2P3YA 2KI7B 2LEXA 4HGZA 2QKDA 1KQSY 4A3CI 5LL6f 4XX2A 4MRIA 2OTL1 4NFRA 1Z02A 2PM9A 3GTOI 1M1K1 1Q821 2VPYA 4A3JI 2R6MA 2AKLA 2QLVB 3CPWZ 1TWAI 3VB9A 1L1OC 3CCL1 2QREB 1M901 5A2Qf 3I56Z 3HKZA 3CCU1 3CPWY 2OZKA 2LIYA 5D1OA 3JAMf 2K3RA 3NDJA 1KC81 2WB1A 1VQNZ 4NBGA 1QF8A 1YJNZ 5IT9b 3TE5B 4A3GI 2QRDB 3EERA 1VQ71 5D1PA 3CCJZ 3CC7Z 2J6AA 1TWFI 4E2XA 2VF1A 3NFZA 3CCRZ 3P5JB 3RZOI 1FDOA 3D2LA 3NH4A 2RT9A 1VQ91 1RNIA 2YU9I 5C4JI 1ZB9A 3OW2Z 4NBEA 1YJ9Z 3OW2Y 3IX0A 4MXUA 1YI2Z 2DE5A 2EGTA 3CCE1 4NBFA 2JIMA 3F3PC 2JIOA 1K732 4Y52I 2F4OA 3VMIA 2Q51A 1VQPZ 2V8JA 1YHQZ 1X3WA 2W04A 1P9NA 4QTUA 3J80f 2R92I 4BXXI 1S72Z 1M1K2 4S1TA 1Q822 3CD6Z 4A3DI 1Q7Y1 2JIPA 2JA6I 2V8IA 3I561 1I3QI 3GTKI 3GKQA 1KC82 4NBDA 1VQN1 4BBRI 1YJN1 2HF1A 3GCFA 1I6HI 2IZ4A 5C44I 2JIQA 1Y1VI 1N8R1 3D6WA 1Q811 1K8A1 3GTJI 2LFUA 2E2HI 2DE7A 3CCJ1 1NP6A 3S17I 1WIIA 3I4MI 3S14I 1VQMZ 1VQLZ 1K731 3CCQZ 1RO0A 3CCMZ 3HOYI 1QXFA 3CCR1 3GTMI 2NVXI 3IFUA 3G6EZ 2NVYI 3BG0B 2RIQA 1Q861 4NB9A 2JS4A 3I4NI 3CCVZ 1YJ91 4NBHA 2K5RA 1YI21 2E2II 4BY7I 3U50C 3VMHA 2M48A 3K7AI 4AYBA 2V8KA 1YIJZ 4A3II 1VQP1 1YHQ1 2QEXZ 3CCSZ 3LUSA 4A3LI 1QVFZ 2V45A 1Q16A 1WJ2A 1VQ4Z 3S1RI 1KRLA 1WCMI 2GTIA 1YUAA 4RS4A 1S721 1TWCI 3CMEZ 1KD11 3S2HI 3EEDA 2GTHA 4A3KI 1Q7Y2 1YJWZ 1RQFA 2DE6A 4BY1I 2QA4Z 2R93I
chains in the Genus database with same CATH topology
1QVGZ 4A93I 1QVGY 3KIFA 3H3VJ 4X6AI 1X0TA 1Z01A 2JA7I 1RLYA 1K83I 2M6NA 5D1OB 1K9M1 3CMAZ 1N8R2 1Q812 1K8A2 3S1MI 1VQOZ 3S1NI 3HOXI 1USPB 2WAQA 1VQM1 3PO3I 1VQL1 3J7A4 4DGLA 3CCQ1 4CL1A 3CCM1 1NJI2 1VQ8Z 3HOVI 2NVTI 3MZLB 4E33A 2ZAEB 2RHBA 1S7MA 4DK1A 3G6E1 3D9XA 2P28A 2YADA 2NVQI 4NBBA 2OTJZ 1Q862 1WW9A 3CCV1 2Q4ZA 2JNYA 4A3MI 1RO4A 1TWHI 2RBLA 1YIJ1 3S16I 2QEX1 3CCS1 4NOZA 1VQ41 1ZH1A 2F4MA 4MD7A 1VQ5Z 3CME1 1KD12 2O53A 2VUMI 4BBSI 1YJW1 3I07A 3T4NB 3CC71 3FQQA 3GTLI 2QA41 