3CCVZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccvZ00
1YIJ1 3CCLZ 1VQNZ 1Q862 1KC81 1QVFY 1KD12 1KD11 2OTJZ 1YITZ 1W2BY 1VQ5Z 2QEX1 1YJ9Z 3CXCZ 3CCUZ 1VQM1 3CME1 3CCVZ 1VQ4Z 1M1K1 1KQSY 3CCR1 1VQP1 1YI2Z 3CMA1 1VQK1 3G4SZ 3CCSZ 1YJNZ 3CMAZ 1VQPZ 1JJ2Y 1JJ2Z 1KC82 3CCJZ 1Q861 3G711 1VQ81 2QEXZ 1YJ91 3CCM1 3CCQ1 1K9M2 3I55Z 3CCEZ 1VQ61 3CCL1 1K731 1YIJZ 1YJN1 1VQOZ 1QVFZ 1VQ9Z 1M902 1NJI1 1VQ41 1Q812 1VQO1 1Q821 1N8R2 1VQ51 3CC21 1VQL1 3CCE1 3I551 1S72Z 3CC2Z 1YHQ1 1VQLZ 1K8A1 1YJW1 3I561 1VQ8Z 1Q7Y2 2OTL1 3G71Z 3CCJ1 1QVGY 1Q822 3CD6Z 3G4S1 3CCS1 1Q811 1VQ71 2QA41 1NJI2 1VQ6Z 3G6EZ 3CPWY 1M901 3CCV1 3CMEZ 1KQSZ 1VQ7Z 1Q7Y1 3CCQZ 3CCMZ 1K8A2 3CC7Z 1YIT1 3OW2Y 3OW2Z 1QVGZ 2OTJ1 3CPWZ 3CXCY 1N8R1 3CC71 1YJWZ 1YHQZ 1VQKZ 1S721 1YI21 3CCRZ 3CC41 3G6E1 2QA4Z 3CCU1 1VQMZ 1W2BZ 1K732 3CD61 3CC4Z 1M1K2 1K9M1 1VQ91 1VQN1 2OTLZ 3I56Z
chains in the Genus database with same CATH superfamily
3IX0A 3CCLZ 1VQNZ 5IP9I 3D2LA 3VB9A 2F4OA 1R9TI 1YUKA 2JR6A 1YJ9Z 4BY1I 2JMOA 2RPRA 4TNUA 3CCR1 2Q51A 3CMA1 1VQK1 2LFUA 3QWUA 3Q87A 4A3CI 1SFOI 3S14I 1VQPZ 3HOUI 1X3ZA 3CCJZ 3G711 2QEXZ 2V8JA 3S16I 4QTTA 5CM2M 5AN9F 4BY7I 3I55Z 4E33A 2IZ3A 3NH4A 2M6NA 1TWGI 1ZH1A 1I3QI 1YJN1 3VTNA 2QRDB 4BXXI 1WCMI 1M902 1WIIA 4E2YA 3M3YI 1Y1VS 4NBBA 5T64A 4X6AI 1YHQ1 3NDIA 3S1RI 1FDIA 2V45A 2JIOA 4A3II 4NBDA 1ZB8A 1Q822 3CD6Z 2KPIA 4S1TA 5C3EI 2O53A 2IV2X 3PO3I 2QA41 1VQ6Z 2DE5A 3G6EZ 1M901 2ZAEB 1WW9A 5IT9f 2B63I 3RZOI 3LUSA 1TWCI 5D1PA 4MRIA 3CCMZ 3J81f 4E32A 1K8A2 4E31A 1YIT1 2HU9A 4NFRA 3GTQI 1L1OC 3CPWZ 4CL1A 2E2JI 2GTIA 3CC41 2OOXB 2QA4Z 3HOVI 5A2Qb 2JUBA 1W2BZ 4E30A 3GTGI 2M48A 3J7A4 3CC4Z 2P3YA 1Q16A 1QXFA 3F3PC 1Q862 1KC81 1QVFY 1KD12 1KD11 3I4MI 4MD7A 1YITZ 1W2BY 1NP6A 2JNYA 2RIQA 2QEX1 3CXCZ 3CCVZ 2JA5I 2I3CA 3PO2I 1YJNZ 4MD9A 3CMAZ 3CQZI 3VMIA 1JJ2Z 2RBLA 1LQLA 1VQ81 2NVQI 2GTHA 1JWHC 2RHBA 4RS4A 1K731 1QVFZ 3S17I 3IR7A 4DGLA 1AA6A 3RZDI 1VQ9Z 1I50I 4BBSI 4NBAA 1RO2A 1VQ41 1I6HI 1NUIA 1VQO1 5T6BA 4EWCA 4A3JI 3H0GI 1Q821 5T67A 4NBFA 5LL6f 2F4MA 2R7ZI 4RVFA 5FLMI 3KIFA 2V8KA 1YJW1 1Z01A 5IP7I 2NVTI 1Q7Y2 