3CCVZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccvZ00
1KQSZ 1KC82 1K732 3CCLZ 3CXCZ 3CCU1 1YJWZ 1JJ2Z 1M901 3CCJ1 1YJ9Z 3CMAZ 1YIJZ 1QVGY 1VQNZ 1YHQZ 1Q7Y1 2QEXZ 1K9M1 3CC7Z 3CCS1 1YJNZ 1KD11 3CCVZ 1VQO1 1K8A1 1Q7Y2 3G6EZ 1VQLZ 3CC21 1VQ61 3I56Z 1KD12 3G4SZ 3CPWZ 1VQ9Z 3OW2Y 1VQK1 3I551 1K8A2 3CCE1 3CCM1 1Q811 2OTJ1 1VQ41 1VQ51 2QA4Z 1QVFY 1S721 1VQM1 3CC41 1VQ71 2OTLZ 3G711 3CCRZ 1VQ8Z 1M902 3CCQZ 3CCL1 1YITZ 1Q812 1QVGZ 1Q821 1Q861 1NJI1 1JJ2Y 1YJW1 3CCSZ 1YJ91 1YI2Z 1K9M2 3CMA1 1YIJ1 1M1K1 1VQN1 1W2BY 1Q822 1YHQ1 3CD6Z 1VQPZ 2QEX1 3CMEZ 3CC71 1YJN1 3CCUZ 3CCV1 1M1K2 3G6E1 3CCJZ 1VQL1 1KQSY 3I561 1QVFZ 3CXCY 3G4S1 1VQ91 3CC4Z 1N8R1 1VQOZ 2QA41 1Q862 1N8R2 2OTL1 3CC2Z 1NJI2 1VQ6Z 3CCR1 1VQ81 3CCQ1 1YIT1 1W2BZ 1VQKZ 3I55Z 3OW2Z 3CCEZ 1KC81 3CCMZ 1K731 1YI21 2OTJZ 1VQ4Z 1VQ5Z 3CPWY 1S72Z 1VQMZ 3CD61 1VQP1 1VQ7Z 3CME1 3G71Z
chains in the Genus database with same CATH superfamily
3CXCZ 3HOYI 3CCU1 2WB1A 2RBLA 1LQLA 3F3FC 3HKZA 2VPZA 4E2YA 1YIJZ 2DE5A 1JWHC 4EWCA 1VQNZ 1YHQZ 3S14I 3CC7Z 2EGTA 2JR6A 3CCS1 4HGZA 4DK1A 5AN9F 3EEDA 1K8A1 3GTQI 3J80f 3CC21 2F4OA 3J81b 3CPWZ 3BG1B 4A3KI 3I551 2VPXA 2E9HA 1Q811 2OTJ1 1VQ41 1VQ51 3HOUI 1NUIA 5A2Qb 1FDOA 3CC41 1QVGZ 5D1PA 2PM9A 2Q51A 1K83I 2JIMA 1YI2Z 1I50I 1Y8CA 3S1QI 4A3CI 4A3JI 1Q822 3CD6Z 2QEX1 2GTIA 2BJOA 4NBDA 1R9TI 4X6AI 1M1K2 3J80b 2NVYI 3VMIA 2VPYA 2LEXA 2KI7B 1TFIA 1PFTA 1RO4A 1VQOZ 2P28A 1Q862 1N8R2 3GTPI 2RHBA 5D1OB 4A3MI 2I3CA 1VQ81 3CCQ1 1YIT1 1NP6A 3MONA 1X3WA 1VQKZ 4A3LI 2VUGA 4A3BI 2V3VA 5LL6f 2E7ZA 4E31A 2PMZA 1QF8A 1VLAA 1RO2A 4NB8A 3KIHA 1VQMZ 1VQP1 1VQ7Z 1I6HI 3G71Z 1KC82 4MD7A 3EERA 4DQYB 2V8JA 1YJWZ 2JS4A 1JJ2Z 4TNUA 1YUAA 3CMAZ 4A3DI 2JMOA 4E2WA 2NVXI 1YJNZ 1ML8A 1RQFA 3CCVZ 4RVGA 1Q7Y2 1S7MA 3G6EZ 1I3QI 1Z03A 1KD12 3D6WA 3G4SZ 1VQ9Z 3PO3I 3NDJA 3CCE1 2M48A 1RO0A 3CCM1 1TWHI 1TWFI 1ZB8A 5C44I 2NAPA 1QXFA 1S721 2V8KA 5C4XI 2OTLZ 4E2ZA 2NVTI 4HGYA 1M902 2J6AA 3PO3S 4RVFA 3FQQA 4MH4A 3NH5A 4A3FI 1Q861 2JUBA 5CM2M 1JJ2Y 2HU9A 3CCSZ 2AYDA 3IR7A 2IZ4A 4A3II 1YIJ1 1VQN1 1W2BY 1YHQ1 3J7A4 2QRCB 3VMGA 3CC71 3U50C 2JIOA 