2H85A 1NJI1 2OOYB 3GTGI 5FLMI 4NH1C 4A3EI 3VMGA 4TNUA 2Y0SA 2KPIA 3CMA1 1K9M2 5FLXb 2B63I 3CQZI 2E2JI 2JA8I 2O4HA 1VQO1 1N2FA 2BJOA 1Y1VS 3ESWA 1VQ81 3GTPI 1KQSZ 2QRCB 4MD9A 1X3ZA 1ML8A 4NBCA 2VUGA 1PFTA 2W03A 3RZDI 1QVFY 1TFIA 4Y7NI 2OTJ1 2PMZA 3GTMS 3CD61 3G4SZ 4E2ZA 4E2WA 5C3EI 1VQ6Z 5C4XI 2QR1B 1YITZ 3CC4Z 4MONA 5T67A 3J81b 3CC2Z 1VQKZ 4E32A 1USPA 1W2BZ 3CXCZ 2OOXB 4NB8A 1W2BY 4HGYA 4EWCA 5CM2M 3CXCY 3KIHA 3I55Z 1VQ51 3F3FC 5T64A 3G71Z 3QWUA 1RO2A 2I3CA 4MH4A 4RV9A 3FQMA 3MZKB 1VLAA 2R7ZI 4RVGA 3BG1B 1LQLA 2HU9A 2OTLZ 4E31A 3VTNA 5A2Qb 2E9HA 4E2YA 3JAMb 3S1QI 1TWGI 2JUBA 2RPRA 3NH5A 3CCLZ 4A3FI 2IZ3A 3CCUZ 3HOWI 5FLXf 3Q87A 3FKII 1NUIA 2G2KA 2GU2A 4NBAA 1Z03A 2PK7A 5T6BA 3PO3S 3MONA 4HH4A 5AN9F 1VQ7Z 3GTQI 4RVDA 3M3YI 5IP9I 2JA5I 4QTTA 3G4S1 2JR6A 1QYPA 1M902 1ZB8A 3NH8A 1VQ61 3HOUI 1JJ2Z 1DL6A 1YIT1 3CC41 3H0GI 1JJ2Y 1YUKA 3M4OI 1I50I 3NDIA 3IF8A 4RVHA 1VQ9Z 3CC21 1VQK1 4RVFA 3TDHB 4DQYB 3J81f 3PO2I 1JWHC 4MD8A 5IT9f 3I551 4A3BI 5IP7I 3CCEZ 1R9TI 3G711 1SFOI 2JMOA 4E30A 1Y1WI 3J80b 3HOZI 3S2DI 3S15I 2P3YA 2KI7B 4HGZA 2QKDA 1KQSY 4A3CI 5LL6f 4XX2A 4MRIA 2OTL1 4NFRA 1Z02A 2PM9A 3GTOI 1M1K1 1Q821 4A3JI 2R6MA 2AKLA 2QLVB 3CPWZ 1TWAI 3VB9A 1L1OC 3CCL1 2QREB 1M901 5A2Qf 3I56Z 3HKZA 3CCU1 3CPWY 2OZKA 2LIYA 5D1OA 3JAMf 2K3RA 3NDJA 1KC81 2WB1A 1VQNZ 4NBGA 1QF8A 1YJNZ 5IT9b 3TE5B 4A3GI 2QRDB 3EERA 1VQ71 5D1PA 3CCJZ 3CC7Z 2J6AA 1TWFI 4E2XA 2VF1A 3NFZA 3CCRZ 3P5JB 3RZOI 3NH4A 2RT9A 1VQ91 1RNIA 2YU9I 5C4JI 1ZB9A 3OW2Z 4NBEA 1YJ9Z 3OW2Y 3IX0A 4MXUA 1YI2Z 2DE5A 2EGTA 3CCE1 4NBFA 3F3PC 1K732 4Y52I 2F4OA 3VMIA 2Q51A 1VQPZ 2V8JA 1YHQZ 1X3WA 2W04A 1P9NA 4QTUA 3J80f 2R92I 4BXXI 1S72Z 1M1K2 4S1TA 1Q822 3CD6Z 4A3DI 1Q7Y1 2JA6I 2V8IA 3I561 1I3QI 3GTKI 3GKQA 1KC82 4NBDA 1VQN1 4BBRI 1YJN1 2HF1A 3GCFA 1I6HI 2IZ4A 5C44I 1Y1VI 1N8R1 3D6WA 1Q811 1K8A1 3GTJI 2LFUA 2E2HI 2DE7A 