1VQPZ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqpZ00
3CC4Z 3G4S1 1K9M2 1KD12 1KC82 3G711 3G6E1 1YJW1 2OTJZ 1YJ91 2QA41 1VQ5Z 1M1K1 1M902 1VQL1 3CCU1 3CMEZ 3CCRZ 1VQ6Z 1N8R1 1YIT1 1Q861 1NJI2 3CCJZ 1K8A2 3CMAZ 2OTL1 1VQPZ 1W2BY 1YI21 3CCVZ 3OW2Z 3CCL1 1VQ9Z 3CPWY 3CCSZ 1K732 1NJI1 3OW2Y 3CC7Z 1VQOZ 3I551 1YHQZ 3CCE1 1VQKZ 1Q821 3CC2Z 1YJNZ 3CCM1 1VQMZ 1S721 3CCQZ 1Q812 1VQN1 2QEX1 1W2BZ 3G4SZ 1VQ81 1JJ2Y 1K9M1 3CXCZ 1KD11 3G71Z 1KC81 1YJWZ 1YJ9Z 2QA4Z 3CPWZ 3CD61 1VQLZ 3CXCY 1VQ71 3CCUZ 1M901 1YITZ 1YIJ1 1KQSY 3I561 1QVGY 1K8A1 1VQ41 1QVFY 3CC41 2OTLZ 1YI2Z 2OTJ1 1M1K2 1VQ51 1JJ2Z 3CME1 3CCR1 1N8R2 1VQ61 3I55Z 1K731 3CCEZ 3CCJ1 3CMA1 1Q7Y2 3G6EZ 3CCMZ 1S72Z 1KQSZ 1QVGZ 1QVFZ 1VQP1 1Q811 1VQNZ 3CCV1 2QEXZ 1VQ91 3CCS1 1VQ8Z 3CC71 1VQO1 1YHQ1 1VQK1 3CD6Z 1Q822 1Q7Y1 1VQ7Z 3CC21 1YJN1 3CCLZ 1VQM1 1YIJZ 3I56Z 1Q862 3CCQ1 1VQ4Z
chains in the Genus database with same CATH superfamily
2YU9I 3CC4Z 4A3MI 3BG0B 1K9M2 1KD12 1ZB8A 5D1OA 3GTKI 2RHBA 1ZH1A 1VQ5Z 3I4MI 1M1K1 2VPXA 1YIT1 1Y1WI 2IZ3A 3CCJZ 4DK1A 4A3DI 3J7A4 3K7AI 2HU9A 3HOYI 2R92I 3FKII 3S1QI 1WW9A 5C4JI 3CCL1 2GU2A 2IZ4A 1Q16A 5D1PA 3TDHB 3CCSZ 1NJI1 3CC7Z 2E7ZA 1Q821 4A3LI 3CC2Z 5FLMI 1WCMI 3M4OI 3CCQZ 4RS4A 3KIFA 1Q812 2QEX1 2ZAEB 1K83I 2RT9A 1VQ81 2PMZA 3ESWA 3TE5B 2WB1A 4HH4A 2OOXB 5IT9f 1VQ71 2JIOA 4XX2A 1YITZ 4DGLA 1TFIA 1X0TA 3I561 3I07A 1KRLA 1QVGY 3J80f 4E2XA 2JS4A 2PM9A 1I50I 1QYPA 2KI7B 1M1K2 3S1NI 2VPWA 3EERA 1QF8A 3GTLI 2BJOA 1LQLA 4NBEA 2V8JA 4Y52I 1K731 4RVDA 5D1OB 3G6EZ 2M6NA 2JIRA 1QVGZ 5IT9b 3GTGI 2QEXZ 3MZKB 1VQ8Z 2W04A 2K3RA 2IV2X 1YHQ1 1VQK1 3RZDI 1Q822 5A2Qf 2O53A 4E32A 5C4XI 1VQ7Z 1QXFA 2F4MA 1VQM1 5CM2M 3I56Z 