3CCVZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccvZ00
3CC21 3CCQZ 1W2BZ 3CCUZ 3G71Z 1Q861 1YJ9Z 1YI2Z 3G6E1 3CCEZ 3CMA1 1M1K1 3G6EZ 3CCE1 3CCM1 1YJWZ 2QEXZ 2OTJZ 1VQO1 1YJ91 1QVGZ 3CCU1 3CXCY 1VQ4Z 3CME1 1NJI1 3G4S1 3G4SZ 1K732 1YIT1 3I56Z 1KC82 1Q811 1M901 3CCSZ 1VQ5Z 1M902 1K8A1 1Q7Y2 1NJI2 1VQK1 2QA41 2OTL1 1VQ91 1YJW1 2OTJ1 3CMAZ 3CCMZ 3G711 1YI21 1YIJZ 1M1K2 1QVFY 3I55Z 3CC2Z 1Q862 3CC71 3CCJZ 3I561 1VQKZ 3CMEZ 1VQ8Z 1K9M2 3CCL1 1KD11 3CCV1 1VQ81 3CCVZ 1W2BY 1YITZ 1Q822 1N8R2 1VQPZ 3CC7Z 1KQSZ 3CC41 1VQ7Z 1YJNZ 1VQM1 1QVGY 1VQ61 1YIJ1 2QEX1 3CXCZ 1KQSY 3CCQ1 1VQP1 1VQN1 3CD61 1Q7Y1 3OW2Y 1VQL1 1K8A2 1VQ9Z 2OTLZ 1Q812 1JJ2Z 3CCLZ 1K731 1KC81 1YHQ1 1VQ51 3OW2Z 3CCS1 1S721 1VQLZ 3CCJ1 3CCRZ 1JJ2Y 1VQNZ 3CD6Z 3I551 1VQ6Z 1VQOZ 1QVFZ 3CC4Z 1VQMZ 3CPWY 1YJN1 1VQ71 2QA4Z 3CPWZ 1Q821 1YHQZ 1N8R1 3CCR1 1S72Z 1KD12 1VQ41 1K9M1
chains in the Genus database with same CATH superfamily
1TWGI 3CCQZ 1W2BZ 4NB8A 3GCFA 2I3CA 4X6AI 1Y8CA 3CMA1 4A3EI 3GTJI 2O4HA 1Z01A 2NVXI 5FLXb 2VUGA 4NB9A 2YU9I 3CME1 2DE5A 4BY1I 1DL6A 1YIT1 3I56Z 1VQ5Z 1M902 1Q7Y2 1Z02A 1KRLA 2OTL1 2VPZA 1Y1VS 3IR7A 3T4NB 1YJW1 5D1OB 4A3FI 4RVGA 1QVFY 5FLMI 2LFUA 3CC2Z 3M4OI 3H3VJ 4A3II 2Y0SA 1I6HI 1X0TA 3CCJZ 1VQKZ 1K9M2 3CCL1 1KD11 1VQ81 1W2BY 5LL6f 4NBDA 2JA6I 3CC41 1YJNZ 3VMGA 3GTLI 3MZLB 2V3VA 3FQMA 1VQ61 4MH4A 4TNUA 3U50C 2QEX1 2B63I 3TE5B 2VUMI 2OOYB 3CQZI 3S1NI 4RV9A 3VMHA 2OOXB 3CD61 2G2KA 3OW2Y 1VQL1 2JIQA 5FLXf 1K8A2 4MRIA 4RVDA 1KC81 1YHQ1 4DGLA 2JS4A 2AKLA 1JWHC 1VQLZ 3GTPI 1VQNZ 2QREB 3I551 1QXFA 1ZB9A 4MD9A 4RVFA 1ML8A 1QVFZ 2WB1A 1YJN1 2JR6A 1NUIA 1Y1VI 3D6WA 5C3EI 3Q87A 1S7MA 4EWCA 3CPWZ 4S1TA 1Q821 1YUKA 2NVQI 2V8IA 1S72Z 4A3CI 1RO0A 5T64A 3NDJA 3GTMS 3CCUZ 3S17I 3G71Z 1YJ9Z 4BY7I 4NFRA 2DE7A 3HOWI 3CCM1 1YJWZ 1RO2A 1VQO1 1QVGZ 1TWHI 3S2HI 3PO3S 2YADA 1NJI1 3G4S1 1KC82 1K8A1 1RLYA 3I4NI 1AA6A 1SFOI 2V8KA 1ZH1A 5D1PA 2E9HA 1PFTA 4Y52I 2JIOA 2IZ4A 5CM2M 1M1K2 3I55Z 1VLAA 2R93I 1Q862 2R6MA 5D1OA 1WZNA 5IT9b 3I561 2VPWA 4E31A 4NBAA 4NBFA 2DE6A 4CL1A 3S1RI 1KQSZ 2E2JI 3PO2I 1VQ7Z 2JA5I 3EERA 3LUSA 4A3JI 