1VQPZ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqpZ00
1VQMZ 1Q822 1VQ51 1KQSY 1VQL1 3G71Z 1Q7Y2 3CCQZ 1VQ61 3CPWZ 3CC71 1VQO1 3CCJ1 3CCRZ 1YI2Z 1VQ91 1VQ8Z 2QEXZ 3CCM1 1YIT1 1KD12 1K732 1Q862 1JJ2Y 1KD11 1QVGZ 1Q861 2OTL1 3OW2Z 1VQLZ 1N8R2 3CC21 3CCE1 1YIJ1 1N8R1 1VQ6Z 3CC7Z 1VQOZ 1VQ41 3CCL1 3CCJZ 3I561 1VQ9Z 1YJW1 1W2BZ 3CME1 2OTJ1 1VQN1 3I55Z 1K9M1 1YHQ1 1VQK1 3CCU1 3CPWY 1S721 2OTLZ 3CCEZ 3CC2Z 3CCV1 3G4S1 3CXCZ 1YIJZ 1VQ5Z 1VQ4Z 3CCLZ 1QVFZ 1Q812 1VQM1 2QA41 1YJWZ 2OTJZ 1YJ91 1QVGY 1VQNZ 3OW2Y 1Q811 1YJN1 3CC41 3CD61 1VQP1 3G711 3CCS1 1M902 1K9M2 1S72Z 1W2BY 1M901 1VQ71 3CCMZ 1YITZ 3G6E1 1YI21 3CMA1 1VQ81 2QEX1 2QA4Z 1YJ9Z 1KQSZ 1YJNZ 3CC4Z 3CXCY 3I56Z 1Q821 3CD6Z 1VQPZ 1KC82 3CMEZ 3CCSZ 1QVFY 1KC81 1K8A2 1VQ7Z 1Q7Y1 1NJI2 1K8A1 3G6EZ 3CMAZ 3CCUZ 1YHQZ 1VQKZ 1NJI1 3CCQ1 1M1K2 3I551 1JJ2Z 3CCR1 3CCVZ 3G4SZ 1M1K1 1K731
chains in the Genus database with same CATH superfamily
4QTUA 3HKZA 4BXXI 1TWGI 2NVYI 4RVGA 4E2YA 4HH4A 1QYPA 3GCFA 2R6MA 2IZ4A 3F3PC 4A3KI 5A2Qf 3CCJ1 3S16I 3JAMb 4NBEA 5D1OB 4RV9A 2M6NA 3CCM1 1YIT1 1JJ2Y 3HOWI 1KD11 1QVGZ 2JIQA 2OTL1 3CCE1 5AN9F 1N8R1 1VQOZ 1L1OC 2VPZA 2AYDA 3TE5B 3JAMf 1Y1VS 4A3GI 2OOXB 1WIIA 4NOZA 2K3RA 3CCU1 3CPWY 2R7ZI 1USPB 3D9XA 4BY1I 4DQYB 3LUSA 3CXCZ 1YIJZ 2VUMI 2M48A 3S14I 3CCLZ 3VTNA 1YJWZ 2OTJZ 3QWUA 3OW2Y 1YJN1 2QLVB 4A3II 2JA8I 2GU2A 2Y0SA 5T67A 2J6AA 1VQP1 4DGLA 1Z02A 4RVFA 1S72Z 1ML8A 2RBLA 3H0GI 4CL1A 3CMA1 1VQ81 3NFZA 4QTTA 4A3MI 2QA4Z 3S1RI 5C4XI 1KQSZ 5T64A 1NUIA 2HF1A 3CC4Z 4NBBA 1Q821 4RVHA 3I4MI 3CMEZ 1RNIA 4NFRA 1KC81 4Y52I 2WAQA 1VQ7Z 1K8A1 3KIFA 4NB9A 1VQKZ 1TWFI 4NB8A 1Y1WI 2VPXA 1M1K1 3S2DI 3KIHA 1YUKA 1K731 2R93I 1VQMZ 2JA7I 3HOZI 2E2HI 4A3BI 1Q822 2PM9A 2KI7B 4A3JI 4E2XA 2I3CA 1VQ51 3S1QI 4A3LI 4E2WA 3CCQZ 1VQ61 3GTMS 2HU9A 4E31A 1YI2Z 3P5JB 1K732 1Q862 2IZ3A 3VMGA 3EEDA 2IV2X 1I6HI 3GTGI 4MD7A 4AYBA 1I50I 3VMIA 3J80b 4A93I 1DL6A 1K83I 1Y1VI 1VQ41 3CCJZ 5C44I 3I561 2LEXA 1VQN1 3GTJI 4EWCA 1YHQ1 3HOUI 5IP9I 3NH4A 1N2FA 3S1NI 4NBCA 3S1MI 2OTLZ 3IR7A 5C3EI 2JMOA 5T6BA 3CCEZ 3S17I 2JR6A 3J80f 3S2HI 1Q812 2W04A 