3CCJ1 1NP6A 3S17I 1WIIA 3I4MI 3S14I 1VQMZ 1VQLZ 1K731 3CCQZ 1RO0A 3CCMZ 3HOYI 3CCR1 3GTMI 2NVXI 3IFUA 3G6EZ 2NVYI 3BG0B 2RIQA 1Q861 4NB9A 2JS4A 3I4NI 3CCVZ 1YJ91 4NBHA 2K5RA 1YI21 2E2II 4BY7I 3U50C 3VMHA 2M48A 3K7AI 4AYBA 2V8KA 1YIJZ 4A3II 1VQP1 1YHQ1 2QEXZ 3CCSZ 3LUSA 4A3LI 1QVFZ 1VQ4Z 3S1RI 1KRLA 1WCMI 2GTIA 1YUAA 4RS4A 1S721 1TWCI 3CMEZ 1KD11 3S2HI 3EEDA 2GTHA 4A3KI 1Q7Y2 1YJWZ 1RQFA 2DE6A 4BY1I 2QA4Z 2R93I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YAD A; 
#chains in the Genus database with same CATH topology
 1QVG Z;  4A93 I;  1QVG Y;  3KIF A;  3H3V J;  4X6A I;  1X0T A;  1Z01 A;  2JA7 I;  1RLY A;  1K83 I;  2M6N A;  1AA6 A;  5D1O B;  1K9M 1;  3CMA Z;  1N8R 2;  2VPX A;  1Q81 2;  1K8A 2;  3S1M I;  1VQO Z;  3S1N I;  3HOX I;  1USP B;  2WAQ A;  1VQM 1;  3PO3 I;  1VQL 1;  3J7A 4;  4DGL A;  3CCQ 1;  4CL1 A;  3CCM 1;  1NJI 2;  1VQ8 Z;  3HOV I;  2NVT I;  3MZL B;  4E33 A;  2ZAE B;  2AYD A;  2RHB A;  1S7M A;  4DK1 A;  3G6E 1;  3D9X A;  2P28 A;  2YAD A;  2NVQ I;  4NBB A;  2OTJ Z;  1Q86 2;  2V3V A;  1WW9 A;  3CCV 1;  2Q4Z A;  2JNY A;  4A3M I;  1RO4 A;  1TWH I;  2RBL A;  1YIJ 1;  3S16 I;  2QEX 1;  3CCS 1;  4NOZ A;  1VQ4 1;  1ZH1 A;  2F4M A;  4MD7 A;  1VQ5 Z;  3CME 1;  2E7Z A;  1KD1 2;  2O53 A;  2VUM I;  4BBS I;  1YJW 1;  3I07 A;  3T4N B;  3CC7 1;  3FQQ A;  1SIW A;  3GTL I;  2QA4 1;  2H85 A;  1Y8C A;  1NJI 1;  2OOY B;  3GTG I;  5FLM I;  4NH1 C;  4A3E I;  3VMG A;  4TNU A;  2Y0S A;  2KPI A;  3CMA 1;  1K9M 2;  5FLX b;  2B63 I;  3CQZ I;  2E2J I;  2JA8 I;  2O4H A;  1VQO 1;  1N2F A;  2BJO A;  1Y1V S;  3ESW A;  1WZN A;  1VQ8 1;  3GTP I;  1KQS Z;  2QRC B;  4MD9 A;  1X3Z A;  1ML8 A;  4NBC A;  2VUG A;  2JIR A;  1PFT A;  2W03 A;  3RZD I;  1QVF Y;  1TFI A;  4Y7N I;  2OTJ 1;  2PMZ A;  3GTM S;  3CD6 1;  3G4S Z;  4E2Z A;  4E2W A;  5C3E I;  1VQ6 Z;  5C4X I;  2QR1 B;  