1USPA 3I4MI 4A93I 2LIYA 3CCJZ 1QYPA 2F4MA 1QVFZ 3CXCY 2E2JI 3QWUA 3NFZA 2JNYA 3CC4Z 2JIPA 5T64A 5C3EI 2IZ3A 1RNIA 3I4NI 1SIWA 2QREB 1VQ6Z 4BXXI 1Y1VS 4RVHA 3S2HI 3OW2Z 3NDIA 2PK7A 1YI21 3GTGI 3CPWY 3GTMI 2RIQA 4NH1C 1WIIA 3CD61 4DGLA 3M4OI 4BBSI 2R7ZI 1KQSZ 5IT9f 3BG0B 1K732 1TWGI 3CCLZ 2R92I 1Z01A 4MXUA 2YU9I 1M901 1YJ9Z 4MONA 2NVQI 3GTMS 1QVGY 2V45A 2E2HI 2LFUA 3P5JB 1SFOI 1VQO1 5FLMI 3TDHB 1VQLZ 3HOVI 3I56Z 3MZKB 3S1NI 3OW2Y 1VQK1 2JA8I 1K8A2 5T6BA 5IP7I 2GTHA 3NH8A 3JAMf 3GKQA 2QA4Z 3IX0A 1VQM1 1VQ71 5IT9b 3G711 2OOXB 4NOZA 3CCRZ 2DE7A 1Q812 1Z02A 4NBEA 1Q821 4BY1I 3S15I 2G2KA 3VTNA 1YJW1 1K9M2 3CMA1 5T67A 1M1K1 4MD9A 3T4NB 2M6NA 2K3RA 3CMEZ 4BY7I 2JIQA 1YJN1 4RS4A 3CCUZ 3CCV1 3IFUA 3MZLB 1TWCI 3IF8A 3G6E1 4S1TA 3F3PC 1AA6A 3G4S1 1VQ91 2QLVB 1N8R1 2Q4ZA 3H0GI 3JAMb 3I07A 2QRDB 3LUSA 2OTL1 3CC2Z 1NJI2 3GTOI 3I55Z 1TWAI 4NBBA 1KC81 3Q87A 4A3GI 2OTJZ 3FKII 4QTUA 1VQ4Z 1VQ5Z 2R93I 3GTKI 1Y1VI 4NBAA 2P3YA 2JA7I 4NFRA 2QKDA 1X0TA 4RVDA 3CCJ1 3S1MI 3VB9A 2K5RA 2YADA 1Q7Y1 1ZB9A 1USPB 3KIFA 2QEXZ 2DE6A 1K9M1 4NBGA 1KD11 2RPRA 1N2FA 1DL6A 2ZAEB 3S16I 1VQ61 4A3EI 3HOZI 3S2DI 2O4HA 2WAQA 2GU2A 1Y1WI 4E33A 2VPWA 3D9XA 5D1OA 2AKLA 2R6MA 3ESWA 2H85A 2OOYB 1KRLA 1X3ZA 1YUKA 4XX2A 3S1RI 2E2II 2B63I 2O53A 1QVFY 3RZDI 2VUMI 5FLXf 2RT9A 3PO2I 1VQ8Z 2JA6I 3CCQZ 3CCL1 1YITZ 4MRIA 2V8IA 1NJI1 4HH4A 3K7AI 1YJ91 2JIRA 2JA5I 4CL1A 4RV9A 1ZH1A 4E30A 3CQZI 2QR1B 1VQPZ 3GTLI 1FDIA 4NBCA 2HF1A 1L1OC 2Y0SA 1RLYA 3GTJI 3HOWI 1Q16A 4AYBA 4QTTA 3GCFA 3HOXI 3D2LA 3TE5B 1VQL1 1KQSY 3I561 3M3YI 4BBRI 5C4JI 2W04A 4Y52I 3NH4A 3RZOI 4MD8A 2QA41 4NBHA 1WW9A 2IV2X 3H3VJ 5FLXb 2KPIA 1P9NA 2VF1A 3CCR1 4NB9A 4Y7NI 1W2BZ 2OZKA 3J81f 3S17I 1WZNA 5IP9I 3CCEZ 3VMHA 3CCMZ 1K731 1WJ2A 4NBFA 1WCMI 4E32A 2W03A 1S72Z 5A2Qf 4E2XA 3FQMA 3CME1
chains in the Genus database with same CATH topology