1QVGY 3S1QI 2RBLA 3S16I 4A3LI 3CCQ1 3NH4A 3F3PC 1Q7Y1 2AYDA 3JAMf 2M6NA 4HGZA 3HOVI 1JJ2Z 4BBSI 3NFZA 3CCLZ 3VB9A 5IP7I 2E7ZA 3OW2Z 1S721 1I3QI 3K7AI 2GTIA 3P5JB 3ESWA 4HGYA 1VQ6Z 1VQOZ 2Q4ZA 4MXUA 3VMIA 3CC4Z 3GTQI 3D9XA 4HH4A 1R9TI 4A3BI 4A3KI 3S14I 3KIHA 1YHQZ 2JIPA 2IZ3A 2W03A 3RZDI 4QTUA 2PK7A 4E2YA 2E2HI 3I07A 2JA8I 3HKZA 1SIWA 1FDOA 1I50I 1WW9A 3MZKB 2V45A 1Q861 5AN9F 3HOXI 1M1K1 3G6EZ 3CCE1 1WCMI 2JMOA 4E32A 3CCU1 1P9NA 1VQ4Z 5T6BA 3G4SZ 3GTKI 2RT9A 2PM9A 3J80b 3J81f 4RS4A 1NJI2 3NH5A 4AYBA 2QA41 2NAPA 2OTJ1 2JIRA 3VTNA 4E2XA 3J80f 2K3RA 4MONA 3G711 3TDHB 3S15I 1YI21 1YIJZ 5IP9I 2GU2A 3HOYI 4Y7NI 3EEDA 2M48A 3CC71 3J7A4 3FKII 1QF8A 3CMEZ 1ZB8A 3CCV1 2VPXA 4NBCA 1Q822 3H0GI 1VQPZ 4NOZA 1TWAI 2PMZA 4A3DI 1VQM1 3IFUA 2VPYA 2JUBA 3IF8A 3S1MI 2R92I 2H85A 1KQSY 1Y1WI 3HOUI 4BBRI 1VQ9Z 2OTLZ 2LIYA 1X3ZA 1Q812 1K731 3HOZI 3KIFA 1VQ51 2RHBA 4MD7A 3CCJ1 3CCRZ 1JJ2Y 2JA7I 2E2II 3J81b 2NVTI 1WJ2A 3GKQA 2BJOA 4A93I 1VQMZ 2GTHA 2Q51A 2QA4Z 3M3YI 2ZAEB 3FQQA 1NP6A 2KPIA 5C4JI 1QYPA 2OZKA 4XX2A 3GTGI 1WIIA 3MONA 1KD12 1USPA 4NH1C 1VQ41 1K9M1 3GTOI 4NBEA 3CC21 4A3GI 1FDIA 4MD8A 1RO4A 3RZOI 5C4XI 1YI2Z 2R7ZI 2VF1A 3G6E1 3CCEZ 1TFIA 1RNIA 2OTJZ 2QEXZ 1TWFI 2K5RA 2WAQA 1YJ91 5IT9f 1N2FA 4DQYB 1L1OC 1YUAA 2HU9A 1X3WA 3CXCY 3NH8A 5T67A 1K732 1K83I 2P3YA 1Q811 1M901 2QR1B 1Q16A 3CCSZ 3S2DI 3D2LA 1VQK1 2F4OA 3PO3I 1VQ91 3CMAZ 3CCMZ 2QRCB 2O53A 1Z03A 2KI7B 5A2Qb 2QLVB 4RVHA 5C44I 2LEXA 3GTMI 1USPB 3JAMb 3IX0A 5A2Qf 1VQ8Z 3BG0B 3CCVZ 2IV2X 4NBHA 1YITZ 1N8R2 2RIQA 2P28A 2RPRA 3CC7Z 2QRDB 3BG1B 4DK1A 4NBGA 1YIJ1 3NDIA 3CXCZ 2HF1A 1VQP1 4BXXI 1VQN1 1TWCI 4QTTA 2QKDA 4E30A 3CCS1 2JNYA 3CD6Z 4E33A 2W04A 2JIMA 2V8JA 4A3MI 2F4MA 1RQFA 2EGTA 3CPWY 4E2ZA 1VQ71 1LQLA 3QWUA 2NVYI 2J6AA 1N8R1 4E2WA 3I4MI 3CCR1 4NBBA 3F3FC
chains in the Genus database with same CATH topology