2OTL1 1TWHI 3S2DI 3NH8A 1ZB9A 2WB1A 3J80b 4A3EI 2YADA 4E2WA 3IF8A 3TDHB 3EERA 1Q811 4Y7NI 1VQ71 1Y1WI 1FDOA 1PFTA 4A93I 3GCFA 3CMEZ 2BJOA 1VQ7Z 1Q7Y1 2YU9I 4DQYB 2VUGA 2QKDA 3NH5A 1N2FA 3K7AI 4A3MI 5C44I 2NAPA 5IT9b 3GTPI 2P28A 1USPA 1VQKZ 1S721 1YI21 4MXUA 3CCRZ 4NOZA 3S2HI 5D1OB 3HOYI 3GTMS 2QR1B 2JA6I 1K9M1 1RQFA 1VQN1 2O4HA 1YIJ1 3PO3S 2VUMI 3EEDA 3F3FC 2OTJZ 2OOYB 4NH1C 4NB9A 3GKQA 3CCUZ 1VQM1 3CME1 1USPB 1VQ4Z 1M1K1 1YI2Z 3S1NI 3I07A 3D6WA 5C4JI 2QRCB 3G4SZ 3CCSZ 4HGYA 5FLXb 1X3WA 1Q861 4NBGA 4RVHA 1VLAA 2JA8I 2QREB 4MD8A 1K9M2 2K5RA 3P5JB 2VPXA 1YUAA 3GTOI 3HOZI 1RNIA 3S15I 1VQOZ 2VPYA 2AKLA 1NJI1 4NBHA 2LIYA 2QLVB 4NBEA 3T4NB 4HGZA 1VQ51 3CCE1 3CC2Z 1VQLZ 2PM9A 3I561 4DK1A 1VQ8Z 1Y8CA 3ESWA 2W03A 2GU2A 2DE7A 3GTJI 1QF8A 2VPWA 1TFIA 1TWFI 3CCV1 1KQSZ 3CCQZ 4MH4A 3CC7Z 2JIRA 4HH4A 2RT9A 2JA7I 1ML8A 1SIWA 3CXCY 1QYPA 2E2HI 1X0TA 3CC71 2VF1A 4NBCA 4AYBA 1YHQZ 3G6E1 3U50C 1K83I 1TWAI 2Q4ZA 2E2II 3J80f 1RO4A 1K732 3FQQA 3CD61 1M1K2 2PMZA 2JS4A 3I56Z 3HOXI 4Y52I 1Z03A 3KIHA 3J81b 2E7ZA 1VQ5Z 2W04A 4A3FI 3HOWI 2NVYI 1KQSY 2R6MA 1VQP1 2J6AA 2E9HA 5A2Qf 1JJ2Y 2K3RA 1KC82 3S1QI 1YJ91 2V8IA 3CCM1 3CCQ1 4A3GI 3FQMA 2JIQA 2Y0SA 3NFZA 3JAMf 3CCEZ 4QTUA 1VQ61 2VPZA 3CCL1 1WJ2A 1YIJZ 1S7MA 5D1OA 3I4NI 3S1MI 4XX2A 2OZKA 3MONA 1Z02A 1Q812 1N8R2 3CC21 1VQL1 2DE6A 3IFUA 5C4XI 3GTLI 3I551 1S72Z 2JIMA 4RV9A 3M4OI 3JAMb 1DL6A 1K8A1 2KI7B 3G71Z 3CCJ1 3TE5B 1QVGY 2V3VA 1RLYA 2H85A 4A3KI 3G4S1 3CCS1 2R92I 1RO0A 1NJI2 3GTMI 1WZNA 2G2KA 3CPWY 1KRLA 3MZLB 2JIPA 3HKZA 3MZKB 3D9XA 2R93I 3OW2Y 3OW2Z 1QVGZ 2OTJ1 2WAQA 1Y1VI 3BG1B 2NVXI 3NDJA 1N8R1 2PK7A 1YJWZ 4E2XA 3FKII 4A3LI 4BBRI 4A3BI 4RVDA 4E2ZA 2EGTA 3BG0B 3VMHA 2IZ4A 4RVGA 2HF1A 1VQMZ 3CCU1 5FLXf 4A3DI 2AYDA 1P9NA 3GTKI 2LEXA 4NB8A 1VQ91 3VMGA 3H3VJ 4MONA 2OTLZ
chains in the Genus database with same CATH topology