1YIT Z;  3CC4 Z;  3IR7 A;  4MON A;  5T67 A;  3J81 b;  3CC2 Z;  1VQK Z;  4E32 A;  1USP A;  1W2B Z;  3CXC Z;  2OOX B;  4NB8 A;  1W2B Y;  4HGY A;  4EWC A;  5CM2 M;  3CXC Y;  3KIH A;  3I55 Z;  1VQ5 1;  3F3F C;  5T64 A;  2VPZ A;  3G71 Z;  3QWU A;  1RO2 A;  2I3C A;  4MH4 A;  4RV9 A;  3FQM A;  3MZK B;  1VLA A;  2R7Z I;  4RVG A;  3BG1 B;  1LQL A;  2HU9 A;  2OTL Z;  4E31 A;  3VTN A;  5A2Q b;  2E9H A;  4E2Y A;  3JAM b;  3S1Q I;  1TWG I;  2JUB A;  2RPR A;  3NH5 A;  3CCL Z;  4A3F I;  2IZ3 A;  3CCU Z;  3HOW I;  5FLX f;  3Q87 A;  3FKI I;  1NUI A;  2G2K A;  2GU2 A;  4NBA A;  1Z03 A;  2PK7 A;  5T6B A;  3PO3 S;  3MON A;  4HH4 A;  5AN9 F;  1VQ7 Z;  3GTQ I;  4RVD A;  3M3Y I;  5IP9 I;  2JA5 I;  4QTT A;  2IV2 X;  3G4S 1;  2JR6 A;  1QYP A;  1FDI A;  1M90 2;  1ZB8 A;  3NH8 A;  1VQ6 1;  3HOU I;  1JJ2 Z;  1DL6 A;  1YIT 1;  3CC4 1;  3H0G I;  1JJ2 Y;  1YUK A;  3M4O I;  1I50 I;  3NDI A;  3IF8 A;  2NAP A;  4RVH A;  1VQ9 Z;  3CC2 1;  1VQK 1;  4RVF A;  3TDH B;  4DQY B;  3J81 f;  3PO2 I;  1JWH C;  2VPW A;  4MD8 A;  5IT9 f;  3I55 1;  4A3B I;  5IP7 I;  3CCE Z;  1R9T I;  3G71 1;  1SFO I;  2JMO A;  4E30 A;  1Y1W I;  3J80 b;  3HOZ I;  3S2D I;  3S15 I;  2P3Y A;  2KI7 B;  2LEX A;  4HGZ A;  2QKD A;  1KQS Y;  4A3C I;  5LL6 f;  4XX2 A;  4MRI A;  2OTL 1;  4NFR A;  1Z02 A;  2PM9 A;  3GTO I;  1M1K 1;  1Q82 1;  2VPY A;  4A3J I;  2R6M A;  2AKL A;  2QLV B;  3CPW Z;  1TWA I;  3VB9 A;  1L1O C;  3CCL 1;  2QRE B;  1M90 1;  5A2Q f;  3I56 Z;  3HKZ A;  3CCU 1;  3CPW Y;  2OZK A;  2LIY A;  5D1O A;  3JAM f;  2K3R A;  3NDJ A;  1KC8 1;  2WB1 A;  1VQN Z;  4NBG A;  1QF8 A;  1YJN Z;  5IT9 b;  3TE5 B;  4A3G I;  2QRD B;  3EER A;  1VQ7 1;  5D1P A;  3CCJ Z;  3CC7 Z;  2J6A A;  1TWF I;  4E2X A;  2VF1 A;  3NFZ A;  3CCR Z;  3P5J B;  3RZO I;  1FDO A;  3D2L A;  3NH4 A;  2RT9 A;  1VQ9 1;  1RNI A;  2YU9 I;  5C4J I;  1ZB9 A;  