1TWGI 3CCQZ 1W2BZ 4NB8A 3GCFA 2I3CA 4X6AI 3CMA1 4A3EI 3GTJI 2O4HA 1Z01A 2NVXI 5FLXb 2VUGA 4NB9A 2YU9I 3CME1 2DE5A 4BY1I 1DL6A 1YIT1 3I56Z 1VQ5Z 1M902 1Q7Y2 1Z02A 1KRLA 2OTL1 1Y1VS 3T4NB 1YJW1 5D1OB 4A3FI 4RVGA 1QVFY 5FLMI 2LFUA 3CC2Z 3M4OI 3H3VJ 4A3II 2Y0SA 1I6HI 1X0TA 3CCJZ 1VQKZ 1K9M2 3CCL1 1KD11 1VQ81 1W2BY 5LL6f 4NBDA 2JA6I 3CC41 1YJNZ 3VMGA 3GTLI 3MZLB 3FQMA 1VQ61 4MH4A 4TNUA 3U50C 2QEX1 2B63I 3TE5B 2VUMI 2OOYB 3CQZI 3S1NI 4RV9A 3VMHA 2OOXB 3CD61 2G2KA 3OW2Y 1VQL1 1K8A2 5FLXf 4MRIA 4RVDA 1KC81 1YHQ1 4DGLA 2JS4A 2AKLA 1JWHC 1VQLZ 3GTPI 1VQNZ 2QREB 3I551 1ZB9A 4MD9A 4RVFA 1ML8A 1QVFZ 2WB1A 1YJN1 2JR6A 1NUIA 1Y1VI 3D6WA 5C3EI 3Q87A 1S7MA 4EWCA 3CPWZ 4S1TA 1Q821 1YUKA 2NVQI 2V8IA 1S72Z 4A3CI 1RO0A 5T64A 3NDJA 3GTMS 3CCUZ 3S17I 3G71Z 1YJ9Z 4BY7I 4NFRA 2DE7A 3HOWI 3CCM1 1YJWZ 1RO2A 1VQO1 1QVGZ 1TWHI 3S2HI 3PO3S 2YADA 1NJI1 3G4S1 1KC82 1K8A1 1RLYA 3I4NI 1SFOI 2V8KA 1ZH1A 5D1PA 2E9HA 1PFTA 4Y52I 2IZ4A 5CM2M 1M1K2 3I55Z 1VLAA 2R93I 1Q862 2R6MA 5D1OA 5IT9b 3I561 4E31A 4NBAA 4NBFA 2DE6A 4CL1A 3S1RI 1KQSZ 2E2JI 3PO2I 1VQ7Z 2JA5I 3EERA 3LUSA 4A3JI 1QVGY 3S1QI 2RBLA 3S16I 4A3LI 3CCQ1 3NH4A 3F3PC 1Q7Y1 3JAMf 2M6NA 4HGZA 3HOVI 1JJ2Z 4BBSI 3NFZA 3CCLZ 3VB9A 5IP7I 3OW2Z 1S721 1I3QI 3K7AI 2GTIA 3P5JB 3ESWA 4HGYA 1VQ6Z 1VQOZ 2Q4ZA 4MXUA 3VMIA 3CC4Z 3GTQI 3D9XA 4HH4A 1R9TI 4A3BI 4A3KI 3S14I 3KIHA 1YHQZ 2IZ3A 2W03A 3RZDI 4QTUA 2PK7A 4E2YA 2E2HI 3I07A 2JA8I 3HKZA 1I50I 1WW9A 3MZKB 1Q861 5AN9F 3HOXI 1M1K1 3G6EZ 3CCE1 1WCMI 2JMOA 4E32A 3CCU1 1P9NA 1VQ4Z 5T6BA 3G4SZ 3GTKI 2RT9A 2PM9A 3J80b 3J81f 4RS4A 1NJI2 3NH5A 4AYBA 2QA41 2OTJ1 3VTNA 4E2XA 3J80f 2K3RA 4MONA 3G711 3TDHB 3S15I 1YI21 1YIJZ 5IP9I 2GU2A 3HOYI 4Y7NI 3EEDA 2M48A 3CC71 3J7A4 3FKII 1QF8A 3CMEZ 1ZB8A 3CCV1 4NBCA 1Q822 3H0GI 1VQPZ 4NOZA 1TWAI 2PMZA 4A3DI 1VQM1 3IFUA 2JUBA 3IF8A 3S1MI 2R92I 2H85A 1KQSY 1Y1WI 3HOUI 4BBRI 1VQ9Z 2OTLZ 2LIYA 1X3ZA 1Q812 1K731 3HOZI 3KIFA 1VQ51 2RHBA 4MD7A 3CCJ1 3CCRZ 1JJ2Y 2JA7I 2E2II 3J81b 2NVTI 3GKQA 2BJOA 4A93I 1VQMZ 2GTHA 2Q51A 2QA4Z 3M3YI 2ZAEB 3FQQA 1NP6A 2KPIA 5C4JI 1QYPA 2OZKA 4XX2A 3GTGI 1WIIA 3MONA 1KD12 1USPA 4NH1C 1VQ41 1K9M1 3GTOI 4NBEA 3CC21 4A3GI 4MD8A 1RO4A 3RZOI 5C4XI 1YI2Z 2R7ZI 2VF1A 3G6E1 3CCEZ 1TFIA 1RNIA 2OTJZ 2QEXZ 1TWFI 2K5RA 2WAQA 1YJ91 5IT9f 1N2FA 4DQYB 1L1OC 1YUAA 2HU9A 1X3WA 3CXCY 3NH8A 5T67A 1K732 1K83I 2P3YA 1Q811 