3IX0A 3CCLZ 1VQNZ 5IP9I 3VB9A 2F4OA 1R9TI 1YUKA 2JR6A 1YJ9Z 4BY1I 2JMOA 2RPRA 4TNUA 3CCR1 2Q51A 3CMA1 1VQK1 2LFUA 3QWUA 3Q87A 4A3CI 1SFOI 3S14I 1VQPZ 3HOUI 1X3ZA 3CCJZ 3G711 2QEXZ 2V8JA 3S16I 4QTTA 5CM2M 5AN9F 4BY7I 3I55Z 4E33A 2IZ3A 3NH4A 2M6NA 1TWGI 1ZH1A 1I3QI 1YJN1 3VTNA 2QRDB 4BXXI 1WCMI 1M902 1WIIA 4E2YA 3M3YI 1Y1VS 4NBBA 5T64A 4X6AI 1YHQ1 3NDIA 3S1RI 4A3II 4NBDA 1ZB8A 1Q822 3CD6Z 2KPIA 4S1TA 5C3EI 2O53A 3PO3I 2QA41 1VQ6Z 2DE5A 3G6EZ 1M901 2ZAEB 1WW9A 5IT9f 2B63I 3RZOI 3LUSA 1TWCI 4MRIA 5D1PA 3CCMZ 3J81f 4E32A 1K8A2 4E31A 1YIT1 2HU9A 4NFRA 3GTQI 1L1OC 3CPWZ 4CL1A 2E2JI 2GTIA 3CC41 2OOXB 2QA4Z 3HOVI 5A2Qb 2JUBA 1W2BZ 4E30A 3GTGI 2M48A 3J7A4 3CC4Z 2P3YA 3F3PC 1Q862 1KC81 1QVFY 1KD12 1KD11 3I4MI 4MD7A 1YITZ 1W2BY 1NP6A 2JNYA 2RIQA 2QEX1 3CXCZ 3CCVZ 2JA5I 2I3CA 3PO2I 1YJNZ 4MD9A 3CMAZ 3CQZI 3VMIA 1JJ2Z 2RBLA 1LQLA 1VQ81 2NVQI 2GTHA 1JWHC 2RHBA 4RS4A 1K731 1QVFZ 3S17I 4DGLA 3RZDI 1VQ9Z 1I50I 4BBSI 4NBAA 1RO2A 1VQ41 1I6HI 1NUIA 1VQO1 5T6BA 4EWCA 4A3JI 3H0GI 1Q821 5T67A 4NBFA 5LL6f 2F4MA 2R7ZI 4RVFA 5FLMI 3KIFA 2V8KA 1YJW1 1Z01A 5IP7I 2NVTI 1Q7Y2 2OTL1 1TWHI 3S2DI 3NH8A 1ZB9A 2WB1A 3J80b 4A3EI 2YADA 4E2WA 3IF8A 3TDHB 3EERA 1Q811 4Y7NI 1VQ71 1Y1WI 1PFTA 4A93I 3GCFA 3CMEZ 2BJOA 1VQ7Z 1Q7Y1 2YU9I 4DQYB 2VUGA 2QKDA 3NH5A 1N2FA 3K7AI 4A3MI 5C44I 5IT9b 3GTPI 2P28A 1USPA 1VQKZ 1S721 1YI21 4MXUA 3CCRZ 4NOZA 3S2HI 5D1OB 3HOYI 3GTMS 2QR1B 2JA6I 1K9M1 1RQFA 1VQN1 2O4HA 1YIJ1 3PO3S 2VUMI 3EEDA 3F3FC 2OTJZ 2OOYB 4NH1C 4NB9A 3GKQA 3CCUZ 1VQM1 3CME1 1USPB 1VQ4Z 1M1K1 1YI2Z 3S1NI 3I07A 3D6WA 5C4JI 2QRCB 3G4SZ 3CCSZ 4HGYA 5FLXb 1X3WA 1Q861 4NBGA 4RVHA 1VLAA 2JA8I 2QREB 4MD8A 1K9M2 2K5RA 3P5JB 1YUAA 3GTOI 3HOZI 1RNIA 3S15I 1VQOZ 2AKLA 1NJI1 4NBHA 2LIYA 2QLVB 4NBEA 3T4NB 4HGZA 1VQ51 3CCE1 3CC2Z 1VQLZ 2PM9A 3I561 4DK1A 1VQ8Z 3ESWA 2W03A 2GU2A 2DE7A 3GTJI 1QF8A 1TFIA 1TWFI 3CCV1 1KQSZ 3CCQZ 4MH4A 3CC7Z 4HH4A 2RT9A 2JA7I 1ML8A 3CXCY 1QYPA 2E2HI 1X0TA 3CC71 2VF1A 4NBCA 4AYBA 1YHQZ 3G6E1 3U50C 1K83I 1TWAI 2Q4ZA 2E2II 3J80f 1RO4A 1K732 3FQQA 3CD61 1M1K2 2PMZA 2JS4A 3I56Z 3HOXI 4Y52I 1Z03A 3KIHA 3J81b 1VQ5Z 2W04A 4A3FI 3HOWI 2NVYI 1KQSY 2R6MA 1VQP1 2J6AA 2E9HA 5A2Qf 1JJ2Y 2K3RA 1KC82 3S1QI 1YJ91 2V8IA 3CCM1 3CCQ1 4A3GI 3FQMA 2Y0SA 3NFZA 3JAMf 3CCEZ 4QTUA 1VQ61 3CCL1 1YIJZ 1S7MA 5D1OA 3I4NI 3S1MI 4XX2A 2OZKA 3MONA 1Z02A 1Q812 1N8R2 3CC21 