3CCVZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccvZ00
3I551 1VQ41 1Q7Y1 1KD11 1Q822 1KC81 1NJI2 2OTL1 3I55Z 1VQP1 1VQ4Z 1K731 1VQ71 2QA41 1M901 2OTLZ 3CCL1 1VQ61 1QVGZ 3CCS1 1Q861 1KQSY 1K9M1 2QA4Z 3CCLZ 1YIT1 1VQ6Z 1VQ51 1YJW1 1Q812 3CCSZ 1QVFZ 3CCE1 1VQM1 1YJ91 1YITZ 1YJWZ 3CCU1 3CCEZ 3CCQ1 1VQMZ 1M1K2 3CCUZ 3CC21 3CPWZ 1Q7Y2 1JJ2Y 1KC82 1VQ91 3CC2Z 1K732 3CMA1 1VQPZ 1VQ9Z 1M902 1VQ7Z 3CMAZ 1Q862 1K9M2 1K8A1 1N8R2 3I561 1W2BY 3CCR1 1VQ5Z 2OTJ1 3CME1 1KQSZ 3I56Z 3CCM1 1YJ9Z 3OW2Y 3CCRZ 2OTJZ 3G711 3CMEZ 1YIJ1 3CCQZ 3CCMZ 3G4S1 3G71Z 3CXCY 1KD12 1YIJZ 1VQK1 1VQO1 3G4SZ 1Q811 1YHQ1 1VQKZ 1VQOZ 3CCJ1 1JJ2Z 1YHQZ 3CC41 1YI21 3CCV1 1K8A2 2QEX1 3CCJZ 3CD61 1VQ81 3CC4Z 1YI2Z 3CCVZ 1Q821 1QVGY 2QEXZ 1NJI1 3CD6Z 1VQ8Z 1VQN1 1YJN1 1VQL1 1QVFY 1W2BZ 3G6E1 1VQNZ 1YJNZ 1VQLZ 1S721 3OW2Z 3CC71 3G6EZ 1N8R1 1S72Z 3CXCZ 3CC7Z 3CPWY 1M1K1
chains in the Genus database with same CATH superfamily
4NFRA 1Q822 3S2HI 2P3YA 4NBBA 1TWHI 3J80f 1VQP1 1NJI2 2GTHA 2E9HA 1VQ71 4A3KI 2W04A 4MH4A 1VQ61 3S15I 2JNYA 1VQ6Z 2IZ4A 1Q812 2JIOA 4A3LI 1VQM1 4BXXI 3CCU1 2Y0SA 4RVFA 3S1RI 1VQMZ 1M1K2 1N2FA 2VF1A 3CCUZ 4NBEA 2NVYI 1Q7Y2 1JJ2Y 1KC82 3HOVI 2RPRA 1RO2A 2JIQA 3VMHA 2I3CA 2QRDB 4NBCA 2IV2X 4BY1I 2WB1A 1Q862 1K9M2 4XX2A 2QRCB 2JIRA 3NFZA 3U50C 3CME1 1KQSZ 4RVGA 3CCM1 2HF1A 1YJ9Z 2E2HI 3CMEZ 3QWUA 3CCMZ 1KD12 3K7AI 1VQO1 5T6BA 3BG1B 1Q811 5D1OA 1YHQ1 1VQOZ 1I6HI 1YHQZ 2RIQA 3FQQA 3M3YI 2NAPA 3GTOI 4E33A 2VUMI 4RV9A 4HH4A 1YUAA 4BBRI 3I07A 5LL6f 5A2Qb 3IFUA 1Y1WI 3OW2Z 1DL6A 4BY7I 4A3II 3PO3I 1USPA 1NUIA 1ZH1A 4Y7NI 4A3EI 4DK1A 3P5JB 3HOYI 2E7ZA 1VQ41 1KRLA 1KD11 2OZKA 1VQ4Z 1X3ZA 1K731 4X6AI 2V8IA 1M901 1RQFA 2VPZA 1WW9A 3GTQI 1KQSY 3S14I 2VPWA 2DE5A 1YIT1 2RHBA 5C3EI 3GTMS 1TWGI 1QVFZ 2NVTI 3GTGI 2O53A 4RVDA 1TWFI 1YITZ 4NBAA 2K3RA 3D2LA 1QXFA 4NBGA 1JWHC 3NH5A 3CCQ1 3J7A4 2QR1B 5C44I 3VTNA 3FQMA 2EGTA 3F3PC 2WAQA 3FKII 1VQPZ 2F4MA 5A2Qf 1VQ7Z 5C4XI 1Z03A 1VLAA 3GTLI 1YUKA 2H85A 3EEDA 3VMIA 2J6AA 3IF8A 4E31A 5C4JI 2Q51A 1FDIA 3OW2Y 2R7ZI 5D1PA 1K83I 2R92I 4MD7A 2VUGA 1WIIA 3G4S1 3PO2I 2KPIA 4A3MI 3MONA 