1M901 2QR1B 3CCSZ 3S2DI 1VQK1 2F4OA 3PO3I 1VQ91 3CMAZ 3CCMZ 2QRCB 2O53A 1Z03A 2KI7B 5A2Qb 2QLVB 4RVHA 5C44I 3GTMI 1USPB 3JAMb 3IX0A 5A2Qf 1VQ8Z 3BG0B 3CCVZ 4NBHA 1YITZ 1N8R2 2RIQA 2P28A 2RPRA 3CC7Z 2QRDB 3BG1B 4DK1A 4NBGA 1YIJ1 3NDIA 3CXCZ 2HF1A 1VQP1 4BXXI 1VQN1 1TWCI 4QTTA 2QKDA 4E30A 3CCS1 2JNYA 3CD6Z 4E33A 2W04A 2V8JA 4A3MI 2F4MA 1RQFA 2EGTA 3CPWY 4E2ZA 1VQ71 1LQLA 3QWUA 2NVYI 2J6AA 1N8R1 4E2WA 3I4MI 3CCR1 4NBBA 3F3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 1;  3CCQ Z;  1W2B Z;  3CCU Z;  3G71 Z;  1Q86 1;  1YJ9 Z;  1YI2 Z;  3G6E 1;  3CCE Z;  3CMA 1;  1M1K 1;  3G6E Z;  3CCE 1;  3CCM 1;  1YJW Z;  2QEX Z;  2OTJ Z;  1VQO 1;  1YJ9 1;  1QVG Z;  3CCU 1;  3CXC Y;  1VQ4 Z;  3CME 1;  1NJI 1;  3G4S 1;  3G4S Z;  1K73 2;  1YIT 1;  3I56 Z;  1KC8 2;  1Q81 1;  1M90 1;  3CCS Z;  1VQ5 Z;  1M90 2;  1K8A 1;  1Q7Y 2;  1NJI 2;  1VQK 1;  2QA4 1;  2OTL 1;  1VQ9 1;  1YJW 1;  2OTJ 1;  3CMA Z;  3CCM Z;  3G71 1;  1YI2 1;  1YIJ Z;  1M1K 2;  1QVF Y;  3I55 Z;  3CC2 Z;  1Q86 2;  3CC7 1;  3CCJ Z;  3I56 1;  1VQK Z;  3CME Z;  1VQ8 Z;  1K9M 2;  3CCL 1;  1KD1 1;  3CCV 1;  1VQ8 1;  3CCV Z;  1W2B Y;  1YIT Z;  1Q82 2;  1N8R 2;  1VQP Z;  3CC7 Z;  1KQS Z;  3CC4 1;  1VQ7 Z;  1YJN Z;  1VQM 1;  1QVG Y;  1VQ6 1;  1YIJ 1;  2QEX 1;  3CXC Z;  1KQS Y;  3CCQ 1;  1VQP 1;  1VQN 1;  3CD6 1;  1Q7Y 1;  3OW2 Y;  1VQL 1;  1K8A 2;  1VQ9 Z;  2OTL Z;  1Q81 2;  1JJ2 Z;  3CCL Z;  1K73 1;  1KC8 1;  1YHQ 1;  1VQ5 1;  3OW2 Z;  3CCS 1;  1S72 1;  1VQL Z;  3CCJ 1;  3CCR Z;  1JJ2 Y;  1VQN Z;  3CD6 Z;  3I55 1;  1VQ6 Z;  1VQO Z;  1QVF Z;  3CC4 Z;  1VQM Z;  3CPW Y;  1YJN 1;  1VQ7 1;  2QA4 Z;  3CPW Z;  1Q82 1;  1YHQ Z;  1N8R 1;  3CCR 1;  1S72 Z;  1KD1 2;  1VQ4 1;  1K9M 1; 
#chains in the Genus database with same CATH topology
 1TWG I;  3CCQ Z;  1W2B Z;  4NB8 A;  3GCF A;  2I3C A;  4X6A I;  1Y8C A;  3CMA 1;  4A3E I;  3GTJ I;  2O4H A;  1Z01 A;  2NVX I;  5FLX b;  2VUG A;  4NB9 A;  2YU9 I;  3CME 1;  2DE5 A;  4BY1 I;  1DL6 A;  1YIT 1;  3I56 Z;  1VQ5 Z;  1M90 2;  1Q7Y 2;  1Z02 A;  1KRL A;  2OTL 1;  2VPZ A;  1Y1V S;  3IR7 A;  3T4N B;  1YJW 1;  5D1O