1VQL1 2DE6A 3IFUA 5C4XI 3GTLI 3I551 1S72Z 4RV9A 3M4OI 3JAMb 1DL6A 1K8A1 2KI7B 3G71Z 3CCJ1 3TE5B 1QVGY 1RLYA 2H85A 4A3KI 3G4S1 3CCS1 2R92I 1RO0A 1NJI2 3GTMI 2G2KA 3CPWY 1KRLA 3MZLB 3HKZA 3MZKB 3D9XA 2R93I 3OW2Y 3OW2Z 1QVGZ 2OTJ1 2WAQA 1Y1VI 3BG1B 2NVXI 3NDJA 1N8R1 2PK7A 1YJWZ 4E2XA 3FKII 4A3LI 4BBRI 4A3BI 4RVDA 4E2ZA 2EGTA 3BG0B 3VMHA 2IZ4A 4RVGA 2HF1A 1VQMZ 3CCU1 5FLXf 4A3DI 1P9NA 3GTKI 4NB8A 1VQ91 3VMGA 3H3VJ 4MONA 2OTLZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 1;  3CCL Z;  1VQN Z;  1Q86 2;  1KC8 1;  1QVF Y;  1KD1 2;  1KD1 1;  2OTJ Z;  1YIT Z;  1W2B Y;  1VQ5 Z;  2QEX 1;  1YJ9 Z;  3CXC Z;  3CCU Z;  1VQM 1;  3CME 1;  3CCV Z;  1VQ4 Z;  1M1K 1;  1KQS Y;  3CCR 1;  1VQP 1;  1YI2 Z;  3CMA 1;  1VQK 1;  3G4S Z;  3CCS Z;  1YJN Z;  3CMA Z;  1VQP Z;  1JJ2 Y;  1JJ2 Z;  1KC8 2;  3CCJ Z;  1Q86 1;  3G71 1;  1VQ8 1;  2QEX Z;  1YJ9 1;  3CCM 1;  3CCQ 1;  1K9M 2;  3I55 Z;  3CCE Z;  1VQ6 1;  3CCL 1;  1K73 1;  1YIJ Z;  1YJN 1;  1VQO Z;  1QVF Z;  1VQ9 Z;  1M90 2;  1NJI 1;  1VQ4 1;  1Q81 2;  1VQO 1;  1Q82 1;  1N8R 2;  1VQ5 1;  3CC2 1;  1VQL 1;  3CCE 1;  3I55 1;  1S72 Z;  3CC2 Z;  1YHQ 1;  1VQL Z;  1K8A 1;  1YJW 1;  3I56 1;  1VQ8 Z;  1Q7Y 2;  2OTL 1;  3G71 Z;  3CCJ 1;  1QVG Y;  1Q82 2;  3CD6 Z;  3G4S 1;  3CCS 1;  1Q81 1;  1VQ7 1;  2QA4 1;  1NJI 2;  1VQ6 Z;  3G6E Z;  3CPW Y;  1M90 1;  3CCV 1;  3CME Z;  1KQS Z;  1VQ7 Z;  1Q7Y 1;  3CCQ Z;  3CCM Z;  1K8A 2;  3CC7 Z;  1YIT 1;  3OW2 Y;  3OW2 Z;  1QVG Z;  2OTJ 1;  3CPW Z;  3CXC Y;  1N8R 1;  3CC7 1;  1YJW Z;  1YHQ Z;  1VQK Z;  1S72 1;  1YI2 1;  3CCR Z;  3CC4 1;  3G6E 1;  2QA4 Z;  3CCU 1;  1VQM Z;  1W2B Z;  1K73 2;  3CD6 1;  3CC4 Z;  1M1K 2;  1K9M 1;  1VQ9 1;  1VQN 1;  2OTL Z;  3I56 Z; 
#chains in the Genus database with same CATH topology
 3IX0 A;  3CCL Z;  1VQN Z;  5IP9 I;  3D2L A;  3VB9 A;  2F4O A;  1R9T I;  1YUK A;  2JR6 A;  1YJ9 Z;  4BY1 I;  2JMO A;  2RPR A;  4TNU A;  3CCR 1;  2Q51 A;  3CMA 1;  1VQK 1;  2LFU A;  3QWU A;  3Q87 A;  4A3C I;  1SFO I;  3S14 I;  1VQP Z;  3HOU I;  1X3Z A;  3CCJ Z;  3G71 1;  2QEX Z;  2V8J A;  3S16 I;  4QTT A;  5CM2 M;  5AN9 