3CXCZ 3HOYI 3CCU1 2WB1A 2RBLA 1LQLA 3F3FC 3HKZA 4E2YA 1YIJZ 2DE5A 1JWHC 4EWCA 1VQNZ 1YHQZ 3S14I 3CC7Z 2EGTA 2JR6A 3CCS1 4HGZA 4DK1A 5AN9F 3EEDA 1K8A1 3GTQI 3J80f 3CC21 2F4OA 3J81b 3CPWZ 3BG1B 4A3KI 3I551 2E9HA 1Q811 2OTJ1 1VQ41 1VQ51 3HOUI 1NUIA 5A2Qb 3CC41 1QVGZ 5D1PA 2PM9A 2Q51A 1K83I 1YI2Z 1I50I 3S1QI 4A3CI 4A3JI 1Q822 3CD6Z 2QEX1 2GTIA 2BJOA 4NBDA 1R9TI 4X6AI 1M1K2 3J80b 2NVYI 3VMIA 2KI7B 1TFIA 1PFTA 1RO4A 1VQOZ 2P28A 1Q862 1N8R2 3GTPI 2RHBA 5D1OB 4A3MI 2I3CA 1VQ81 3CCQ1 1YIT1 1NP6A 3MONA 1X3WA 1VQKZ 4A3LI 2VUGA 4A3BI 5LL6f 4E31A 2PMZA 1QF8A 1VLAA 1RO2A 4NB8A 3KIHA 1VQMZ 1VQP1 1VQ7Z 1I6HI 3G71Z 1KC82 4MD7A 3EERA 4DQYB 2V8JA 1YJWZ 2JS4A 1JJ2Z 4TNUA 1YUAA 3CMAZ 4A3DI 2JMOA 4E2WA 2NVXI 1YJNZ 1ML8A 1RQFA 3CCVZ 4RVGA 1Q7Y2 1S7MA 3G6EZ 1I3QI 1Z03A 1KD12 3D6WA 3G4SZ 1VQ9Z 3PO3I 3NDJA 3CCE1 2M48A 1RO0A 3CCM1 1TWHI 1TWFI 1ZB8A 5C44I 1S721 2V8KA 5C4XI 2OTLZ 4E2ZA 2NVTI 4HGYA 1M902 2J6AA 3PO3S 4RVFA 3FQQA 4MH4A 3NH5A 4A3FI 1Q861 2JUBA 5CM2M 1JJ2Y 2HU9A 3CCSZ 2IZ4A 4A3II 1YIJ1 1VQN1 1W2BY 1YHQ1 3J7A4 2QRCB 3VMGA 3CC71 3U50C 1USPA 3I4MI 4A93I 2LIYA 3CCJZ 1QYPA 2F4MA 1QVFZ 3CXCY 2E2JI 3QWUA 3NFZA 2JNYA 3CC4Z 5C3EI 5T64A 2IZ3A 1RNIA 3I4NI 2QREB 1VQ6Z 4BXXI 1Y1VS 4RVHA 3S2HI 3OW2Z 3NDIA 2PK7A 1YI21 3GTGI 3CPWY 3GTMI 2RIQA 4NH1C 1WIIA 3CD61 4DGLA 3M4OI 4BBSI 2R7ZI 1KQSZ 5IT9f 3BG0B 1K732 1TWGI 3CCLZ 2R92I 1Z01A 4MXUA 2YU9I 1M901 1YJ9Z 4MONA 2NVQI 3GTMS 1QVGY 2E2HI 2LFUA 3P5JB 1SFOI 1VQO1 5FLMI 3TDHB 1VQLZ 3HOVI 3I56Z 3MZKB 3S1NI 3OW2Y 1VQK1 2JA8I 1K8A2 5T6BA 5IP7I 2GTHA 3NH8A 3JAMf 3GKQA 2QA4Z 3IX0A 1VQM1 1VQ71 5IT9b 3G711 2OOXB 4NOZA 3CCRZ 2DE7A 1Q812 1Z02A 4NBEA 1Q821 4BY1I 3S15I 2G2KA 3VTNA 1YJW1 1K9M2 3CMA1 5T67A 1M1K1 4MD9A 3T4NB 2M6NA 2K3RA 3CMEZ 4BY7I 1YJN1 4RS4A 3CCUZ 3CCV1 3IFUA 3MZLB 1TWCI 3IF8A 3G6E1 4S1TA 3F3PC 3G4S1 1VQ91 2QLVB 1N8R1 2Q4ZA 3H0GI 3JAMb 3I07A 2QRDB 3LUSA 2OTL1 3CC2Z 1NJI2 3GTOI 3I55Z 1TWAI 4NBBA 1KC81 3Q87A 4A3GI 2OTJZ 3FKII 4QTUA 1VQ4Z 1VQ5Z 2R93I 3GTKI 1Y1VI 4NBAA 2P3YA 2JA7I 4NFRA 2QKDA 1X0TA 4RVDA 3CCJ1 3S1MI 3VB9A 2K5RA 2YADA 1Q7Y1 1ZB9A 1USPB 3KIFA 2QEXZ 2DE6A 1K9M1 4NBGA 1KD11 2RPRA 1N2FA 1DL6A 2ZAEB 3S16I 1VQ61 4A3EI 3HOZI 3S2DI 2O4HA 2WAQA 2GU2A 1Y1WI 4E33A 3D9XA 5D1OA 2AKLA 2R6MA 3ESWA 2H85A 2OOYB 1KRLA 1X3ZA 1YUKA 4XX2A 3S1RI 2E2II 2B63I 2O53A 1QVFY 3RZDI 2VUMI 5FLXf 2RT9A 3PO2I 1VQ8Z 