B;  4A3F I;  4RVG A;  1QVF Y;  5FLM I;  2LFU A;  3CC2 Z;  3M4O I;  3H3V J;  4A3I I;  2Y0S A;  1I6H I;  1X0T A;  3CCJ Z;  1VQK Z;  1K9M 2;  3CCL 1;  1KD1 1;  1VQ8 1;  1W2B Y;  5LL6 f;  4NBD A;  2JA6 I;  3CC4 1;  1YJN Z;  3VMG A;  3GTL I;  3MZL B;  2V3V A;  3FQM A;  1VQ6 1;  4MH4 A;  4TNU A;  3U50 C;  2QEX 1;  2B63 I;  3TE5 B;  2VUM I;  2OOY B;  3CQZ I;  3S1N I;  4RV9 A;  3VMH A;  2OOX B;  3CD6 1;  2G2K A;  3OW2 Y;  1VQL 1;  2JIQ A;  5FLX f;  1K8A 2;  4MRI A;  4RVD A;  1KC8 1;  1YHQ 1;  4DGL A;  2JS4 A;  2AKL A;  1JWH C;  1VQL Z;  3GTP I;  1VQN Z;  2QRE B;  3I55 1;  1QXF A;  1ZB9 A;  4MD9 A;  4RVF A;  1ML8 A;  1QVF Z;  2WB1 A;  1YJN 1;  2JR6 A;  1NUI A;  1Y1V I;  3D6W A;  5C3E I;  3Q87 A;  1S7M A;  4EWC A;  3CPW Z;  4S1T A;  1Q82 1;  1YUK A;  2NVQ I;  2V8I A;  1S72 Z;  4A3C I;  1RO0 A;  5T64 A;  3NDJ A;  3GTM S;  3CCU Z;  3S17 I;  3G71 Z;  1YJ9 Z;  4BY7 I;  4NFR A;  2DE7 A;  3HOW I;  3CCM 1;  1YJW Z;  1RO2 A;  1VQO 1;  1QVG Z;  1TWH I;  3S2H I;  3PO3 S;  2YAD A;  1NJI 1;  3G4S 1;  1KC8 2;  1K8A 1;  1RLY A;  3I4N I;  1AA6 A;  1SFO I;  2V8K A;  1ZH1 A;  5D1P A;  2E9H A;  1PFT A;  4Y52 I;  2JIO A;  2IZ4 A;  5CM2 M;  1M1K 2;  3I55 Z;  1VLA A;  2R93 I;  1Q86 2;  2R6M A;  5D1O A;  1WZN A;  5IT9 b;  3I56 1;  2VPW A;  4E31 A;  4NBA A;  4NBF A;  2DE6 A;  4CL1 A;  3S1R I;  1KQS Z;  2E2J I;  3PO2 I;  1VQ7 Z;  2JA5 I;  3EER A;  3LUS A;  4A3J I;  1QVG Y;  3S1Q I;  2RBL A;  3S16 I;  4A3L I;  3CCQ 1;  3NH4 A;  3F3P C;  1Q7Y 1;  2AYD A;  3JAM f;  2M6N A;  4HGZ A;  3HOV I;  1JJ2 Z;  4BBS I;  3NFZ A;  3CCL Z;  3VB9 A;  5IP7 I;  2E7Z A;  3OW2 Z;  1S72 1;  1I3Q I;  3K7A I;  2GTI A;  3P5J B;  3ESW A;  4HGY A;  1VQ6 Z;  1VQO Z;  2Q4Z A;  4MXU A;  3VMI A;  3CC4 Z;  3GTQ I;  3D9X A;  4HH4 A;  1R9T I;  4A3B I;  4A3K I;  3S14 I;  3KIH A;  1YHQ Z;  2JIP A;  2IZ3 A;  2W03 A;  3RZD I;  4QTU A;  2PK7 A;  4E2Y A;  2E2H I;  3I07 A;  2JA8 I;  3HKZ A;  1SIW A;  1FDO A;  1I50 I;  1WW9 A;  3MZK B;  2V45 A;  1Q86 1;  5AN9 F;  3HOX I;  1M1K 1;  3G6E Z;  3CCE 1;  1WCM I;  2JMO A;  4E32 A;  3CCU 1;  1P9N A;  1VQ4 Z;  