3G4SZ 4DQYB 3S2DI 3GCFA 4RS4A 5T67A 2JS4A 1YI21 3CCV1 2E2JI 1K8A2 2QEX1 1YI2Z 3CCVZ 1Q821 3I4NI 2QEXZ 1NJI1 4QTTA 1AA6A 2JA7I 1VQL1 1QVFY 2JA5I 3HOUI 1W2BZ 2JA8I 1VQLZ 1S721 3Q87A 1FDOA 4A3JI 1S72Z 3S16I 3CXCZ 2LFUA 4MD9A 2JR6A 4E30A 2IZ3A 4QTUA 4MONA 3GTPI 1M1K1 4EWCA 3S1MI 5IP9I 3I4MI 1Q7Y1 1KC81 4A3DI 3MZLB 2E2II 5D1OB 2ZAEB 2YU9I 1QVGZ 3CCS1 1Q861 3RZOI 3D9XA 1K9M1 1VQ51 2DE6A 1YJW1 3CCSZ 3CQZI 2GU2A 2LIYA 1YJWZ 4Y52I 1TWAI 4NBHA 3J81f 2HU9A 1RO4A 2VPXA 4HGYA 2R93I 2O4HA 4S1TA 3PO3S 5IP7I 5FLXf 4DGLA 1S7MA 1Z02A 1VQ91 3HOXI 4E32A 3S17I 1RNIA 1VQ9Z 1PFTA 4MRIA 2JA6I 1USPB 1X0TA 3EERA 3H3VJ 1Y1VI 1N8R2 2QKDA 2AKLA 1P9NA 1W2BY 1Z01A 2BJOA 2M48A 3M4OI 2PM9A 3CCQZ 1QF8A 3KIHA 3CXCY 1VQK1 2LEXA 3JAMf 2PK7A 3GTJI 1VQKZ 3H0GI 3CCJ1 1WCMI 1SFOI 3HOWI 5T64A 3F3FC 2B63I 3CCJZ 3CD61 4MD8A 1VQ81 2AYDA 3D6WA 1QVGY 3CD6Z 3S1NI 1VQ8Z 4E2YA 2JIPA 4A93I 2KI7B 3G6E1 3RZDI 2K5RA 2VPYA 3NDJA 3G6EZ 1SIWA 2PMZA 2V3VA 4AYBA 1N8R1 1RLYA 1ZB9A 4E2XA 4A3BI 3GKQA 3J81b 3IR7A 3S1QI 3I551 1ML8A 1TFIA 5FLXb 1ZB8A 2OTL1 3I55Z 4HGZA 2OOXB 2YADA 2QA41 2OTLZ 1I3QI 3CCL1 3ESWA 1QYPA 1NP6A 3IX0A 4E2ZA 2QA4Z 4NB9A 4A3CI 3CCLZ 2P28A 3MZKB 3CCE1 2V8JA 1YJ91 5IT9b 4MXUA 3CCEZ 2V45A 4A3GI 2G2KA 3HKZA 3CC21 2JUBA 3CPWZ 4A3FI 3JAMb 5AN9F 3TE5B 3NH4A 3CC2Z 1L1OC 3T4NB 1K732 4CL1A 3CMA1 1M902 5FLMI 1LQLA 2M6NA 3VB9A 3CMAZ 2GTIA 1K8A1 3I561 1RO0A 2NVQI 3CCR1 1VQ5Z 2OTJ1 2OOYB 2QLVB 3I56Z 3J80b 3TDHB 3CCRZ 2OTJZ 3G711 1YIJ1 1R9TI 4NBDA 3BG0B 3KIFA 4BBSI 3GTKI 3G71Z 1YIJZ 2V8KA 2RBLA 2NVXI 4NB8A 1WZNA 1JJ2Z 4NBFA 1TWCI 4TNUA 2Q4ZA 4NOZA 3CC41 1X3WA 4NH1C 3CC4Z 1WJ2A 5IT9f 2W03A 2R6MA 2JIMA 3GTMI 1VQN1 1YJN1 1Y1VS 3NDIA 2RT9A 2QREB 1I50I 1VQNZ 1YJNZ 5CM2M 4E2WA 3NH8A 2DE7A 1Y8CA 3CC71 3LUSA 4RVHA 3CC7Z 2JMOA 2F4OA 3VMGA 1Q16A 3CPWY 3HOZI
chains in the Genus database with same CATH topology