3K7AI 1QVGY 3HOXI 2JS4A 5D1PA 3FQMA 1TFIA 2ZAEB 3CD61 2O53A 5FLXb 1TWHI 2B63I 4E2ZA 3CCS1 1M902 1VLAA 2R92I 3G6E1 3RZDI 3PO3I 2RPRA 2AKLA 2P28A 3D2LA 1WJ2A 2NVTI 4NBFA 2DE6A 5LL6f 1YJNZ 2QR1B 3CXCY 1VQPZ 5FLXf 2EGTA 1Q7Y1 1NJI2 3CMAZ 2RHBA 2VPWA 4A3EI 4E30A 3CCR1 3CCVZ 3G4SZ 5D1OA 1Y8CA 2VF1A 1SIWA 4E32A 2YADA 2V8JA 1Z01A 3BG1B 4BBSI 1NP6A 3GTPI 2WB1A 1S7MA 1KQSY 5C4JI 1VQL1 2G2KA 1ZH1A 3G71Z 4TNUA 1Q7Y2 4MRIA 3S15I 2Q4ZA 2E7ZA 3CC71 2GTIA 4BY7I 2Q51A 3BG0B 1VQ91 5FLMI 1R9TI 2O4HA 4NBHA 4HGYA 2QEXZ 2LIYA 2E9HA 3NDJA 1FDOA 1USPA 2QRDB 3GTOI 2PK7A 3D6WA 1Q861 3GKQA 2K5RA 3IFUA 3PO2I 1P9NA 3CC21 1Z03A 2KPIA 1X3ZA 1VQ6Z 2JA6I 1W2BZ 3CME1 1QF8A 2BJOA 3I55Z 2P3YA 4X6AI 1VQK1 2QREB 1QXFA 4NBAA 4BBRI 2F4OA 3Q87A 1PFTA 1RQFA 3MZLB 4A3CI 1ZB8A 1VQ4Z 2H85A 1QVFZ 2VUGA 3NDIA 1VQM1 2JUBA 1YJ91 1VQNZ 1Q811 3MZKB 1JWHC 4MH4A 3RZOI 3GTKI 3J7A4 1YUAA 3NH8A 4RVDA 4DK1A 1M901 2NAPA 3HOYI 3CCMZ 1YITZ 1YI21 4NH1C 1FDIA 1RO0A 2YU9I 2RT9A 1RLYA 1ZB9A 3U50C 3CD6Z 1WW9A 2JIMA 3CCSZ 2JNYA 4S1TA 3G6EZ 3IX0A 3CCUZ 2E2JI 3H3VJ 1RO4A 1NJI1 2V8KA 1JJ2Z 3IF8A 2W03A 2F4MA 4XX2A 3M3YI 3NH5A 2JIRA 2NVQI 4NBDA 5CM2M 1I3QI 2OOYB 5IP7I 3FQQA 4MXUA 1AA6A 1X3WA 3CPWZ 1VQO1 3CCRZ 1VQ8Z 2RIQA 3F3FC 3CQZI 2QRCB 4Y7NI 1KD12 2QKDA 1WCMI 2PMZA 2V3VA 3OW2Z 2DE5A 1VQLZ 1N8R2 1YIJ1 3CC7Z 3CCL1 1Q16A 3GTMI 1VQ9Z 1YJW1 2V8IA 3FKII 2OTJ1 2E2II 1KRLA 1LQLA 3I07A 1K9M1 5IT9b 1S721 3PO3S 3CC2Z 3CCV1 3G4S1 3HOVI 1WZNA 1VQ5Z 4HGZA 3J81b 2GTHA 4MD8A 2QA41 3VB9A 4RS4A 3CC41 3ESWA 3G711 1K9M2 4NBGA 2JIOA 5IT9f 1W2BY 4MONA 4E33A 1VQ71 4A3FI 3GTLI 2V45A 2VPYA 2QEX1 3J81f 3VMHA 3T4NB 1YJ9Z 3GTQI 3M4OI 3I4NI 3I56Z 1TWCI 1KC82 2NVXI 3MONA 1QVFY 2DE7A 1K8A2 1RO2A 2JA5I 4MD9A 1YHQZ 1X0TA 2LFUA 4A3DI 3CCQ1 5A2Qb 3EERA 3I551 1SFOI 1M1K2 2JIPA 3TDHB 2OZKA 1TWAI
chains in the Genus database with same CATH topology