2JA6I 3CCQZ 3CCL1 1YITZ 4MRIA 2V8IA 1NJI1 4HH4A 3K7AI 1YJ91 2JA5I 4CL1A 4RV9A 1ZH1A 4E30A 3CQZI 2QR1B 1VQPZ 3GTLI 4NBCA 2HF1A 1L1OC 2Y0SA 1RLYA 3GTJI 3HOWI 4AYBA 4QTTA 3GCFA 3HOXI 3TE5B 1VQL1 1KQSY 3I561 3M3YI 4BBRI 5C4JI 2W04A 4Y52I 3NH4A 3RZOI 4MD8A 2QA41 4NBHA 1WW9A 3H3VJ 5FLXb 2KPIA 1P9NA 2VF1A 3CCR1 4NB9A 4Y7NI 1W2BZ 2OZKA 3J81f 3S17I 5IP9I 3CCEZ 3VMHA 3CCMZ 1K731 4NBFA 1WCMI 4E32A 2W03A 1S72Z 5A2Qf 4E2XA 3FQMA 3CME1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS Z;  1KC8 2;  1K73 2;  3CCL Z;  3CXC Z;  3CCU 1;  1YJW Z;  1JJ2 Z;  1M90 1;  3CCJ 1;  1YJ9 Z;  3CMA Z;  1YIJ Z;  1QVG Y;  1VQN Z;  1YHQ Z;  1Q7Y 1;  2QEX Z;  1K9M 1;  3CC7 Z;  3CCS 1;  1YJN Z;  1KD1 1;  3CCV Z;  1VQO 1;  1K8A 1;  1Q7Y 2;  3G6E Z;  1VQL Z;  3CC2 1;  1VQ6 1;  3I56 Z;  1KD1 2;  3G4S Z;  3CPW Z;  1VQ9 Z;  3OW2 Y;  1VQK 1;  3I55 1;  1K8A 2;  3CCE 1;  3CCM 1;  1Q81 1;  2OTJ 1;  1VQ4 1;  1VQ5 1;  2QA4 Z;  1QVF Y;  1S72 1;  1VQM 1;  3CC4 1;  1VQ7 1;  2OTL Z;  3G71 1;  3CCR Z;  1VQ8 Z;  1M90 2;  3CCQ Z;  3CCL 1;  1YIT Z;  1Q81 2;  1QVG Z;  1Q82 1;  1Q86 1;  1NJI 1;  1JJ2 Y;  1YJW 1;  3CCS Z;  1YJ9 1;  1YI2 Z;  1K9M 2;  3CMA 1;  1YIJ 1;  1M1K 1;  1VQN 1;  1W2B Y;  1Q82 2;  1YHQ 1;  3CD6 Z;  1VQP Z;  2QEX 1;  3CME Z;  3CC7 1;  1YJN 1;  3CCU Z;  3CCV 1;  1M1K 2;  3G6E 1;  3CCJ Z;  1VQL 1;  1KQS Y;  3I56 1;  1QVF Z;  3CXC Y;  3G4S 1;  1VQ9 1;  3CC4 Z;  1N8R 1;  1VQO Z;  2QA4 1;  1Q86 2;  1N8R 2;  2OTL 1;  3CC2 Z;  1NJI 2;  1VQ6 Z;  3CCR 1;  1VQ8 1;  3CCQ 1;  1YIT 1;  1W2B Z;  1VQK Z;  3I55 Z;  3OW2 Z;  3CCE Z;  1KC8 1;  3CCM Z;  1K73 1;  1YI2 1;  2OTJ Z;  1VQ4 Z;  1VQ5 Z;  3CPW Y;  1S72 Z;  1VQM Z;  3CD6 1;  1VQP 1;  1VQ7 Z;  3CME 1;  3G71 Z; 
#chains in the Genus database with same CATH topology
 3CXC Z;  3HOY I;  3CCU 1;  2WB1 A;  2RBL A;  1LQL A;  3F3F C;  3HKZ A;  2VPZ A;  4E2Y A;  1YIJ Z;  2DE5 A;  1JWH C;  4EWC A;  1VQN Z;  1YHQ Z;  3S14 I;  3CC7 Z;  2EGT A;  2JR6 A;  3CCS 1;  4HGZ A;  4DK1 A;  5AN9 F;  3EED A;  1K8A 1;  3GTQ I;  3J80 f;  3CC2 1;  2F4O A;  3J81 b;  3CPW Z;  3BG1 B;  4A3K I;  3I55 1;  2VPX