4NFRA 1Q822 3S2HI 2P3YA 4NBBA 1TWHI 3J80f 1VQP1 1NJI2 2GTHA 2E9HA 1VQ71 4A3KI 2W04A 4MH4A 1VQ61 3S15I 2JNYA 1VQ6Z 2IZ4A 1Q812 4A3LI 1VQM1 4BXXI 3CCU1 2Y0SA 4RVFA 3S1RI 1VQMZ 1M1K2 1N2FA 2VF1A 3CCUZ 4NBEA 2NVYI 1Q7Y2 1JJ2Y 1KC82 3HOVI 2RPRA 1RO2A 3VMHA 2I3CA 2QRDB 4NBCA 4BY1I 2WB1A 1Q862 1K9M2 4XX2A 2QRCB 3NFZA 3U50C 3CME1 1KQSZ 4RVGA 3CCM1 2HF1A 1YJ9Z 2E2HI 3CMEZ 3QWUA 3CCMZ 1KD12 3K7AI 1VQO1 5T6BA 3BG1B 1Q811 5D1OA 1YHQ1 1VQOZ 1I6HI 1YHQZ 2RIQA 3FQQA 3M3YI 3GTOI 4E33A 2VUMI 4RV9A 4HH4A 1YUAA 4BBRI 3I07A 5LL6f 5A2Qb 3IFUA 1Y1WI 3OW2Z 1DL6A 4BY7I 4A3II 3PO3I 1USPA 1NUIA 1ZH1A 4Y7NI 4A3EI 4DK1A 3P5JB 3HOYI 1VQ41 1KRLA 1KD11 2OZKA 1VQ4Z 1X3ZA 1K731 4X6AI 2V8IA 1M901 1RQFA 1WW9A 3GTQI 1KQSY 3S14I 2DE5A 1YIT1 2RHBA 5C3EI 3GTMS 1TWGI 1QVFZ 2NVTI 3GTGI 2O53A 4RVDA 1TWFI 1YITZ 4NBAA 2K3RA 4NBGA 1JWHC 3NH5A 3CCQ1 3J7A4 2QR1B 5C44I 3VTNA 3FQMA 2EGTA 3F3PC 2WAQA 3FKII 1VQPZ 2F4MA 5A2Qf 1VQ7Z 5C4XI 1Z03A 1VLAA 3GTLI 1YUKA 2H85A 3EEDA 3VMIA 2J6AA 3IF8A 4E31A 5C4JI 2Q51A 3OW2Y 2R7ZI 5D1PA 1K83I 2R92I 4MD7A 2VUGA 1WIIA 3G4S1 3PO2I 2KPIA 4A3MI 3MONA 3G4SZ 4DQYB 3S2DI 3GCFA 4RS4A 5T67A 2JS4A 1YI21 3CCV1 2E2JI 1K8A2 2QEX1 1YI2Z 3CCVZ 1Q821 3I4NI 2QEXZ 1NJI1 4QTTA 2JA7I 1VQL1 1QVFY 2JA5I 3HOUI 1W2BZ 2JA8I 1VQLZ 1S721 3Q87A 4A3JI 1S72Z 3S16I 3CXCZ 2LFUA 4MD9A 2JR6A 4E30A 2IZ3A 4QTUA 4MONA 3GTPI 1M1K1 4EWCA 3S1MI 5IP9I 3I4MI 1Q7Y1 1KC81 4A3DI 3MZLB 2E2II 5D1OB 2ZAEB 2YU9I 1QVGZ 3CCS1 1Q861 3RZOI 3D9XA 1K9M1 1VQ51 2DE6A 1YJW1 3CCSZ 3CQZI 2GU2A 2LIYA 1YJWZ 4Y52I 1TWAI 4NBHA 3J81f 2HU9A 1RO4A 4HGYA 2R93I 2O4HA 4S1TA 3PO3S 5IP7I 5FLXf 4DGLA 1S7MA 1Z02A 1VQ91 3HOXI 4E32A 3S17I 1RNIA 1VQ9Z 1PFTA 4MRIA 2JA6I 1USPB 1X0TA 3EERA 3H3VJ 1Y1VI 1N8R2 2QKDA 2AKLA 1P9NA 1W2BY 1Z01A 2BJOA 2M48A 3M4OI 2PM9A 3CCQZ 1QF8A 3KIHA 3CXCY 1VQK1 3JAMf 2PK7A 3GTJI 1VQKZ 3H0GI 3CCJ1 1WCMI 1SFOI 3HOWI 5T64A 3F3FC 2B63I 3CCJZ 3CD61 4MD8A 1VQ81 3D6WA 1QVGY 3CD6Z 3S1NI 1VQ8Z 4E2YA 4A93I 2KI7B 3G6E1 3RZDI 2K5RA 3NDJA 3G6EZ 2PMZA 4AYBA 1N8R1 1RLYA 1ZB9A 4E2XA 4A3BI 3GKQA 3J81b 3S1QI 3I551 1ML8A 1TFIA 5FLXb 1ZB8A 2OTL1 3I55Z 4HGZA 2OOXB 2YADA 2QA41 2OTLZ 1I3QI 3CCL1 3ESWA 1QYPA 1NP6A 3IX0A 4E2ZA 2QA4Z 4NB9A 4A3CI 3CCLZ 2P28A 3MZKB 3CCE1 2V8JA 1YJ91 5IT9b 4MXUA 3CCEZ 4A3GI 2G2KA 3HKZA 3CC21 2JUBA 3CPWZ 4A3FI 3JAMb 5AN9F 3TE5B 3NH4A 3CC2Z 1L1OC 3T4NB 1K732 4CL1A 3CMA1 