4QTUA 3HKZA 4BXXI 1TWGI 2NVYI 4RVGA 4E2YA 4HH4A 1QYPA 3GCFA 2R6MA 2IZ4A 3F3PC 4A3KI 5A2Qf 3CCJ1 3S16I 3JAMb 4NBEA 5D1OB 4RV9A 2M6NA 3CCM1 1YIT1 1JJ2Y 3HOWI 1KD11 1QVGZ 2OTL1 3CCE1 5AN9F 1N8R1 1VQOZ 1L1OC 3TE5B 3JAMf 1Y1VS 4A3GI 2OOXB 1WIIA 4NOZA 2K3RA 3CCU1 3CPWY 2R7ZI 1USPB 3D9XA 4BY1I 4DQYB 3LUSA 3CXCZ 1YIJZ 2VUMI 2M48A 3S14I 3CCLZ 3VTNA 1YJWZ 2OTJZ 3QWUA 3OW2Y 1YJN1 2QLVB 4A3II 2JA8I 2GU2A 2Y0SA 5T67A 2J6AA 1VQP1 4DGLA 1Z02A 4RVFA 1S72Z 1ML8A 2RBLA 3H0GI 4CL1A 3CMA1 1VQ81 3NFZA 4QTTA 4A3MI 2QA4Z 3S1RI 5C4XI 1KQSZ 5T64A 1NUIA 2HF1A 3CC4Z 4NBBA 1Q821 4RVHA 3I4MI 3CMEZ 1RNIA 4NFRA 1KC81 4Y52I 2WAQA 1VQ7Z 1K8A1 3KIFA 4NB9A 1VQKZ 1TWFI 4NB8A 1Y1WI 1M1K1 3S2DI 3KIHA 1YUKA 1K731 2R93I 1VQMZ 2JA7I 3HOZI 2E2HI 4A3BI 1Q822 2PM9A 2KI7B 4A3JI 4E2XA 2I3CA 1VQ51 3S1QI 4A3LI 4E2WA 3CCQZ 1VQ61 3GTMS 2HU9A 4E31A 1YI2Z 3P5JB 1K732 1Q862 2IZ3A 3VMGA 3EEDA 1I6HI 3GTGI 4MD7A 4AYBA 1I50I 3VMIA 3J80b 4A93I 1DL6A 1K83I 1Y1VI 1VQ41 3CCJZ 5C44I 3I561 1VQN1 3GTJI 4EWCA 1YHQ1 3HOUI 5IP9I 3NH4A 1N2FA 3S1NI 4NBCA 3S1MI 2OTLZ 5C3EI 2JMOA 5T6BA 3CCEZ 3S17I 2JR6A 3J80f 3S2HI 1Q812 2W04A 3K7AI 1QVGY 3HOXI 2JS4A 5D1PA 3FQMA 1TFIA 2ZAEB 3CD61 2O53A 5FLXb 1TWHI 2B63I 4E2ZA 3CCS1 1M902 1VLAA 2R92I 3G6E1 3RZDI 3PO3I 2RPRA 2AKLA 2P28A 2NVTI 4NBFA 2DE6A 5LL6f 1YJNZ 2QR1B 3CXCY 1VQPZ 5FLXf 2EGTA 1Q7Y1 1NJI2 3CMAZ 2RHBA 4A3EI 4E30A 3CCR1 3CCVZ 3G4SZ 5D1OA 2VF1A 4E32A 2YADA 2V8JA 1Z01A 3BG1B 4BBSI 1NP6A 3GTPI 2WB1A 1S7MA 1KQSY 5C4JI 1VQL1 2G2KA 1ZH1A 3G71Z 4TNUA 1Q7Y2 4MRIA 3S15I 2Q4ZA 3CC71 2GTIA 4BY7I 2Q51A 3BG0B 1VQ91 5FLMI 1R9TI 2O4HA 4NBHA 4HGYA 2QEXZ 2LIYA 2E9HA 3NDJA 1USPA 2QRDB 3GTOI 2PK7A 3D6WA 1Q861 3GKQA 2K5RA 3IFUA 3PO2I 1P9NA 3CC21 1Z03A 2KPIA 1X3ZA 1VQ6Z 2JA6I 1W2BZ 3CME1 1QF8A 2BJOA 3I55Z 2P3YA 4X6AI 1VQK1 2QREB 4NBAA 4BBRI 2F4OA 3Q87A 1PFTA 1RQFA 3MZLB 4A3CI 1ZB8A 1VQ4Z 2H85A 1QVFZ 2VUGA 3NDIA 1VQM1 2JUBA 1YJ91 1VQNZ 1Q811 3MZKB 1JWHC 4MH4A 3RZOI 3GTKI 3J7A4 1YUAA 3NH8A 4RVDA 4DK1A 1M901 3HOYI 3CCMZ 1YITZ 1YI21 4NH1C 1RO0A 2YU9I 2RT9A 1RLYA 1ZB9A 3U50C 3CD6Z 1WW9A 3CCSZ 2JNYA 4S1TA 3G6EZ 3IX0A 3CCUZ 2E2JI 3H3VJ 1RO4A 1NJI1 2V8KA 1JJ2Z 3IF8A 2W03A 2F4MA 4XX2A 3M3YI 3NH5A 2NVQI 4NBDA 5CM2M 1I3QI 2OOYB 5IP7I 3FQQA 4MXUA 1X3WA 3CPWZ 1VQO1 3CCRZ 1VQ8Z 2RIQA 3F3FC 3CQZI 2QRCB 4Y7NI 1KD12 2QKDA 1WCMI 2PMZA 3OW2Z 2DE5A 1VQLZ 1N8R2 1YIJ1 3CC7Z 