3OW2 Z;  4NBE A;  1YJ9 Z;  3OW2 Y;  3IX0 A;  4MXU A;  1YI2 Z;  2DE5 A;  2EGT A;  3CCE 1;  4NBF A;  2JIM A;  3F3P C;  2JIO A;  1K73 2;  4Y52 I;  2F4O A;  3VMI A;  2Q51 A;  1VQP Z;  2V8J A;  1YHQ Z;  1X3W A;  2W04 A;  1P9N A;  4QTU A;  3J80 f;  2R92 I;  4BXX I;  1S72 Z;  1M1K 2;  4S1T A;  1Q82 2;  3CD6 Z;  4A3D I;  1Q7Y 1;  2JIP A;  2JA6 I;  2V8I A;  3I56 1;  1I3Q I;  3GTK I;  3GKQ A;  1KC8 2;  4NBD A;  1VQN 1;  4BBR I;  1YJN 1;  2HF1 A;  3GCF A;  1I6H I;  2IZ4 A;  5C44 I;  2JIQ A;  1Y1V I;  1N8R 1;  3D6W A;  1Q81 1;  1K8A 1;  3GTJ I;  2LFU A;  2E2H I;  2DE7 A;  3CCJ 1;  1NP6 A;  3S17 I;  1WII A;  3I4M I;  3S14 I;  1VQM Z;  1VQL Z;  1K73 1;  3CCQ Z;  1RO0 A;  3CCM Z;  3HOY I;  1QXF A;  3CCR 1;  3GTM I;  2NVX I;  3IFU A;  3G6E Z;  2NVY I;  3BG0 B;  2RIQ A;  1Q86 1;  4NB9 A;  2JS4 A;  3I4N I;  3CCV Z;  1YJ9 1;  4NBH A;  2K5R A;  1YI2 1;  2E2I I;  4BY7 I;  3U50 C;  3VMH A;  2M48 A;  3K7A I;  4AYB A;  2V8K A;  1YIJ Z;  4A3I I;  1VQP 1;  1YHQ 1;  2QEX Z;  3CCS Z;  3LUS A;  4A3L I;  1QVF Z;  2V45 A;  1Q16 A;  1WJ2 A;  1VQ4 Z;  3S1R I;  1KRL A;  1WCM I;  2GTI A;  1YUA A;  4RS4 A;  1S72 1;  1TWC I;  3CME Z;  1KD1 1;  3S2H I;  3EED A;  2GTH A;  4A3K I;  1Q7Y 2;  1YJW Z;  1RQF A;  2DE6 A;  4BY1 I;  2QA4 Z;  2R93 I; 
#chains in the Genus database with same CATH homology
 1QVG Z;  4A93 I;  1QVG Y;  3KIF A;  3H3V J;  4X6A I;  1X0T A;  1Z01 A;  2JA7 I;  1RLY A;  1K83 I;  2M6N A;  5D1O B;  1K9M 1;  3CMA Z;  1N8R 2;  1Q81 2;  1K8A 2;  3S1M I;  1VQO Z;  3S1N I;  3HOX I;  1USP B;  2WAQ A;  1VQM 1;  3PO3 I;  1VQL 1;  3J7A 4;  4DGL A;  3CCQ 1;  4CL1 A;  3CCM 1;  1NJI 2;  1VQ8 Z;  3HOV I;  2NVT I;  3MZL B;  4E33 A;  2ZAE B;  2RHB A;  1S7M A;  4DK1 A;  3G6E 1;  3D9X A;  2P28 A;  2YAD A;  2NVQ I;  4NBB A;  2OTJ Z;  1Q86 2;  1WW9 A;  3CCV 1;  2Q4Z A;  2JNY A;  4A3M I;  1RO4 A;  