1M902 5FLMI 1LQLA 2M6NA 3VB9A 3CMAZ 2GTIA 1K8A1 3I561 1RO0A 2NVQI 3CCR1 1VQ5Z 2OTJ1 2OOYB 2QLVB 3I56Z 3J80b 3TDHB 3CCRZ 2OTJZ 3G711 1YIJ1 1R9TI 4NBDA 3BG0B 3KIFA 4BBSI 3GTKI 3G71Z 1YIJZ 2V8KA 2RBLA 2NVXI 4NB8A 1JJ2Z 4NBFA 1TWCI 4TNUA 2Q4ZA 4NOZA 3CC41 1X3WA 4NH1C 3CC4Z 5IT9f 2W03A 2R6MA 3GTMI 1VQN1 1YJN1 1Y1VS 3NDIA 2RT9A 2QREB 1I50I 1VQNZ 1YJNZ 5CM2M 4E2WA 3NH8A 2DE7A 3CC71 3LUSA 4RVHA 3CC7Z 2JMOA 2F4OA 3VMGA 3CPWY 3HOZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 1;  1VQ4 1;  1Q7Y 1;  1KD1 1;  1Q82 2;  1KC8 1;  1NJI 2;  2OTL 1;  3I55 Z;  1VQP 1;  1VQ4 Z;  1K73 1;  1VQ7 1;  2QA4 1;  1M90 1;  2OTL Z;  3CCL 1;  1VQ6 1;  1QVG Z;  3CCS 1;  1Q86 1;  1KQS Y;  1K9M 1;  2QA4 Z;  3CCL Z;  1YIT 1;  1VQ6 Z;  1VQ5 1;  1YJW 1;  1Q81 2;  3CCS Z;  1QVF Z;  3CCE 1;  1VQM 1;  1YJ9 1;  1YIT Z;  1YJW Z;  3CCU 1;  3CCE Z;  3CCQ 1;  1VQM Z;  1M1K 2;  3CCU Z;  3CC2 1;  3CPW Z;  1Q7Y 2;  1JJ2 Y;  1KC8 2;  1VQ9 1;  3CC2 Z;  1K73 2;  3CMA 1;  1VQP Z;  1VQ9 Z;  1M90 2;  1VQ7 Z;  3CMA Z;  1Q86 2;  1K9M 2;  1K8A 1;  1N8R 2;  3I56 1;  1W2B Y;  3CCR 1;  1VQ5 Z;  2OTJ 1;  3CME 1;  1KQS Z;  3I56 Z;  3CCM 1;  1YJ9 Z;  3OW2 Y;  3CCR Z;  2OTJ Z;  3G71 1;  3CME Z;  1YIJ 1;  3CCQ Z;  3CCM Z;  3G4S 1;  3G71 Z;  3CXC Y;  1KD1 2;  1YIJ Z;  1VQK 1;  1VQO 1;  3G4S Z;  1Q81 1;  1YHQ 1;  1VQK Z;  1VQO Z;  3CCJ 1;  1JJ2 Z;  1YHQ Z;  3CC4 1;  1YI2 1;  3CCV 1;  1K8A 2;  2QEX 1;  3CCJ Z;  3CD6 1;  1VQ8 1;  3CC4 Z;  1YI2 Z;  3CCV Z;  1Q82 1;  1QVG Y;  2QEX Z;  1NJI 1;  3CD6 Z;  1VQ8 Z;  1VQN 1;  1YJN 1;  1VQL 1;  1QVF Y;  1W2B Z;  3G6E 1;  1VQN Z;  1YJN Z;  1VQL Z;  1S72 1;  3OW2 Z;  3CC7 1;  3G6E Z;  1N8R 1;  1S72 Z;  3CXC Z;  3CC7 Z;  3CPW Y;  1M1K 1; 
#chains in the Genus database with same CATH topology
 4NFR A;  1Q82 2;  3S2H I;  2P3Y A;  4NBB A;  1TWH I;  3J80 f;  1VQP 1;  1NJI 2;  2GTH A;  2E9H A;  1VQ7 1;  4A3K I;  2W04 A;  4MH4 A;  1VQ6 1;  3S15 I;  2JNY A;  1VQ6 Z;  2IZ4 A;  1Q81 2;  2JIO A;  4A3L I;  1VQM 1;  4BXX I;  3CCU 1;  2Y0S A;  4RVF A;  3S1R I;  1VQM Z;  1M1K 2;  1N2F A;  2VF1 A;  3CCU Z;  4NBE A;  2NVY