F;  4BY7 I;  3I55 Z;  4E33 A;  2IZ3 A;  3NH4 A;  2M6N A;  1TWG I;  1ZH1 A;  1I3Q I;  1YJN 1;  3VTN A;  2QRD B;  4BXX I;  1WCM I;  1M90 2;  1WII A;  4E2Y A;  3M3Y I;  1Y1V S;  4NBB A;  5T64 A;  4X6A I;  1YHQ 1;  3NDI A;  3S1R I;  1FDI A;  2V45 A;  2JIO A;  4A3I I;  4NBD A;  1ZB8 A;  1Q82 2;  3CD6 Z;  2KPI A;  4S1T A;  5C3E I;  2O53 A;  2IV2 X;  3PO3 I;  2QA4 1;  1VQ6 Z;  2DE5 A;  3G6E Z;  1M90 1;  2ZAE B;  1WW9 A;  5IT9 f;  2B63 I;  3RZO I;  3LUS A;  1TWC I;  5D1P A;  4MRI A;  3CCM Z;  3J81 f;  4E32 A;  1K8A 2;  4E31 A;  1YIT 1;  2HU9 A;  4NFR A;  3GTQ I;  1L1O C;  3CPW Z;  4CL1 A;  2E2J I;  2GTI A;  3CC4 1;  2OOX B;  2QA4 Z;  3HOV I;  5A2Q b;  2JUB A;  1W2B Z;  4E30 A;  3GTG I;  2M48 A;  3J7A 4;  3CC4 Z;  2P3Y A;  1Q16 A;  1QXF A;  3F3P C;  1Q86 2;  1KC8 1;  1QVF Y;  1KD1 2;  1KD1 1;  3I4M I;  4MD7 A;  1YIT Z;  1W2B Y;  1NP6 A;  2JNY A;  2RIQ A;  2QEX 1;  3CXC Z;  3CCV Z;  2JA5 I;  2I3C A;  3PO2 I;  1YJN Z;  4MD9 A;  3CMA Z;  3CQZ I;  3VMI A;  1JJ2 Z;  2RBL A;  1LQL A;  1VQ8 1;  2NVQ I;  2GTH A;  1JWH C;  2RHB A;  4RS4 A;  1K73 1;  1QVF Z;  3S17 I;  3IR7 A;  4DGL A;  1AA6 A;  3RZD I;  1VQ9 Z;  1I50 I;  4BBS I;  4NBA A;  1RO2 A;  1VQ4 1;  1I6H I;  1NUI A;  1VQO 1;  5T6B A;  4EWC A;  4A3J I;  3H0G I;  1Q82 1;  5T67 A;  4NBF A;  5LL6 f;  2F4M A;  2R7Z I;  4RVF A;  5FLM I;  3KIF A;  2V8K A;  1YJW 1;  1Z01 A;  5IP7 I;  2NVT I;  1Q7Y 2;  2OTL 1;  1TWH I;  3S2D I;  3NH8 A;  1ZB9 A;  2WB1 A;  3J80 b;  4A3E I;  2YAD A;  4E2W A;  3IF8 A;  3TDH B;  3EER A;  1Q81 1;  4Y7N I;  1VQ7 1;  1Y1W I;  1FDO A;  1PFT A;  4A93 I;  3GCF A;  3CME Z;  2BJO A;  1VQ7 Z;  1Q7Y 1;  2YU9 I;  4DQY B;  2VUG A;  2QKD A;  3NH5 A;  1N2F A;  3K7A I;  4A3M I;  5C44 I;  2NAP A;  5IT9 b;  3GTP I;  2P28 A;  1USP A;  1VQK Z;  1S72 1;  1YI2 1;  4MXU A;  3CCR Z;  4NOZ A;  3S2H I;  5D1O B;  3HOY I;  3GTM S;  2QR1 B;  2JA6 I;  1K9M 1;  1RQF A;  1VQN 1;  2O4H A;  1YIJ 1;  3PO3 S;  2VUM I;  3EED A;  3F3F C;  2OTJ Z;  2OOY B;  4NH1 C;  4NB9 A;  3GKQ A;  3CCU Z;  1VQM 1;  3CME 1;  1USP B;  1VQ4 Z;  1M1K 1;  1YI2 Z;  3S1N I;  