3CCL1 3GTMI 1VQ9Z 1YJW1 2V8IA 3FKII 2OTJ1 2E2II 1KRLA 1LQLA 3I07A 1K9M1 5IT9b 1S721 3PO3S 3CC2Z 3CCV1 3G4S1 3HOVI 1VQ5Z 4HGZA 3J81b 2GTHA 4MD8A 2QA41 3VB9A 4RS4A 3CC41 3ESWA 3G711 1K9M2 4NBGA 5IT9f 1W2BY 4MONA 4E33A 1VQ71 4A3FI 3GTLI 2QEX1 3J81f 3VMHA 3T4NB 1YJ9Z 3GTQI 3M4OI 3I4NI 3I56Z 1TWCI 1KC82 2NVXI 3MONA 1QVFY 2DE7A 1K8A2 1RO2A 2JA5I 4MD9A 1YHQZ 1X0TA 2LFUA 4A3DI 3CCQ1 5A2Qb 3EERA 3I551 1SFOI 1M1K2 3TDHB 2OZKA 1TWAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM Z;  1Q82 2;  1VQ5 1;  1KQS Y;  1VQL 1;  3G71 Z;  1Q7Y 2;  3CCQ Z;  1VQ6 1;  3CPW Z;  3CC7 1;  1VQO 1;  3CCJ 1;  3CCR Z;  1YI2 Z;  1VQ9 1;  1VQ8 Z;  2QEX Z;  3CCM 1;  1YIT 1;  1KD1 2;  1K73 2;  1Q86 2;  1JJ2 Y;  1KD1 1;  1QVG Z;  1Q86 1;  2OTL 1;  3OW2 Z;  1VQL Z;  1N8R 2;  3CC2 1;  3CCE 1;  1YIJ 1;  1N8R 1;  1VQ6 Z;  3CC7 Z;  1VQO Z;  1VQ4 1;  3CCL 1;  3CCJ Z;  3I56 1;  1VQ9 Z;  1YJW 1;  1W2B Z;  3CME 1;  2OTJ 1;  1VQN 1;  3I55 Z;  1K9M 1;  1YHQ 1;  1VQK 1;  3CCU 1;  3CPW Y;  1S72 1;  2OTL Z;  3CCE Z;  3CC2 Z;  3CCV 1;  3G4S 1;  3CXC Z;  1YIJ Z;  1VQ5 Z;  1VQ4 Z;  3CCL Z;  1QVF Z;  1Q81 2;  1VQM 1;  2QA4 1;  1YJW Z;  2OTJ Z;  1YJ9 1;  1QVG Y;  1VQN Z;  3OW2 Y;  1Q81 1;  1YJN 1;  3CC4 1;  3CD6 1;  1VQP 1;  3G71 1;  3CCS 1;  1M90 2;  1K9M 2;  1S72 Z;  1W2B Y;  1M90 1;  1VQ7 1;  3CCM Z;  1YIT Z;  3G6E 1;  1YI2 1;  3CMA 1;  1VQ8 1;  2QEX 1;  2QA4 Z;  1YJ9 Z;  1KQS Z;  1YJN Z;  3CC4 Z;  3CXC Y;  3I56 Z;  1Q82 1;  3CD6 Z;  1VQP Z;  1KC8 2;  3CME Z;  3CCS Z;  1QVF Y;  1KC8 1;  1K8A 2;  1VQ7 Z;  1Q7Y 1;  1NJI 2;  1K8A 1;  3G6E Z;  3CMA Z;  3CCU Z;  1YHQ Z;  1VQK Z;  1NJI 1;  3CCQ 1;  1M1K 2;  3I55 1;  1JJ2 Z;  3CCR 1;  3CCV Z;  3G4S Z;  1M1K 1;  1K73 1; 
#chains in the Genus database with same CATH topology
 4QTU A;  3HKZ A;  4BXX I;  1TWG I;  2NVY I;  4RVG A;  4E2Y A;  4HH4 A;  1QYP A;  3GCF A;  2R6M A;  2IZ4 A;  3F3P C;  4A3K I;  5A2Q f;  3CCJ 1;  3S16 I;  3JAM b;  4NBE A;  5D1O B;  4RV9 A;  2M6N A;  3CCM 1;  1YIT 1;  1JJ2 Y;  3HOW I;  1KD1 1;  1QVG Z;  2JIQ A;  2OTL 1;  3CCE 1;  5AN9 F;  1N8R 1;  1VQO Z;  1L1O C;  2VPZ A;  2AYD A;  3TE5 B;  3JAM f;  1Y1V S;  4A3G I;  2OOX B;  1WII A;  4NOZ A;  2K3R A;  3CCU 1;  3CPW Y;  2R7Z I;  1USP B;  3D9X A;  4BY1 I;  4DQY B;  3LUS A;  3CXC Z;  1YIJ Z;  2VUM I;  2M48 A;  3S14 I;  3CCL Z;  3VTN A;  1YJW Z;  2OTJ Z;  3QWU A;  3OW2 Y;  1YJN 1;  2QLV B;  4A3I I;  2JA8 I;  2GU2 A;  2Y0S A;  5T67 A;  2J6A A;  1VQP 1;  4DGL A;  1Z02 A;  4RVF A;  1S72 Z;  1ML8 A;  2RBL A;  3H0G I;  4CL1 A;  3CMA 1;  1VQ8 1;  3NFZ A;  4QTT A;  4A3M I;  2QA4 Z;  3S1R I;  5C4X I;  1KQS Z;  5T64 A;  1NUI A;  2HF1 A;  3CC4 Z;  4NBB A;  1Q82 1;  4RVH A;  3I4M I;  3CME Z;  1RNI A;  4NFR A;  1KC8 1;  4Y52 I;  2WAQ A;  1VQ7 Z;  1K8A 1;  3KIF A;  4NB9 A;  1VQK Z;  1TWF I;  4NB8 A;  1Y1W I;  2VPX A;  1M1K 1;  3S2D I;  3KIH A;  1YUK A;  1K73 1;  2R93 I;  1VQM Z;  2JA7 I;  3HOZ I;  2E2H I;  4A3B I;  1Q82 2;  2PM9 A;  2KI7 B;  4A3J I;  4E2X A;  2I3C A;  1VQ5 1;  3S1Q I;  4A3L I;  4E2W A;  3CCQ Z;  1VQ6 1;  3GTM S;  2HU9 A;  4E31 A;  1YI2 Z;  3P5J B;  1K73 2;  1Q86 2;  2IZ3 A;  3VMG A;  3EED A;  2IV2 X;  1I6H I;  3GTG I;  4MD7 A;  4AYB A;  1I50 I;  3VMI A;  3J80 b;  4A93 I;  1DL6 A;  1K83 I;  1Y1V I;  1VQ4 1;  3CCJ Z;  5C44 I;  3I56 1;  2LEX A;  1VQN 1;  3GTJ I;  4EWC A;  1YHQ 1;  3HOU I;  5IP9 I;  3NH4 A;  1N2F A;  3S1N I;  4NBC A;  3S1M I;  2OTL Z;  3IR7 A;  5C3E I;  2JMO A;  5T6B A;  3CCE Z;  3S17 I;  2JR6 A;  3J80 f;  3S2H I;  1Q81 2;  2W04 A;  3K7A I;  1QVG Y;  3HOX I;  2JS4 A;  5D1P A;  3FQM A;  1TFI A;  2ZAE B;  3CD6 1;  2O53 A;  5FLX b;  1TWH I;  2B63 I;  4E2Z A;  3CCS 1;  1M90 2;  1VLA A;  2R92 I;  3G6E 1;  3RZD I;  3PO3 I;  2RPR A;  2AKL A;  2P28 A;  3D2L A;  1WJ2 A;  2NVT I;  4NBF A;  2DE6 A;  5LL6 f;  1YJN Z;  2QR1 B;  3CXC Y;  1VQP Z;  5FLX f;  2EGT A;  1Q7Y 1;  1NJI 2;  3CMA Z;  2RHB A;  2VPW A;  4A3E I;  4E30 A;  3CCR 1;  3CCV Z;  3G4S Z;  5D1O A;  1Y8C A;  2VF1 A;  1SIW A;  4E32 A;  2YAD A;  2V8J A;  1Z01 A;  3BG1 B;  4BBS I;  1NP6 A;  3GTP I;  2WB1 A;  1S7M A;  1KQS Y;  5C4J I;  1VQL 1;  2G2K A;  1ZH1 A;  3G71 Z;  4TNU A;  1Q7Y 2;  4MRI A;  3S15 I;  2Q4Z A;  2E7Z A;  3CC7 1;  