I;  1Q7Y 2;  1JJ2 Y;  1KC8 2;  3HOV I;  2RPR A;  1RO2 A;  2JIQ A;  3VMH A;  2I3C A;  2QRD B;  4NBC A;  2IV2 X;  4BY1 I;  2WB1 A;  1Q86 2;  1K9M 2;  4XX2 A;  2QRC B;  2JIR A;  3NFZ A;  3U50 C;  3CME 1;  1KQS Z;  4RVG A;  3CCM 1;  2HF1 A;  1YJ9 Z;  2E2H I;  3CME Z;  3QWU A;  3CCM Z;  1KD1 2;  3K7A I;  1VQO 1;  5T6B A;  3BG1 B;  1Q81 1;  5D1O A;  1YHQ 1;  1VQO Z;  1I6H I;  1YHQ Z;  2RIQ A;  3FQQ A;  3M3Y I;  2NAP A;  3GTO I;  4E33 A;  2VUM I;  4RV9 A;  4HH4 A;  1YUA A;  4BBR I;  3I07 A;  5LL6 f;  5A2Q b;  3IFU A;  1Y1W I;  3OW2 Z;  1DL6 A;  4BY7 I;  4A3I I;  3PO3 I;  1USP A;  1NUI A;  1ZH1 A;  4Y7N I;  4A3E I;  4DK1 A;  3P5J B;  3HOY I;  2E7Z A;  1VQ4 1;  1KRL A;  1KD1 1;  2OZK A;  1VQ4 Z;  1X3Z A;  1K73 1;  4X6A I;  2V8I A;  1M90 1;  1RQF A;  2VPZ A;  1WW9 A;  3GTQ I;  1KQS Y;  3S14 I;  2VPW A;  2DE5 A;  1YIT 1;  2RHB A;  5C3E I;  3GTM S;  1TWG I;  1QVF Z;  2NVT I;  3GTG I;  2O53 A;  4RVD A;  1TWF I;  1YIT Z;  4NBA A;  2K3R A;  3D2L A;  1QXF A;  4NBG A;  1JWH C;  3NH5 A;  3CCQ 1;  3J7A 4;  2QR1 B;  5C44 I;  3VTN A;  3FQM A;  2EGT A;  3F3P C;  2WAQ A;  3FKI I;  1VQP Z;  2F4M A;  5A2Q f;  1VQ7 Z;  5C4X I;  1Z03 A;  1VLA A;  3GTL I;  1YUK A;  2H85 A;  3EED A;  3VMI A;  2J6A A;  3IF8 A;  4E31 A;  5C4J I;  2Q51 A;  1FDI A;  3OW2 Y;  2R7Z I;  5D1P A;  1K83 I;  2R92 I;  4MD7 A;  2VUG A;  1WII A;  3G4S 1;  3PO2 I;  2KPI A;  4A3M I;  3MON A;  3G4S Z;  4DQY B;  3S2D I;  3GCF A;  4RS4 A;  5T67 A;  2JS4 A;  1YI2 1;  3CCV 1;  2E2J I;  1K8A 2;  2QEX 1;  1YI2 Z;  3CCV Z;  1Q82 1;  3I4N I;  2QEX Z;  1NJI 1;  4QTT A;  1AA6 A;  2JA7 I;  1VQL 1;  1QVF Y;  2JA5 I;  3HOU I;  1W2B Z;  2JA8 I;  1VQL Z;  1S72 1;  3Q87 A;  1FDO A;  4A3J I;  1S72 Z;  3S16 I;  3CXC Z;  2LFU A;  4MD9 A;  2JR6 A;  4E30 A;  2IZ3 A;  4QTU A;  4MON A;  3GTP I;  1M1K 1;  4EWC A;  3S1M I;  5IP9 I;  3I4M I;  1Q7Y 1;  1KC8 1;  4A3D I;  3MZL B;  2E2I I;  5D1O B;  2ZAE B;  2YU9 I;  1QVG Z;  3CCS 1;  1Q86 1;  3RZO I;  3D9X A;  1K9M 1;  1VQ5 1;  2DE6 A;  1YJW 1;  3CCS Z;  3CQZ I;  2GU2 A;  2LIY A;  1YJW Z;  4Y52 I;  1TWA I;  4NBH A;  