3I07 A;  3D6W A;  5C4J I;  2QRC B;  3G4S Z;  3CCS Z;  4HGY A;  5FLX b;  1X3W A;  1Q86 1;  4NBG A;  4RVH A;  1VLA A;  2JA8 I;  2QRE B;  4MD8 A;  1K9M 2;  2K5R A;  3P5J B;  2VPX A;  1YUA A;  3GTO I;  3HOZ I;  1RNI A;  3S15 I;  1VQO Z;  2VPY A;  2AKL A;  1NJI 1;  4NBH A;  2LIY A;  2QLV B;  4NBE A;  3T4N B;  4HGZ A;  1VQ5 1;  3CCE 1;  3CC2 Z;  1VQL Z;  2PM9 A;  3I56 1;  4DK1 A;  1VQ8 Z;  1Y8C A;  3ESW A;  2W03 A;  2GU2 A;  2DE7 A;  3GTJ I;  1QF8 A;  2VPW A;  1TFI A;  1TWF I;  3CCV 1;  1KQS Z;  3CCQ Z;  4MH4 A;  3CC7 Z;  2JIR A;  4HH4 A;  2RT9 A;  2JA7 I;  1ML8 A;  1SIW A;  3CXC Y;  1QYP A;  2E2H I;  1X0T A;  3CC7 1;  2VF1 A;  4NBC A;  4AYB A;  1YHQ Z;  3G6E 1;  3U50 C;  1K83 I;  1TWA I;  2Q4Z A;  2E2I I;  3J80 f;  1RO4 A;  1K73 2;  3FQQ A;  3CD6 1;  1M1K 2;  2PMZ A;  2JS4 A;  3I56 Z;  3HOX I;  4Y52 I;  1Z03 A;  3KIH A;  3J81 b;  2E7Z A;  1VQ5 Z;  2W04 A;  4A3F I;  3HOW I;  2NVY I;  1KQS Y;  2R6M A;  1VQP 1;  2J6A A;  2E9H A;  5A2Q f;  1JJ2 Y;  2K3R A;  1KC8 2;  3S1Q I;  1YJ9 1;  2V8I A;  3CCM 1;  3CCQ 1;  4A3G I;  3FQM A;  2JIQ A;  2Y0S A;  3NFZ A;  3JAM f;  3CCE Z;  4QTU A;  1VQ6 1;  2VPZ A;  3CCL 1;  1WJ2 A;  1YIJ Z;  1S7M A;  5D1O A;  3I4N I;  3S1M I;  4XX2 A;  2OZK A;  3MON A;  1Z02 A;  1Q81 2;  1N8R 2;  3CC2 1;  1VQL 1;  2DE6 A;  3IFU A;  5C4X I;  3GTL I;  3I55 1;  1S72 Z;  2JIM A;  4RV9 A;  3M4O I;  3JAM b;  1DL6 A;  1K8A 1;  2KI7 B;  3G71 Z;  3CCJ 1;  3TE5 B;  1QVG Y;  2V3V A;  1RLY A;  2H85 A;  4A3K I;  3G4S 1;  3CCS 1;  2R92 I;  1RO0 A;  1NJI 2;  3GTM I;  1WZN A;  2G2K A;  3CPW Y;  1KRL A;  3MZL B;  2JIP A;  3HKZ A;  3MZK B;  3D9X A;  2R93 I;  3OW2 Y;  3OW2 Z;  1QVG Z;  2OTJ 1;  2WAQ A;  1Y1V I;  3BG1 B;  2NVX I;  3NDJ A;  1N8R 1;  2PK7 A;  1YJW Z;  4E2X A;  3FKI I;  4A3L I;  4BBR I;  4A3B I;  4RVD A;  4E2Z A;  2EGT A;  3BG0 B;  3VMH A;  2IZ4 A;  4RVG A;  2HF1 A;  1VQM Z;  3CCU 1;  5FLX f;  4A3D I;  2AYD A;  1P9N A;  3GTK I;  2LEX A;  4NB8 A;  1VQ9 1;  3VMG A;  3H3V J;  4MON A;  2OTL Z; 
#chains in the Genus database with same CATH homology