1TWH I;  2RBL A;  1YIJ 1;  3S16 I;  2QEX 1;  3CCS 1;  4NOZ A;  1VQ4 1;  1ZH1 A;  2F4M A;  4MD7 A;  1VQ5 Z;  3CME 1;  1KD1 2;  2O53 A;  2VUM I;  4BBS I;  1YJW 1;  3I07 A;  3T4N B;  3CC7 1;  3FQQ A;  3GTL I;  2QA4 1;  2H85 A;  1NJI 1;  2OOY B;  3GTG I;  5FLM I;  4NH1 C;  4A3E I;  3VMG A;  4TNU A;  2Y0S A;  2KPI A;  3CMA 1;  1K9M 2;  5FLX b;  2B63 I;  3CQZ I;  2E2J I;  2JA8 I;  2O4H A;  1VQO 1;  1N2F A;  2BJO A;  1Y1V S;  3ESW A;  1VQ8 1;  3GTP I;  1KQS Z;  2QRC B;  4MD9 A;  1X3Z A;  1ML8 A;  4NBC A;  2VUG A;  1PFT A;  2W03 A;  3RZD I;  1QVF Y;  1TFI A;  4Y7N I;  2OTJ 1;  2PMZ A;  3GTM S;  3CD6 1;  3G4S Z;  4E2Z A;  4E2W A;  5C3E I;  1VQ6 Z;  5C4X I;  2QR1 B;  1YIT Z;  3CC4 Z;  4MON A;  5T67 A;  3J81 b;  3CC2 Z;  1VQK Z;  4E32 A;  1USP A;  1W2B Z;  3CXC Z;  2OOX B;  4NB8 A;  1W2B Y;  4HGY A;  4EWC A;  5CM2 M;  3CXC Y;  3KIH A;  3I55 Z;  1VQ5 1;  3F3F C;  5T64 A;  3G71 Z;  3QWU A;  1RO2 A;  2I3C A;  4MH4 A;  4RV9 A;  3FQM A;  3MZK B;  1VLA A;  2R7Z I;  4RVG A;  3BG1 B;  1LQL A;  2HU9 A;  2OTL Z;  4E31 A;  3VTN A;  5A2Q b;  2E9H A;  4E2Y A;  3JAM b;  3S1Q I;  1TWG I;  2JUB A;  2RPR A;  3NH5 A;  3CCL Z;  4A3F I;  2IZ3 A;  3CCU Z;  3HOW I;  5FLX f;  3Q87 A;  3FKI I;  1NUI A;  2G2K A;  2GU2 A;  4NBA A;  1Z03 A;  2PK7 A;  5T6B A;  3PO3 S;  3MON A;  4HH4 A;  5AN9 F;  1VQ7 Z;  3GTQ I;  4RVD A;  3M3Y I;  5IP9 I;  2JA5 I;  4QTT A;  3G4S 1;  2JR6 A;  1QYP A;  1M90 2;  1ZB8 A;  3NH8 A;  1VQ6 1;  3HOU I;  1JJ2 Z;  1DL6 A;  1YIT 1;  3CC4 1;  3H0G I;  1JJ2 Y;  1YUK A;  3M4O I;  1I50 I;  3NDI A;  3IF8 A;  4RVH A;  1VQ9 Z;  3CC2 1;  1VQK 1;  4RVF A;  3TDH B;  4DQY B;  3J81 f;  3PO2 I;  1JWH C;  4MD8 A;  5IT9 f;  3I55 1;  4A3B I;  5IP7 I;  3CCE Z;  1R9T I;  3G71 1;  1SFO I;  2JMO A;  4E30 A;  1Y1W I;  3J80 b;  3HOZ I;  3S2D I;  3S15 I;  2P3Y A;  2KI7 B;  4HGZ A;  2QKD A;  