A;  2E9H A;  1Q81 1;  2OTJ 1;  1VQ4 1;  1VQ5 1;  3HOU I;  1NUI A;  5A2Q b;  1FDO A;  3CC4 1;  1QVG Z;  5D1P A;  2PM9 A;  2Q51 A;  1K83 I;  2JIM A;  1YI2 Z;  1I50 I;  1Y8C A;  3S1Q I;  4A3C I;  4A3J I;  1Q82 2;  3CD6 Z;  2QEX 1;  2GTI A;  2BJO A;  4NBD A;  1R9T I;  4X6A I;  1M1K 2;  3J80 b;  2NVY I;  3VMI A;  2VPY A;  2LEX A;  2KI7 B;  1TFI A;  1PFT A;  1RO4 A;  1VQO Z;  2P28 A;  1Q86 2;  1N8R 2;  3GTP I;  2RHB A;  5D1O B;  4A3M I;  2I3C A;  1VQ8 1;  3CCQ 1;  1YIT 1;  1NP6 A;  3MON A;  1X3W A;  1VQK Z;  4A3L I;  2VUG A;  4A3B I;  2V3V A;  5LL6 f;  2E7Z A;  4E31 A;  2PMZ A;  1QF8 A;  1VLA A;  1RO2 A;  4NB8 A;  3KIH A;  1VQM Z;  1VQP 1;  1VQ7 Z;  1I6H I;  3G71 Z;  1KC8 2;  4MD7 A;  3EER A;  4DQY B;  2V8J A;  1YJW Z;  2JS4 A;  1JJ2 Z;  4TNU A;  1YUA A;  3CMA Z;  4A3D I;  2JMO A;  4E2W A;  2NVX I;  1YJN Z;  1ML8 A;  1RQF A;  3CCV Z;  4RVG A;  1Q7Y 2;  1S7M A;  3G6E Z;  1I3Q I;  1Z03 A;  1KD1 2;  3D6W A;  3G4S Z;  1VQ9 Z;  3PO3 I;  3NDJ A;  3CCE 1;  2M48 A;  1RO0 A;  3CCM 1;  1TWH I;  1TWF I;  1ZB8 A;  5C44 I;  2NAP A;  1QXF A;  1S72 1;  2V8K A;  5C4X I;  2OTL Z;  4E2Z A;  2NVT I;  4HGY A;  1M90 2;  2J6A A;  3PO3 S;  4RVF A;  3FQQ A;  4MH4 A;  3NH5 A;  4A3F I;  1Q86 1;  2JUB A;  5CM2 M;  1JJ2 Y;  2HU9 A;  3CCS Z;  2AYD A;  3IR7 A;  2IZ4 A;  4A3I I;  1YIJ 1;  1VQN 1;  1W2B Y;  1YHQ 1;  3J7A 4;  2QRC B;  3VMG A;  3CC7 1;  3U50 C;  2JIO A;  1USP A;  3I4M I;  4A93 I;  2LIY A;  3CCJ Z;  1QYP A;  2F4M A;  1QVF Z;  3CXC Y;  2E2J I;  3QWU A;  3NFZ A;  2JNY A;  3CC4 Z;  2JIP A;  5T64 A;  5C3E I;  2IZ3 A;  1RNI A;  3I4N I;  1SIW A;  2QRE B;  1VQ6 Z;  4BXX I;  1Y1V S;  4RVH A;  3S2H I;  3OW2 Z;  3NDI A;  2PK7 A;  1YI2 1;  3GTG I;  3CPW Y;  3GTM I;  2RIQ A;  4NH1 C;  1WII A;  3CD6 1;  4DGL A;  3M4O I;  4BBS I;  2R7Z I;  1KQS Z;  5IT9 f;  3BG0 B;  1K73 2;  1TWG I;  3CCL Z;  2R92 I;  1Z01 A;  4MXU A;  2YU9 I;  1M90 1;  1YJ9 Z;  4MON A;  2NVQ I;  3GTM S;  1QVG Y;  2V45 A;  2E2H I;  2LFU A;  3P5J B;  1SFO I;  1VQO 1;  5FLM I;  3TDH B;  1VQL Z;  3HOV I;  3I56 Z;  3MZK B;  3S1N I;  3OW2 Y;  1VQK 1;  