3J81 f;  2HU9 A;  1RO4 A;  2VPX A;  4HGY A;  2R93 I;  2O4H A;  4S1T A;  3PO3 S;  5IP7 I;  5FLX f;  4DGL A;  1S7M A;  1Z02 A;  1VQ9 1;  3HOX I;  4E32 A;  3S17 I;  1RNI A;  1VQ9 Z;  1PFT A;  4MRI A;  2JA6 I;  1USP B;  1X0T A;  3EER A;  3H3V J;  1Y1V I;  1N8R 2;  2QKD A;  2AKL A;  1P9N A;  1W2B Y;  1Z01 A;  2BJO A;  2M48 A;  3M4O I;  2PM9 A;  3CCQ Z;  1QF8 A;  3KIH A;  3CXC Y;  1VQK 1;  2LEX A;  3JAM f;  2PK7 A;  3GTJ I;  1VQK Z;  3H0G I;  3CCJ 1;  1WCM I;  1SFO I;  3HOW I;  5T64 A;  3F3F C;  2B63 I;  3CCJ Z;  3CD6 1;  4MD8 A;  1VQ8 1;  2AYD A;  3D6W A;  1QVG Y;  3CD6 Z;  3S1N I;  1VQ8 Z;  4E2Y A;  2JIP A;  4A93 I;  2KI7 B;  3G6E 1;  3RZD I;  2K5R A;  2VPY A;  3NDJ A;  3G6E Z;  1SIW A;  2PMZ A;  2V3V A;  4AYB A;  1N8R 1;  1RLY A;  1ZB9 A;  4E2X A;  4A3B I;  3GKQ A;  3J81 b;  3IR7 A;  3S1Q I;  3I55 1;  1ML8 A;  1TFI A;  5FLX b;  1ZB8 A;  2OTL 1;  3I55 Z;  4HGZ A;  2OOX B;  2YAD A;  2QA4 1;  2OTL Z;  1I3Q I;  3CCL 1;  3ESW A;  1QYP A;  1NP6 A;  3IX0 A;  4E2Z A;  2QA4 Z;  4NB9 A;  4A3C I;  3CCL Z;  2P28 A;  3MZK B;  3CCE 1;  2V8J A;  1YJ9 1;  5IT9 b;  4MXU A;  3CCE Z;  2V45 A;  4A3G I;  2G2K A;  3HKZ A;  3CC2 1;  2JUB A;  3CPW Z;  4A3F I;  3JAM b;  5AN9 F;  3TE5 B;  3NH4 A;  3CC2 Z;  1L1O C;  3T4N B;  1K73 2;  4CL1 A;  3CMA 1;  1M90 2;  5FLM I;  1LQL A;  2M6N A;  3VB9 A;  3CMA Z;  2GTI A;  1K8A 1;  3I56 1;  1RO0 A;  2NVQ I;  3CCR 1;  1VQ5 Z;  2OTJ 1;  2OOY B;  2QLV B;  3I56 Z;  3J80 b;  3TDH B;  3CCR Z;  2OTJ Z;  3G71 1;  1YIJ 1;  1R9T I;  4NBD A;  3BG0 B;  3KIF A;  4BBS I;  3GTK I;  3G71 Z;  1YIJ Z;  2V8K A;  2RBL A;  2NVX I;  4NB8 A;  1WZN A;  1JJ2 Z;  4NBF A;  1TWC I;  4TNU A;  2Q4Z A;  4NOZ A;  3CC4 1;  1X3W A;  4NH1 C;  3CC4 Z;  1WJ2 A;  5IT9 f;  2W03 A;  2R6M A;  2JIM A;  3GTM I;  1VQN 1;  1YJN 1;  1Y1V S;  3NDI A;  2RT9 A;  2QRE B;  1I50 I;  1VQN Z;  1YJN Z;  5CM2 M;  4E2W A;  3NH8 A;  2DE7 A;  1Y8C A;  3CC7 1;  3LUS A;  4RVH A;  3CC7 Z;  2JMO A;  2F4O A;  3VMG A;  1Q16 A;  3CPW Y;  3HOZ I; 
#chains in the Genus database with same CATH homology