1KQS Y;  4A3C I;  5LL6 f;  4XX2 A;  4MRI A;  2OTL 1;  4NFR A;  1Z02 A;  2PM9 A;  3GTO I;  1M1K 1;  1Q82 1;  4A3J I;  2R6M A;  2AKL A;  2QLV B;  3CPW Z;  1TWA I;  3VB9 A;  1L1O C;  3CCL 1;  2QRE B;  1M90 1;  5A2Q f;  3I56 Z;  3HKZ A;  3CCU 1;  3CPW Y;  2OZK A;  2LIY A;  5D1O A;  3JAM f;  2K3R A;  3NDJ A;  1KC8 1;  2WB1 A;  1VQN Z;  4NBG A;  1QF8 A;  1YJN Z;  5IT9 b;  3TE5 B;  4A3G I;  2QRD B;  3EER A;  1VQ7 1;  5D1P A;  3CCJ Z;  3CC7 Z;  2J6A A;  1TWF I;  4E2X A;  2VF1 A;  3NFZ A;  3CCR Z;  3P5J B;  3RZO I;  3NH4 A;  2RT9 A;  1VQ9 1;  1RNI A;  2YU9 I;  5C4J I;  1ZB9 A;  3OW2 Z;  4NBE A;  1YJ9 Z;  3OW2 Y;  3IX0 A;  4MXU A;  1YI2 Z;  2DE5 A;  2EGT A;  3CCE 1;  4NBF A;  3F3P C;  1K73 2;  4Y52 I;  2F4O A;  3VMI A;  2Q51 A;  1VQP Z;  2V8J A;  1YHQ Z;  1X3W A;  2W04 A;  1P9N A;  4QTU A;  3J80 f;  2R92 I;  4BXX I;  1S72 Z;  1M1K 2;  4S1T A;  1Q82 2;  3CD6 Z;  4A3D I;  1Q7Y 1;  2JA6 I;  2V8I A;  3I56 1;  1I3Q I;  3GTK I;  3GKQ A;  1KC8 2;  4NBD A;  1VQN 1;  4BBR I;  1YJN 1;  2HF1 A;  3GCF A;  1I6H I;  2IZ4 A;  5C44 I;  1Y1V I;  1N8R 1;  3D6W A;  1Q81 1;  1K8A 1;  3GTJ I;  2LFU A;  2E2H I;  2DE7 A;  3CCJ 1;  1NP6 A;  3S17 I;  1WII A;  3I4M I;  3S14 I;  1VQM Z;  1VQL Z;  1K73 1;  3CCQ Z;  1RO0 A;  3CCM Z;  3HOY I;  3CCR 1;  3GTM I;  2NVX I;  3IFU A;  3G6E Z;  2NVY I;  3BG0 B;  2RIQ A;  1Q86 1;  4NB9 A;  2JS4 A;  3I4N I;  3CCV Z;  1YJ9 1;  4NBH A;  2K5R A;  1YI2 1;  2E2I I;  4BY7 I;  3U50 C;  3VMH A;  2M48 A;  3K7A I;  4AYB A;  2V8K A;  1YIJ Z;  4A3I I;  1VQP 1;  1YHQ 1;  2QEX Z;  3CCS Z;  3LUS A;  4A3L I;  1QVF Z;  1VQ4 Z;  3S1R I;  1KRL A;  1WCM I;  2GTI A;  1YUA A;  4RS4 A;  1S72 1;  1TWC I;  3CME Z;  1KD1 1;  3S2H I;  3EED A;  2GTH A;  4A3K I;  1Q7Y 2;  1YJW Z;  1RQF A;  2DE6 A;  4BY1 I;  2QA4 Z;  2R93 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...