2JA8 I;  1K8A 2;  5T6B A;  5IP7 I;  2GTH A;  3NH8 A;  3JAM f;  3GKQ A;  2QA4 Z;  3IX0 A;  1VQM 1;  1VQ7 1;  5IT9 b;  3G71 1;  2OOX B;  4NOZ A;  3CCR Z;  2DE7 A;  1Q81 2;  1Z02 A;  4NBE A;  1Q82 1;  4BY1 I;  3S15 I;  2G2K A;  3VTN A;  1YJW 1;  1K9M 2;  3CMA 1;  5T67 A;  1M1K 1;  4MD9 A;  3T4N B;  2M6N A;  2K3R A;  3CME Z;  4BY7 I;  2JIQ A;  1YJN 1;  4RS4 A;  3CCU Z;  3CCV 1;  3IFU A;  3MZL B;  1TWC I;  3IF8 A;  3G6E 1;  4S1T A;  3F3P C;  1AA6 A;  3G4S 1;  1VQ9 1;  2QLV B;  1N8R 1;  2Q4Z A;  3H0G I;  3JAM b;  3I07 A;  2QRD B;  3LUS A;  2OTL 1;  3CC2 Z;  1NJI 2;  3GTO I;  3I55 Z;  1TWA I;  4NBB A;  1KC8 1;  3Q87 A;  4A3G I;  2OTJ Z;  3FKI I;  4QTU A;  1VQ4 Z;  1VQ5 Z;  2R93 I;  3GTK I;  1Y1V I;  4NBA A;  2P3Y A;  2JA7 I;  4NFR A;  2QKD A;  1X0T A;  4RVD A;  3CCJ 1;  3S1M I;  3VB9 A;  2K5R A;  2YAD A;  1Q7Y 1;  1ZB9 A;  1USP B;  3KIF A;  2QEX Z;  2DE6 A;  1K9M 1;  4NBG A;  1KD1 1;  2RPR A;  1N2F A;  1DL6 A;  2ZAE B;  3S16 I;  1VQ6 1;  4A3E I;  3HOZ I;  3S2D I;  2O4H A;  2WAQ A;  2GU2 A;  1Y1W I;  4E33 A;  2VPW A;  3D9X A;  5D1O A;  2AKL A;  2R6M A;  3ESW A;  2H85 A;  2OOY B;  1KRL A;  1X3Z A;  1YUK A;  4XX2 A;  3S1R I;  2E2I I;  2B63 I;  2O53 A;  1QVF Y;  3RZD I;  2VUM I;  5FLX f;  2RT9 A;  3PO2 I;  1VQ8 Z;  2JA6 I;  3CCQ Z;  3CCL 1;  1YIT Z;  4MRI A;  2V8I A;  1NJI 1;  4HH4 A;  3K7A I;  1YJ9 1;  2JIR A;  2JA5 I;  4CL1 A;  4RV9 A;  1ZH1 A;  4E30 A;  3CQZ I;  2QR1 B;  1VQP Z;  3GTL I;  1FDI A;  4NBC A;  2HF1 A;  1L1O C;  2Y0S A;  1RLY A;  3GTJ I;  3HOW I;  1Q16 A;  4AYB A;  4QTT A;  3GCF A;  3HOX I;  3D2L A;  3TE5 B;  1VQL 1;  1KQS Y;  3I56 1;  3M3Y I;  4BBR I;  5C4J I;  2W04 A;  4Y52 I;  3NH4 A;  3RZO I;  4MD8 A;  2QA4 1;  4NBH A;  1WW9 A;  2IV2 X;  3H3V J;  5FLX b;  2KPI A;  1P9N A;  2VF1 A;  3CCR 1;  4NB9 A;  4Y7N I;  1W2B Z;  2OZK A;  3J81 f;  3S17 I;  1WZN A;  5IP9 I;  3CCE Z;  3VMH A;  3CCM Z;  1K73 1;  1WJ2 A;  4NBF A;  1WCM I;  4E32 A;  2W03 A;  1S72 Z;  5A2Q f;  4E2X A;  3FQM A;  3CME 1; 
#chains in the Genus database with same CATH homology