5T6B A;  3G4S Z;  3GTK I;  2RT9 A;  2PM9 A;  3J80 b;  3J81 f;  4RS4 A;  1NJI 2;  3NH5 A;  4AYB A;  2QA4 1;  2NAP A;  2OTJ 1;  2JIR A;  3VTN A;  4E2X A;  3J80 f;  2K3R A;  4MON A;  3G71 1;  3TDH B;  3S15 I;  1YI2 1;  1YIJ Z;  5IP9 I;  2GU2 A;  3HOY I;  4Y7N I;  3EED A;  2M48 A;  3CC7 1;  3J7A 4;  3FKI I;  1QF8 A;  3CME Z;  1ZB8 A;  3CCV 1;  2VPX A;  4NBC A;  1Q82 2;  3H0G I;  1VQP Z;  4NOZ A;  1TWA I;  2PMZ A;  4A3D I;  1VQM 1;  3IFU A;  2VPY A;  2JUB A;  3IF8 A;  3S1M I;  2R92 I;  2H85 A;  1KQS Y;  1Y1W I;  3HOU I;  4BBR I;  1VQ9 Z;  2OTL Z;  2LIY A;  1X3Z A;  1Q81 2;  1K73 1;  3HOZ I;  3KIF A;  1VQ5 1;  2RHB A;  4MD7 A;  3CCJ 1;  3CCR Z;  1JJ2 Y;  2JA7 I;  2E2I I;  3J81 b;  2NVT I;  1WJ2 A;  3GKQ A;  2BJO A;  4A93 I;  1VQM Z;  2GTH A;  2Q51 A;  2QA4 Z;  3M3Y I;  2ZAE B;  3FQQ A;  1NP6 A;  2KPI A;  5C4J I;  1QYP A;  2OZK A;  4XX2 A;  3GTG I;  1WII A;  3MON A;  1KD1 2;  1USP A;  4NH1 C;  1VQ4 1;  1K9M 1;  3GTO I;  4NBE A;  3CC2 1;  4A3G I;  1FDI A;  4MD8 A;  1RO4 A;  3RZO I;  5C4X I;  1YI2 Z;  2R7Z I;  2VF1 A;  3G6E 1;  3CCE Z;  1TFI A;  1RNI A;  2OTJ Z;  2QEX Z;  1TWF I;  2K5R A;  2WAQ A;  1YJ9 1;  5IT9 f;  1N2F A;  4DQY B;  1L1O C;  1YUA A;  2HU9 A;  1X3W A;  3CXC Y;  3NH8 A;  5T67 A;  1K73 2;  1K83 I;  2P3Y A;  1Q81 1;  1M90 1;  2QR1 B;  1Q16 A;  3CCS Z;  3S2D I;  3D2L A;  1VQK 1;  2F4O A;  3PO3 I;  1VQ9 1;  3CMA Z;  3CCM Z;  2QRC B;  2O53 A;  1Z03 A;  2KI7 B;  5A2Q b;  2QLV B;  4RVH A;  5C44 I;  2LEX A;  3GTM I;  1USP B;  3JAM b;  3IX0 A;  5A2Q f;  1VQ8 Z;  3BG0 B;  3CCV Z;  2IV2 X;  4NBH A;  1YIT Z;  1N8R 2;  2RIQ A;  2P28 A;  2RPR A;  3CC7 Z;  2QRD B;  3BG1 B;  4DK1 A;  4NBG A;  1YIJ 1;  3NDI A;  3CXC Z;  2HF1 A;  1VQP 1;  4BXX I;  1VQN 1;  1TWC I;  4QTT A;  2QKD A;  4E30 A;  3CCS 1;  2JNY A;  3CD6 Z;  4E33 A;  2W04 A;  2JIM A;  2V8J A;  4A3M I;  2F4M A;  1RQF A;  2EGT A;  3CPW Y;  4E2Z A;  1VQ7 1;  1LQL A;  3QWU A;  2NVY I;  2J6A A;  1N8R 1;  4E2W A;  3I4M I;  3CCR 1;  4NBB A;  3F3F C; 
#chains in the Genus database with same CATH homology