 4NFR A;  1Q82 2;  3S2H I;  2P3Y A;  4NBB A;  1TWH I;  3J80 f;  1VQP 1;  1NJI 2;  2GTH A;  2E9H A;  1VQ7 1;  4A3K I;  2W04 A;  4MH4 A;  1VQ6 1;  3S15 I;  2JNY A;  1VQ6 Z;  2IZ4 A;  1Q81 2;  4A3L I;  1VQM 1;  4BXX I;  3CCU 1;  2Y0S A;  4RVF A;  3S1R I;  1VQM Z;  1M1K 2;  1N2F A;  2VF1 A;  3CCU Z;  4NBE A;  2NVY I;  1Q7Y 2;  1JJ2 Y;  1KC8 2;  3HOV I;  2RPR A;  1RO2 A;  3VMH A;  2I3C A;  2QRD B;  4NBC A;  4BY1 I;  2WB1 A;  1Q86 2;  1K9M 2;  4XX2 A;  2QRC B;  3NFZ A;  3U50 C;  3CME 1;  1KQS Z;  4RVG A;  3CCM 1;  2HF1 A;  1YJ9 Z;  2E2H I;  3CME Z;  3QWU A;  3CCM Z;  1KD1 2;  3K7A I;  1VQO 1;  5T6B A;  3BG1 B;  1Q81 1;  5D1O A;  1YHQ 1;  1VQO Z;  1I6H I;  1YHQ Z;  2RIQ A;  3FQQ A;  3M3Y I;  3GTO I;  4E33 A;  2VUM I;  4RV9 A;  4HH4 A;  1YUA A;  4BBR I;  3I07 A;  5LL6 f;  5A2Q b;  3IFU A;  1Y1W I;  3OW2 Z;  1DL6 A;  4BY7 I;  4A3I I;  3PO3 I;  1USP A;  1NUI A;  1ZH1 A;  4Y7N I;  4A3E I;  4DK1 A;  3P5J B;  3HOY I;  1VQ4 1;  1KRL A;  1KD1 1;  2OZK A;  1VQ4 Z;  1X3Z A;  1K73 1;  4X6A I;  2V8I A;  1M90 1;  1RQF A;  1WW9 A;  3GTQ I;  1KQS Y;  3S14 I;  2DE5 A;  1YIT 1;  2RHB A;  5C3E I;  3GTM S;  1TWG I;  1QVF Z;  2NVT I;  3GTG I;  2O53 A;  4RVD A;  1TWF I;  1YIT Z;  4NBA A;  2K3R A;  4NBG A;  1JWH C;  3NH5 A;  3CCQ 1;  3J7A 4;  2QR1 B;  5C44 I;  3VTN A;  3FQM A;  2EGT A;  3F3P C;  2WAQ A;  3FKI I;  1VQP Z;  2F4M A;  5A2Q f;  1VQ7 Z;  5C4X I;  1Z03 A;  1VLA A;  3GTL I;  1YUK A;  2H85 A;  3EED A;  3VMI A;  2J6A A;  3IF8 A;  4E31 A;  5C4J I;  2Q51 A;  3OW2 Y;  2R7Z I;  5D1P A;  1K83 I;  2R92 I;  4MD7 A;  2VUG A;  1WII A;  3G4S 1;  3PO2 I;  2KPI A;  4A3M I;  3MON A;  3G4S Z;  4DQY B;  3S2D I;  3GCF A;  4RS4 A;  5T67 A;  2JS4 A;  1YI2 1;  3CCV 1;  2E2J I;  1K8A 2;  2QEX 1;  1YI2 Z;  3CCV Z;  1Q82 1;  3I4N I;  2QEX Z;  1NJI 1;  4QTT A;  2JA7 I;  1VQL 1;  1QVF Y;  2JA5 I;  3HOU I;  1W2B Z;  2JA8 I;  1VQL Z;  1S72 1;  3Q87 A;  4A3J I;  1S72 Z;  3S16 I;  3CXC Z;  2LFU A;  4MD9 A;  2JR6 A;  4E30 A;  2IZ3 A;  4QTU A;  4MON A;  3GTP I;  1M1K 1;  4EWC A;  3S1M I;  5IP9 I;  3I4M I;  1Q7Y 1;  1KC8 1;  4A3D I;  3MZL B;  2E2I I;  5D1O B;  2ZAE B;  