 3CXC Z;  3HOY I;  3CCU 1;  2WB1 A;  2RBL A;  1LQL A;  3F3F C;  3HKZ A;  4E2Y A;  1YIJ Z;  2DE5 A;  1JWH C;  4EWC A;  1VQN Z;  1YHQ Z;  3S14 I;  3CC7 Z;  2EGT A;  2JR6 A;  3CCS 1;  4HGZ A;  4DK1 A;  5AN9 F;  3EED A;  1K8A 1;  3GTQ I;  3J80 f;  3CC2 1;  2F4O A;  3J81 b;  3CPW Z;  3BG1 B;  4A3K I;  3I55 1;  2E9H A;  1Q81 1;  2OTJ 1;  1VQ4 1;  1VQ5 1;  3HOU I;  1NUI A;  5A2Q b;  3CC4 1;  1QVG Z;  5D1P A;  2PM9 A;  2Q51 A;  1K83 I;  1YI2 Z;  1I50 I;  3S1Q I;  4A3C I;  4A3J I;  1Q82 2;  3CD6 Z;  2QEX 1;  2GTI A;  2BJO A;  4NBD A;  1R9T I;  4X6A I;  1M1K 2;  3J80 b;  2NVY I;  3VMI A;  2KI7 B;  1TFI A;  1PFT A;  1RO4 A;  1VQO Z;  2P28 A;  1Q86 2;  1N8R 2;  3GTP I;  2RHB A;  5D1O B;  4A3M I;  2I3C A;  1VQ8 1;  3CCQ 1;  1YIT 1;  1NP6 A;  3MON A;  1X3W A;  1VQK Z;  4A3L I;  2VUG A;  4A3B I;  5LL6 f;  4E31 A;  2PMZ A;  1QF8 A;  1VLA A;  1RO2 A;  4NB8 A;  3KIH A;  1VQM Z;  1VQP 1;  1VQ7 Z;  1I6H I;  3G71 Z;  1KC8 2;  4MD7 A;  3EER A;  4DQY B;  2V8J A;  1YJW Z;  2JS4 A;  1JJ2 Z;  4TNU A;  1YUA A;  3CMA Z;  4A3D I;  2JMO A;  4E2W A;  2NVX I;  1YJN Z;  1ML8 A;  1RQF A;  3CCV Z;  4RVG A;  1Q7Y 2;  1S7M A;  3G6E Z;  1I3Q I;  1Z03 A;  1KD1 2;  3D6W A;  3G4S Z;  1VQ9 Z;  3PO3 I;  3NDJ A;  3CCE 1;  2M48 A;  1RO0 A;  3CCM 1;  1TWH I;  1TWF I;  1ZB8 A;  5C44 I;  1S72 1;  2V8K A;  5C4X I;  2OTL Z;  4E2Z A;  2NVT I;  4HGY A;  1M90 2;  2J6A A;  3PO3 S;  4RVF A;  3FQQ A;  4MH4 A;  3NH5 A;  4A3F I;  1Q86 1;  2JUB A;  5CM2 M;  1JJ2 Y;  2HU9 A;  3CCS Z;  2IZ4 A;  4A3I I;  1YIJ 1;  1VQN 1;  1W2B Y;  1YHQ 1;  3J7A 4;  2QRC B;  3VMG A;  3CC7 1;  3U50 C;  1USP A;  3I4M I;  4A93 I;  2LIY A;  3CCJ Z;  1QYP A;  2F4M A;  1QVF Z;  3CXC Y;  2E2J I;  3QWU A;  3NFZ A;  2JNY A;  3CC4 Z;  5C3E I;  5T64 A;  2IZ3 A;  1RNI A;  3I4N I;  2QRE B;  1VQ6 Z;  4BXX I;  1Y1V S;  4RVH A;  3S2H I;  3OW2 Z;  3NDI A;  2PK7 A;  1YI2 1;  3GTG I;  3CPW Y;  3GTM I;  2RIQ A;  4NH1 C;  1WII A;  3CD6 1;  4DGL A;  3M4O I;  4BBS I;  2R7Z I;  1KQS Z;  5IT9 f;  3BG0 B;  1K73 2;  1TWG I;  3CCL Z;  2R92 I;  1Z01 A;  4MXU A;  2YU9 I;  1M90 1;  1YJ9 Z;  4MON A;  2NVQ I;  3GTM S;  1QVG Y;  