 3IX0 A;  3CCL Z;  1VQN Z;  5IP9 I;  3VB9 A;  2F4O A;  1R9T I;  1YUK A;  2JR6 A;  1YJ9 Z;  4BY1 I;  2JMO A;  2RPR A;  4TNU A;  3CCR 1;  2Q51 A;  3CMA 1;  1VQK 1;  2LFU A;  3QWU A;  3Q87 A;  4A3C I;  1SFO I;  3S14 I;  1VQP Z;  3HOU I;  1X3Z A;  3CCJ Z;  3G71 1;  2QEX Z;  2V8J A;  3S16 I;  4QTT A;  5CM2 M;  5AN9 F;  4BY7 I;  3I55 Z;  4E33 A;  2IZ3 A;  3NH4 A;  2M6N A;  1TWG I;  1ZH1 A;  1I3Q I;  1YJN 1;  3VTN A;  2QRD B;  4BXX I;  1WCM I;  1M90 2;  1WII A;  4E2Y A;  3M3Y I;  1Y1V S;  4NBB A;  5T64 A;  4X6A I;  1YHQ 1;  3NDI A;  3S1R I;  4A3I I;  4NBD A;  1ZB8 A;  1Q82 2;  3CD6 Z;  2KPI A;  4S1T A;  5C3E I;  2O53 A;  3PO3 I;  2QA4 1;  1VQ6 Z;  2DE5 A;  3G6E Z;  1M90 1;  2ZAE B;  1WW9 A;  5IT9 f;  2B63 I;  3RZO I;  3LUS A;  1TWC I;  4MRI A;  5D1P A;  3CCM Z;  3J81 f;  4E32 A;  1K8A 2;  4E31 A;  1YIT 1;  2HU9 A;  4NFR A;  3GTQ I;  1L1O C;  3CPW Z;  4CL1 A;  2E2J I;  2GTI A;  3CC4 1;  2OOX B;  2QA4 Z;  3HOV I;  5A2Q b;  2JUB A;  1W2B Z;  4E30 A;  3GTG I;  2M48 A;  3J7A 4;  3CC4 Z;  2P3Y A;  3F3P C;  1Q86 2;  1KC8 1;  1QVF Y;  1KD1 2;  1KD1 1;  3I4M I;  4MD7 A;  1YIT Z;  1W2B Y;  1NP6 A;  2JNY A;  2RIQ A;  2QEX 1;  3CXC Z;  3CCV Z;  2JA5 I;  2I3C A;  3PO2 I;  1YJN Z;  4MD9 A;  3CMA Z;  3CQZ I;  3VMI A;  1JJ2 Z;  2RBL A;  1LQL A;  1VQ8 1;  2NVQ I;  2GTH A;  1JWH C;  2RHB A;  4RS4 A;  1K73 1;  1QVF Z;  3S17 I;  4DGL A;  3RZD I;  1VQ9 Z;  1I50 I;  4BBS I;  4NBA A;  1RO2 A;  1VQ4 1;  1I6H I;  1NUI A;  1VQO 1;  5T6B A;  4EWC A;  4A3J I;  3H0G I;  1Q82 1;  5T67 A;  4NBF A;  5LL6 f;  2F4M A;  2R7Z I;  4RVF A;  5FLM I;  3KIF A;  2V8K A;  1YJW 1;  1Z01 A;  5IP7 I;  2NVT I;  1Q7Y 2;  2OTL 1;  1TWH I;  3S2D I;  3NH8 A;  1ZB9 A;  2WB1 A;  3J80 b;  4A3E I;  2YAD A;  4E2W A;  3IF8 A;  3TDH B;  3EER A;  1Q81 1;  4Y7N I;  1VQ7 1;  1Y1W I;  1PFT A;  4A93 I;  3GCF A;  3CME Z;  2BJO A;  1VQ7 Z;  1Q7Y 1;  2YU9 I;  4DQY B;  2VUG A;  2QKD A;  3NH5 A;  1N2F A;  3K7A I;  4A3M I;  5C44 I;  5IT9 b;  3GTP I;  2P28 A;  1USP A;  1VQK Z;  1S72 1;  1YI2 1;  4MXU A;  3CCR Z;  4NOZ A;  3S2H I;  5D1O B;  3HOY I;  3GTM S;  2QR1 B;  2JA6 I;  1K9M 1;  1RQF A;  