2YU9 I;  1QVG Z;  3CCS 1;  1Q86 1;  3RZO I;  3D9X A;  1K9M 1;  1VQ5 1;  2DE6 A;  1YJW 1;  3CCS Z;  3CQZ I;  2GU2 A;  2LIY A;  1YJW Z;  4Y52 I;  1TWA I;  4NBH A;  3J81 f;  2HU9 A;  1RO4 A;  4HGY A;  2R93 I;  2O4H A;  4S1T A;  3PO3 S;  5IP7 I;  5FLX f;  4DGL A;  1S7M A;  1Z02 A;  1VQ9 1;  3HOX I;  4E32 A;  3S17 I;  1RNI A;  1VQ9 Z;  1PFT A;  4MRI A;  2JA6 I;  1USP B;  1X0T A;  3EER A;  3H3V J;  1Y1V I;  1N8R 2;  2QKD A;  2AKL A;  1P9N A;  1W2B Y;  1Z01 A;  2BJO A;  2M48 A;  3M4O I;  2PM9 A;  3CCQ Z;  1QF8 A;  3KIH A;  3CXC Y;  1VQK 1;  3JAM f;  2PK7 A;  3GTJ I;  1VQK Z;  3H0G I;  3CCJ 1;  1WCM I;  1SFO I;  3HOW I;  5T64 A;  3F3F C;  2B63 I;  3CCJ Z;  3CD6 1;  4MD8 A;  1VQ8 1;  3D6W A;  1QVG Y;  3CD6 Z;  3S1N I;  1VQ8 Z;  4E2Y A;  4A93 I;  2KI7 B;  3G6E 1;  3RZD I;  2K5R A;  3NDJ A;  3G6E Z;  2PMZ A;  4AYB A;  1N8R 1;  1RLY A;  1ZB9 A;  4E2X A;  4A3B I;  3GKQ A;  3J81 b;  3S1Q I;  3I55 1;  1ML8 A;  1TFI A;  5FLX b;  1ZB8 A;  2OTL 1;  3I55 Z;  4HGZ A;  2OOX B;  2YAD A;  2QA4 1;  2OTL Z;  1I3Q I;  3CCL 1;  3ESW A;  1QYP A;  1NP6 A;  3IX0 A;  4E2Z A;  2QA4 Z;  4NB9 A;  4A3C I;  3CCL Z;  2P28 A;  3MZK B;  3CCE 1;  2V8J A;  1YJ9 1;  5IT9 b;  4MXU A;  3CCE Z;  4A3G I;  2G2K A;  3HKZ A;  3CC2 1;  2JUB A;  3CPW Z;  4A3F I;  3JAM b;  5AN9 F;  3TE5 B;  3NH4 A;  3CC2 Z;  1L1O C;  3T4N B;  1K73 2;  4CL1 A;  3CMA 1;  1M90 2;  5FLM I;  1LQL A;  2M6N A;  3VB9 A;  3CMA Z;  2GTI A;  1K8A 1;  3I56 1;  1RO0 A;  2NVQ I;  3CCR 1;  1VQ5 Z;  2OTJ 1;  2OOY B;  2QLV B;  3I56 Z;  3J80 b;  3TDH B;  3CCR Z;  2OTJ Z;  3G71 1;  1YIJ 1;  1R9T I;  4NBD A;  3BG0 B;  3KIF A;  4BBS I;  3GTK I;  3G71 Z;  1YIJ Z;  2V8K A;  2RBL A;  2NVX I;  4NB8 A;  1JJ2 Z;  4NBF A;  1TWC I;  4TNU A;  2Q4Z A;  4NOZ A;  3CC4 1;  1X3W A;  4NH1 C;  3CC4 Z;  5IT9 f;  2W03 A;  2R6M A;  3GTM I;  1VQN 1;  1YJN 1;  1Y1V S;  3NDI A;  2RT9 A;  2QRE B;  1I50 I;  1VQN Z;  1YJN Z;  5CM2 M;  4E2W A;  3NH8 A;  2DE7 A;  3CC7 1;  3LUS A;  4RVH A;  3CC7 Z;  2JMO A;  2F4O A;  3VMG A;  3CPW Y;  3HOZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...