2E2H I;  2LFU A;  3P5J B;  1SFO I;  1VQO 1;  5FLM I;  3TDH B;  1VQL Z;  3HOV I;  3I56 Z;  3MZK B;  3S1N I;  3OW2 Y;  1VQK 1;  2JA8 I;  1K8A 2;  5T6B A;  5IP7 I;  2GTH A;  3NH8 A;  3JAM f;  3GKQ A;  2QA4 Z;  3IX0 A;  1VQM 1;  1VQ7 1;  5IT9 b;  3G71 1;  2OOX B;  4NOZ A;  3CCR Z;  2DE7 A;  1Q81 2;  1Z02 A;  4NBE A;  1Q82 1;  4BY1 I;  3S15 I;  2G2K A;  3VTN A;  1YJW 1;  1K9M 2;  3CMA 1;  5T67 A;  1M1K 1;  4MD9 A;  3T4N B;  2M6N A;  2K3R A;  3CME Z;  4BY7 I;  1YJN 1;  4RS4 A;  3CCU Z;  3CCV 1;  3IFU A;  3MZL B;  1TWC I;  3IF8 A;  3G6E 1;  4S1T A;  3F3P C;  3G4S 1;  1VQ9 1;  2QLV B;  1N8R 1;  2Q4Z A;  3H0G I;  3JAM b;  3I07 A;  2QRD B;  3LUS A;  2OTL 1;  3CC2 Z;  1NJI 2;  3GTO I;  3I55 Z;  1TWA I;  4NBB A;  1KC8 1;  3Q87 A;  4A3G I;  2OTJ Z;  3FKI I;  4QTU A;  1VQ4 Z;  1VQ5 Z;  2R93 I;  3GTK I;  1Y1V I;  4NBA A;  2P3Y A;  2JA7 I;  4NFR A;  2QKD A;  1X0T A;  4RVD A;  3CCJ 1;  3S1M I;  3VB9 A;  2K5R A;  2YAD A;  1Q7Y 1;  1ZB9 A;  1USP B;  3KIF A;  2QEX Z;  2DE6 A;  1K9M 1;  4NBG A;  1KD1 1;  2RPR A;  1N2F A;  1DL6 A;  2ZAE B;  3S16 I;  1VQ6 1;  4A3E I;  3HOZ I;  3S2D I;  2O4H A;  2WAQ A;  2GU2 A;  1Y1W I;  4E33 A;  3D9X A;  5D1O A;  2AKL A;  2R6M A;  3ESW A;  2H85 A;  2OOY B;  1KRL A;  1X3Z A;  1YUK A;  4XX2 A;  3S1R I;  2E2I I;  2B63 I;  2O53 A;  1QVF Y;  3RZD I;  2VUM I;  5FLX f;  2RT9 A;  3PO2 I;  1VQ8 Z;  2JA6 I;  3CCQ Z;  3CCL 1;  1YIT Z;  4MRI A;  2V8I A;  1NJI 1;  4HH4 A;  3K7A I;  1YJ9 1;  2JA5 I;  4CL1 A;  4RV9 A;  1ZH1 A;  4E30 A;  3CQZ I;  2QR1 B;  1VQP Z;  3GTL I;  4NBC A;  2HF1 A;  1L1O C;  2Y0S A;  1RLY A;  3GTJ I;  3HOW I;  4AYB A;  4QTT A;  3GCF A;  3HOX I;  3TE5 B;  1VQL 1;  1KQS Y;  3I56 1;  3M3Y I;  4BBR I;  5C4J I;  2W04 A;  4Y52 I;  3NH4 A;  3RZO I;  4MD8 A;  2QA4 1;  4NBH A;  1WW9 A;  3H3V J;  5FLX b;  2KPI A;  1P9N A;  2VF1 A;  3CCR 1;  4NB9 A;  4Y7N I;  1W2B Z;  2OZK A;  3J81 f;  3S17 I;  5IP9 I;  3CCE Z;  3VMH A;  3CCM Z;  1K73 1;  4NBF A;  1WCM I;  4E32 A;  2W03 A;  1S72 Z;  5A2Q f;  4E2X A;  3FQM A;  3CME 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...