1VQN 1;  2O4H A;  1YIJ 1;  3PO3 S;  2VUM I;  3EED A;  3F3F C;  2OTJ Z;  2OOY B;  4NH1 C;  4NB9 A;  3GKQ A;  3CCU Z;  1VQM 1;  3CME 1;  1USP B;  1VQ4 Z;  1M1K 1;  1YI2 Z;  3S1N I;  3I07 A;  3D6W A;  5C4J I;  2QRC B;  3G4S Z;  3CCS Z;  4HGY A;  5FLX b;  1X3W A;  1Q86 1;  4NBG A;  4RVH A;  1VLA A;  2JA8 I;  2QRE B;  4MD8 A;  1K9M 2;  2K5R A;  3P5J B;  1YUA A;  3GTO I;  3HOZ I;  1RNI A;  3S15 I;  1VQO Z;  2AKL A;  1NJI 1;  4NBH A;  2LIY A;  2QLV B;  4NBE A;  3T4N B;  4HGZ A;  1VQ5 1;  3CCE 1;  3CC2 Z;  1VQL Z;  2PM9 A;  3I56 1;  4DK1 A;  1VQ8 Z;  3ESW A;  2W03 A;  2GU2 A;  2DE7 A;  3GTJ I;  1QF8 A;  1TFI A;  1TWF I;  3CCV 1;  1KQS Z;  3CCQ Z;  4MH4 A;  3CC7 Z;  4HH4 A;  2RT9 A;  2JA7 I;  1ML8 A;  3CXC Y;  1QYP A;  2E2H I;  1X0T A;  3CC7 1;  2VF1 A;  4NBC A;  4AYB A;  1YHQ Z;  3G6E 1;  3U50 C;  1K83 I;  1TWA I;  2Q4Z A;  2E2I I;  3J80 f;  1RO4 A;  1K73 2;  3FQQ A;  3CD6 1;  1M1K 2;  2PMZ A;  2JS4 A;  3I56 Z;  3HOX I;  4Y52 I;  1Z03 A;  3KIH A;  3J81 b;  1VQ5 Z;  2W04 A;  4A3F I;  3HOW I;  2NVY I;  1KQS Y;  2R6M A;  1VQP 1;  2J6A A;  2E9H A;  5A2Q f;  1JJ2 Y;  2K3R A;  1KC8 2;  3S1Q I;  1YJ9 1;  2V8I A;  3CCM 1;  3CCQ 1;  4A3G I;  3FQM A;  2Y0S A;  3NFZ A;  3JAM f;  3CCE Z;  4QTU A;  1VQ6 1;  3CCL 1;  1YIJ Z;  1S7M A;  5D1O A;  3I4N I;  3S1M I;  4XX2 A;  2OZK A;  3MON A;  1Z02 A;  1Q81 2;  1N8R 2;  3CC2 1;  1VQL 1;  2DE6 A;  3IFU A;  5C4X I;  3GTL I;  3I55 1;  1S72 Z;  4RV9 A;  3M4O I;  3JAM b;  1DL6 A;  1K8A 1;  2KI7 B;  3G71 Z;  3CCJ 1;  3TE5 B;  1QVG Y;  1RLY A;  2H85 A;  4A3K I;  3G4S 1;  3CCS 1;  2R92 I;  1RO0 A;  1NJI 2;  3GTM I;  2G2K A;  3CPW Y;  1KRL A;  3MZL B;  3HKZ A;  3MZK B;  3D9X A;  2R93 I;  3OW2 Y;  3OW2 Z;  1QVG Z;  2OTJ 1;  2WAQ A;  1Y1V I;  3BG1 B;  2NVX I;  3NDJ A;  1N8R 1;  2PK7 A;  1YJW Z;  4E2X A;  3FKI I;  4A3L I;  4BBR I;  4A3B I;  4RVD A;  4E2Z A;  2EGT A;  3BG0 B;  3VMH A;  2IZ4 A;  4RVG A;  2HF1 A;  1VQM Z;  3CCU 1;  5FLX f;  4A3D I;  1P9N A;  3GTK I;  4NB8 A;  1VQ9 1;  3VMG A;  3H3V J;  4MON A;  2OTL Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...