 1TWG I;  3CCQ Z;  1W2B Z;  4NB8 A;  3GCF A;  2I3C A;  4X6A I;  3CMA 1;  4A3E I;  3GTJ I;  2O4H A;  1Z01 A;  2NVX I;  5FLX b;  2VUG A;  4NB9 A;  2YU9 I;  3CME 1;  2DE5 A;  4BY1 I;  1DL6 A;  1YIT 1;  3I56 Z;  1VQ5 Z;  1M90 2;  1Q7Y 2;  1Z02 A;  1KRL A;  2OTL 1;  1Y1V S;  3T4N B;  1YJW 1;  5D1O B;  4A3F I;  4RVG A;  1QVF Y;  5FLM I;  2LFU A;  3CC2 Z;  3M4O I;  3H3V J;  4A3I I;  2Y0S A;  1I6H I;  1X0T A;  3CCJ Z;  1VQK Z;  1K9M 2;  3CCL 1;  1KD1 1;  1VQ8 1;  1W2B Y;  5LL6 f;  4NBD A;  2JA6 I;  3CC4 1;  1YJN Z;  3VMG A;  3GTL I;  3MZL B;  3FQM A;  1VQ6 1;  4MH4 A;  4TNU A;  3U50 C;  2QEX 1;  2B63 I;  3TE5 B;  2VUM I;  2OOY B;  3CQZ I;  3S1N I;  4RV9 A;  3VMH A;  2OOX B;  3CD6 1;  2G2K A;  3OW2 Y;  1VQL 1;  1K8A 2;  5FLX f;  4MRI A;  4RVD A;  1KC8 1;  1YHQ 1;  4DGL A;  2JS4 A;  2AKL A;  1JWH C;  1VQL Z;  3GTP I;  1VQN Z;  2QRE B;  3I55 1;  1ZB9 A;  4MD9 A;  4RVF A;  1ML8 A;  1QVF Z;  2WB1 A;  1YJN 1;  2JR6 A;  1NUI A;  1Y1V I;  3D6W A;  5C3E I;  3Q87 A;  1S7M A;  4EWC A;  3CPW Z;  4S1T A;  1Q82 1;  1YUK A;  2NVQ I;  2V8I A;  1S72 Z;  4A3C I;  1RO0 A;  5T64 A;  3NDJ A;  3GTM S;  3CCU Z;  3S17 I;  3G71 Z;  1YJ9 Z;  4BY7 I;  4NFR A;  2DE7 A;  3HOW I;  3CCM 1;  1YJW Z;  1RO2 A;  1VQO 1;  1QVG Z;  1TWH I;  3S2H I;  3PO3 S;  2YAD A;  1NJI 1;  3G4S 1;  1KC8 2;  1K8A 1;  1RLY A;  3I4N I;  1SFO I;  2V8K A;  1ZH1 A;  5D1P A;  2E9H A;  1PFT A;  4Y52 I;  2IZ4 A;  5CM2 M;  1M1K 2;  3I55 Z;  1VLA A;  2R93 I;  1Q86 2;  2R6M A;  5D1O A;  5IT9 b;  3I56 1;  4E31 A;  4NBA A;  4NBF A;  2DE6 A;  4CL1 A;  3S1R I;  1KQS Z;  2E2J I;  3PO2 I;  1VQ7 Z;  2JA5 I;  3EER A;  3LUS A;  4A3J I;  1QVG Y;  3S1Q I;  2RBL A;  3S16 I;  4A3L I;  3CCQ 1;  3NH4 A;  3F3P C;  1Q7Y 1;  3JAM f;  2M6N A;  4HGZ A;  3HOV I;  1JJ2 Z;  4BBS I;  3NFZ A;  3CCL Z;  3VB9 A;  5IP7 I;  3OW2 Z;  1S72 1;  1I3Q I;  3K7A I;  2GTI A;  3P5J B;  3ESW A;  4HGY A;  1VQ6 Z;  1VQO Z;  2Q4Z A;  4MXU A;  3VMI A;  3CC4 Z;  3GTQ I;  3D9X A;  4HH4 A;  1R9T I;  4A3B I;  4A3K I;  3S14 I;  3KIH A;  1YHQ Z;  2IZ3 A;  2W03 A;  3RZD I;  4QTU A;  2PK7 A;  4E2Y A;  2E2H I;  3I07 A;  2JA8 I;  3HKZ A;  1I50 I;  1WW9 A;  3MZK B;  1Q86 1;  5AN9 F;  3HOX I;  1M1K 1;  3G6E Z;  3CCE 1;  1WCM I;  2JMO A;  4E32 A;  3CCU 1;  1P9N A;  1VQ4 Z;  5T6B A;  3G4S Z;  3GTK I;  2RT9 A;  2PM9 A;  3J80 b;  3J81 f;  4RS4 A;  1NJI 2;  3NH5 A;  4AYB A;  2QA4 1;  2OTJ 1;  3VTN A;  4E2X A;  3J80 f;  2K3R A;  4MON A;  3G71 1;  3TDH B;  3S15 I;  1YI2 1;  1YIJ Z;  5IP9 I;  2GU2 A;  3HOY I;  4Y7N I;  3EED A;  2M48 A;  3CC7 1;  3J7A 4;  3FKI I;  1QF8 A;  3CME Z;  1ZB8 A;  3CCV 1;  4NBC A;  1Q82 2;  3H0G I;  1VQP Z;  4NOZ A;  1TWA I;  2PMZ A;  4A3D I;  1VQM 1;  3IFU A;  2JUB A;  3IF8 A;  3S1M I;  2R92 I;  2H85 A;  1KQS Y;  1Y1W I;  3HOU I;  4BBR I;  1VQ9 Z;  2OTL Z;  2LIY A;  1X3Z A;  1Q81 2;  1K73 1;  3HOZ I;  3KIF A;  1VQ5 1;  2RHB A;  4MD7 A;  3CCJ 1;  3CCR Z;  1JJ2 Y;  2JA7 I;  2E2I I;  3J81 b;  2NVT I;  3GKQ A;  2BJO A;  4A93 I;  1VQM Z;  2GTH A;  2Q51 A;  2QA4 Z;  3M3Y I;  2ZAE B;  3FQQ A;  1NP6 A;  2KPI A;  5C4J I;  1QYP A;  2OZK A;  4XX2 A;  3GTG I;  1WII A;  3MON A;  1KD1 2;  1USP A;  4NH1 C;  1VQ4 1;  1K9M 1;  3GTO I;  4NBE A;  3CC2 1;  4A3G I;  4MD8 A;  1RO4 A;  3RZO I;  5C4X I;  1YI2 Z;  2R7Z I;  2VF1 A;  3G6E 1;  3CCE Z;  1TFI A;  1RNI A;  2OTJ Z;  2QEX Z;  1TWF I;  2K5R A;  2WAQ A;  1YJ9 1;  5IT9 f;  1N2F A;  4DQY B;  1L1O C;  1YUA A;  2HU9 A;  1X3W A;  3CXC Y;  3NH8 A;  5T67 A;  1K73 2;  1K83 I;  2P3Y A;  1Q81 1;  1M90 1;  2QR1 B;  3CCS Z;  3S2D I;  1VQK 1;  2F4O A;  3PO3 I;  1VQ9 1;  3CMA Z;  3CCM Z;  2QRC B;  2O53 A;  1Z03 A;  2KI7 B;  5A2Q b;  2QLV B;  4RVH A;  5C44 I;  3GTM I;  1USP B;  3JAM b;  3IX0 A;  5A2Q f;  1VQ8 Z;  3BG0 B;  3CCV Z;  4NBH A;  1YIT Z;  1N8R 2;  2RIQ A;  2P28 A;  2RPR A;  3CC7 Z;  2QRD B;  3BG1 B;  4DK1 A;  4NBG A;  1YIJ 1;  3NDI A;  3CXC Z;  2HF1 A;  1VQP 1;  4BXX I;  1VQN 1;  1TWC I;  4QTT A;  2QKD A;  4E30 A;  3CCS 1;  2JNY A;  3CD6 Z;  4E33 A;  2W04 A;  2V8J A;  4A3M I;  2F4M A;  1RQF A;  2EGT A;  3CPW Y;  4E2Z A;  1VQ7 1;  1LQL A;  3QWU A;  2NVY I;  2J6A A;  1N8R 1;  4E2W A;  3I4M I;  3CCR 1;  4NBB A;  3F3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...