2GTI A;  4BY7 I;  2Q51 A;  3BG0 B;  1VQ9 1;  5FLM I;  1R9T I;  2O4H A;  4NBH A;  4HGY A;  2QEX Z;  2LIY A;  2E9H A;  3NDJ A;  1FDO A;  1USP A;  2QRD B;  3GTO I;  2PK7 A;  3D6W A;  1Q86 1;  3GKQ A;  2K5R A;  3IFU A;  3PO2 I;  1P9N A;  3CC2 1;  1Z03 A;  2KPI A;  1X3Z A;  1VQ6 Z;  2JA6 I;  1W2B Z;  3CME 1;  1QF8 A;  2BJO A;  3I55 Z;  2P3Y A;  4X6A I;  1VQK 1;  2QRE B;  1QXF A;  4NBA A;  4BBR I;  2F4O A;  3Q87 A;  1PFT A;  1RQF A;  3MZL B;  4A3C I;  1ZB8 A;  1VQ4 Z;  2H85 A;  1QVF Z;  2VUG A;  3NDI A;  1VQM 1;  2JUB A;  1YJ9 1;  1VQN Z;  1Q81 1;  3MZK B;  1JWH C;  4MH4 A;  3RZO I;  3GTK I;  3J7A 4;  1YUA A;  3NH8 A;  4RVD A;  4DK1 A;  1M90 1;  2NAP A;  3HOY I;  3CCM Z;  1YIT Z;  1YI2 1;  4NH1 C;  1FDI A;  1RO0 A;  2YU9 I;  2RT9 A;  1RLY A;  1ZB9 A;  3U50 C;  3CD6 Z;  1WW9 A;  2JIM A;  3CCS Z;  2JNY A;  4S1T A;  3G6E Z;  3IX0 A;  3CCU Z;  2E2J I;  3H3V J;  1RO4 A;  1NJI 1;  2V8K A;  1JJ2 Z;  3IF8 A;  2W03 A;  2F4M A;  4XX2 A;  3M3Y I;  3NH5 A;  2JIR A;  2NVQ I;  4NBD A;  5CM2 M;  1I3Q I;  2OOY B;  5IP7 I;  3FQQ A;  4MXU A;  1AA6 A;  1X3W A;  3CPW Z;  1VQO 1;  3CCR Z;  1VQ8 Z;  2RIQ A;  3F3F C;  3CQZ I;  2QRC B;  4Y7N I;  1KD1 2;  2QKD A;  1WCM I;  2PMZ A;  2V3V A;  3OW2 Z;  2DE5 A;  1VQL Z;  1N8R 2;  1YIJ 1;  3CC7 Z;  3CCL 1;  1Q16 A;  3GTM I;  1VQ9 Z;  1YJW 1;  2V8I A;  3FKI I;  2OTJ 1;  2E2I I;  1KRL A;  1LQL A;  3I07 A;  1K9M 1;  5IT9 b;  1S72 1;  3PO3 S;  3CC2 Z;  3CCV 1;  3G4S 1;  3HOV I;  1WZN A;  1VQ5 Z;  4HGZ A;  3J81 b;  2GTH A;  4MD8 A;  2QA4 1;  3VB9 A;  4RS4 A;  3CC4 1;  3ESW A;  3G71 1;  1K9M 2;  4NBG A;  2JIO A;  5IT9 f;  1W2B Y;  4MON A;  4E33 A;  1VQ7 1;  4A3F I;  3GTL I;  2V45 A;  2VPY A;  2QEX 1;  3J81 f;  3VMH A;  3T4N B;  1YJ9 Z;  3GTQ I;  3M4O I;  3I4N I;  3I56 Z;  1TWC I;  1KC8 2;  2NVX I;  3MON A;  1QVF Y;  2DE7 A;  1K8A 2;  1RO2 A;  2JA5 I;  4MD9 A;  1YHQ Z;  1X0T A;  2LFU A;  4A3D I;  3CCQ 1;  5A2Q b;  3EER A;  3I55 1;  1SFO I;  1M1K 2;  2JIP A;  3TDH B;  2OZK A;  1TWA I; 
#chains in the Genus database with same CATH homology
 4QTU A;  3HKZ A;  4BXX I;  1TWG I;  2NVY I;  4RVG A;  4E2Y A;  4HH4 A;  1QYP A;  3GCF A;  2R6M A;  2IZ4 A;  3F3P C;  4A3K I;  5A2Q f;  3CCJ 1;  3S16 I;  3JAM b;  4NBE A;  5D1O B;  4RV9 A;  2M6N A;  3CCM 1;  1YIT 1;  1JJ2 Y;  3HOW I;  1KD1 1;  1QVG Z;  2OTL 1;  3CCE 1;  5AN9 F;  1N8R 1;  1VQO Z;  1L1O C;  3TE5 B;  3JAM f;  1Y1V S;  4A3G I;  2OOX B;  1WII A;  4NOZ A;  2K3R A;  3CCU 1;  3CPW Y;  2R7Z I;  1USP B;  3D9X A;  4BY1 I;  4DQY B;  3LUS A;  3CXC Z;  1YIJ Z;  2VUM I;  2M48 A;  3S14 I;  3CCL Z;  3VTN A;  1YJW Z;  2OTJ Z;  3QWU A;  3OW2 Y;  1YJN 1;  2QLV B;  4A3I I;  2JA8 I;  2GU2 A;  2Y0S A;  5T67 A;  2J6A A;  1VQP 1;  4DGL A;  1Z02 A;  4RVF A;  1S72 Z;  1ML8 A;  2RBL A;  3H0G I;  4CL1 A;  3CMA 1;  1VQ8 1;  3NFZ A;  4QTT A;  4A3M I;  2QA4 Z;  3S1R I;  5C4X I;  1KQS Z;  5T64 A;  1NUI A;  2HF1 A;  3CC4 Z;  4NBB A;  1Q82 1;  4RVH A;  3I4M I;  3CME Z;  1RNI A;  4NFR A;  1KC8 1;  4Y52 I;  2WAQ A;  1VQ7 Z;  1K8A 1;  3KIF A;  4NB9 A;  1VQK Z;  1TWF I;  4NB8 A;  1Y1W I;  1M1K 1;  3S2D I;  3KIH A;  1YUK A;  1K73 1;  2R93 I;  1VQM Z;  2JA7 I;  3HOZ I;  2E2H I;  4A3B I;  1Q82 2;  2PM9 A;  2KI7 B;  4A3J I;  4E2X A;  2I3C A;  1VQ5 1;  3S1Q I;  4A3L I;  4E2W A;  3CCQ Z;  1VQ6 1;  3GTM S;  2HU9 A;  4E31 A;  1YI2 Z;  3P5J B;  1K73 2;  1Q86 2;  2IZ3 A;  3VMG A;  3EED A;  1I6H I;  3GTG I;  4MD7 A;  4AYB A;  1I50 I;  3VMI A;  3J80 b;  4A93 I;  1DL6 A;  1K83 I;  1Y1V I;  1VQ4 1;  3CCJ Z;  5C44 I;  3I56 1;  1VQN 1;  3GTJ I;  4EWC A;  1YHQ 1;  3HOU I;  5IP9 I;  3NH4 A;  1N2F A;  3S1N I;  4NBC A;  3S1M I;  2OTL Z;  5C3E I;  2JMO A;  5T6B A;  3CCE Z;  3S17 I;  2JR6 A;  3J80 f;  3S2H I;  1Q81 2;  2W04 A;  3K7A I;  1QVG Y;  3HOX I;  2JS4 A;  5D1P A;  3FQM A;  1TFI A;  2ZAE B;  3CD6 1;  2O53 A;  5FLX b;  1TWH I;  2B63 I;  4E2Z A;  3CCS 1;  1M90 2;  1VLA A;  2R92 I;  3G6E 1;  3RZD I;  3PO3 I;  2RPR A;  2AKL A;  2P28 A;  2NVT I;  4NBF A;  2DE6 A;  5LL6 f;  1YJN Z;  2QR1 B;  3CXC Y;  1VQP Z;  5FLX f;  2EGT A;  1Q7Y 1;  1NJI 2;  3CMA Z;  2RHB A;  4A3E I;  4E30 A;  3CCR 1;  3CCV Z;  3G4S Z;  5D1O A;  2VF1 A;  4E32 A;  2YAD A;  2V8J A;  1Z01 A;  3BG1 B;  4BBS I;  1NP6 A;  3GTP I;  2WB1 A;  1S7M A;  1KQS Y;  5C4J I;  1VQL 1;  2G2K A;  1ZH1 A;  3G71 Z;  4TNU A;  1Q7Y 2;  4MRI A;  3S15 I;  2Q4Z A;  3CC7 1;  2GTI A;  4BY7 I;  2Q51 A;  3BG0 B;  1VQ9 1;  5FLM I;  1R9T I;  2O4H A;  4NBH A;  4HGY A;  2QEX Z;  2LIY A;  2E9H A;  3NDJ A;  1USP A;  2QRD B;  3GTO I;  2PK7 A;  3D6W A;  1Q86 1;  3GKQ A;  2K5R A;  3IFU A;  3PO2 I;  1P9N A;  3CC2 1;  1Z03 A;  2KPI A;  1X3Z A;  1VQ6 Z;  2JA6 I;  1W2B Z;  3CME 1;  1QF8 A;  2BJO A;  3I55 Z;  2P3Y A;  4X6A I;  1VQK 1;  2QRE B;  4NBA A;  4BBR I;  2F4O A;  3Q87 A;  1PFT A;  1RQF A;  3MZL B;  4A3C I;  1ZB8 A;  1VQ4 Z;  2H85 A;  1QVF Z;  2VUG A;  3NDI A;  1VQM 1;  2JUB A;  1YJ9 1;  1VQN Z;  1Q81 1;  3MZK B;  1JWH C;  4MH4 A;  3RZO I;  3GTK I;  3J7A 4;  1YUA A;  3NH8 A;  4RVD A;  4DK1 A;  1M90 1;  3HOY I;  3CCM Z;  1YIT Z;  1YI2 1;  4NH1 C;  1RO0 A;  2YU9 I;  2RT9 A;  1RLY A;  1ZB9 A;  3U50 C;  3CD6 Z;  1WW9 A;  3CCS Z;  2JNY A;  4S1T A;  3G6E Z;  3IX0 A;  3CCU Z;  2E2J I;  3H3V J;  1RO4 A;  1NJI 1;  2V8K A;  1JJ2 Z;  3IF8 A;  2W03 A;  2F4M A;  4XX2 A;  3M3Y I;  3NH5 A;  2NVQ I;  4NBD A;  5CM2 M;  1I3Q I;  2OOY B;  5IP7 I;  3FQQ A;  4MXU A;  1X3W A;  3CPW Z;  1VQO 1;  3CCR Z;  1VQ8 Z;  2RIQ A;  3F3F C;  3CQZ I;  2QRC B;  4Y7N I;  1KD1 2;  2QKD A;  1WCM I;  2PMZ A;  3OW2 Z;  2DE5 A;  1VQL Z;  1N8R 2;  1YIJ 1;  3CC7 Z;  3CCL 1;  3GTM I;  1VQ9 Z;  1YJW 1;  2V8I A;  3FKI I;  2OTJ 1;  2E2I I;  1KRL A;  1LQL A;  3I07 A;  1K9M 1;  5IT9 b;  1S72 1;  3PO3 S;  3CC2 Z;  3CCV 1;  3G4S 1;  3HOV I;  1VQ5 Z;  4HGZ A;  3J81 b;  2GTH A;  4MD8 A;  2QA4 1;  3VB9 A;  4RS4 A;  3CC4 1;  3ESW A;  3G71 1;  1K9M 2;  4NBG A;  5IT9 f;  1W2B Y;  4MON A;  4E33 A;  1VQ7 1;  4A3F I;  3GTL I;  2QEX 1;  3J81 f;  3VMH A;  3T4N B;  1YJ9 Z;  3GTQ I;  3M4O I;  3I4N I;  3I56 Z;  1TWC I;  1KC8 2;  2NVX I;  3MON A;  1QVF Y;  2DE7 A;  1K8A 2;  1RO2 A;  2JA5 I;  4MD9 A;  1YHQ Z;  1X0T A;  2LFU A;  4A3D I;  3CCQ 1;  5A2Q b;  3EER A;  3I55 1;  1SFO I;  1M1K 2;  3TDH B;  2OZK A;  1TWA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...