1Q862 2G2KA 3QWUA 4E2WA 1RO4A 3F3FC 4NBAA 1RO0A 4NBFA 3PO3I 1TWGI 5C44I 4NBDA 3NDIA 1VQL1 3H0GI 1FDOA 4BXXI 4RVHA 4E31A 2I3CA 4E30A 3VMIA 2QKDA 5A2Qb 1WJ2A 1WZNA 4NOZA 3NH4A 4S1TA 1DL6A 1Z02A 2O4HA 1K732 1WIIA 3I551 1YHQZ 1VQKZ 2B63I 1JWHC 1VQMZ 2GTIA 2QRCB 2LFUA 2E9HA 3PO2I 3J81f 5IP7I 3NH5A 3CD61 5AN9F 1VQLZ 4RVGA 3S2DI 4BY7I 2YADA 5T64A 1USPA 1K8A1 2R93I 4A3FI 1VQ41 3H3VJ 4NBBA 1TWFI 3GTMI 3S1MI 2DE5A 2QLVB 2OTJ1 2AKLA 2NVXI 3CME1 2VF1A 3CCR1 4DQYB 3I55Z 2QREB 3RZOI 3CMA1 1Q7Y2 4MD8A 2HF1A 2E2HI 4A3BI 3CCV1 3GTMS 1VQ91 4NBGA 2JR6A 3HOUI 2Q4ZA 3CD6Z 4A3II 2LEXA 3CCLZ 3HOZI 2V45A 2QR1B 2DE7A 1VQ4Z 1X3ZA 3G4S1 3GTQI 1YJW1 2OTJZ 2QA41 4MD7A 4RV9A 2JNYA 1ML8A 4AYBA 3CMEZ 3CCRZ 1Y1VI 1NJI2 3J80b 3NH8A 1K8A2 3D6WA 3HOVI 3CMAZ 4HGYA 2P28A 3S16I 2JA8I 2OTL1 4A3CI 4BBRI 1W2BY 3S15I 3CCVZ 1USPB 3OW2Z 1VQ9Z 1R9TI 3CPWY 5LL6f 3GCFA 4EWCA 3S14I 3Q87A 2VUGA 2JA6I 2LIYA 2P3YA 1TWCI 2JIPA 1S721 3MZLB 3I4NI 4NB8A 2Q51A 2W03A 1VQN1 1RLYA 2WAQA 2V8IA 1W2BZ 1SFOI 2VUMI 1NP6A 3G4SZ 1JJ2Y 2RBLA 3CXCZ 1KC81 1YJWZ 1X3WA 3CPWZ 2QA4Z 3FQQA 3NDJA 1M901 1I3QI 3PO3S 3D2LA 1Z03A 1KQSY 2NVYI 1QVFY 4TNUA 1YUAA 3GTOI 1AA6A 2OTLZ 3T4NB 2E2II 3HOWI 2VPZA 4MONA 2EGTA 3IFUA 2M48A 1JJ2Z 1VQ61 1N2FA 2JA7I 3P5JB 1RO2A 1Y8CA 3HKZA 3S17I 1S72Z 1KQSZ 2R7ZI 3VMGA 1QVFZ 1VQP1 2GTHA 3JAMf 1VQNZ 3IX0A 2V8KA 2E2JI 2JA5I 1VQO1 2Y0SA 2NVTI 4BBSI 2DE6A 1YJN1 3FQMA 3MONA 4NH1C 2JIQA 3IR7A 3VTNA 3J81b 4E2ZA 1KC82 3G711 3G6E1 1YJ91 3F3PC 4HGZA 1M902 2F4OA 3CCU1 1VQ6Z 3KIHA 3JAMb 1N8R1 1Q861 5T6BA 1PFTA 3D9XA 3VB9A 3S2HI 4NFRA 2AYDA 1VLAA 4A3GI 2JMOA 5C3EI 4MH4A 1VQPZ 4QTTA 1YI21 3GTJI 1L1OC 2VPYA 2KPIA 4E33A 2K5RA 3OW2Y 1VQOZ 3CCE1 3S1RI 2J6AA 3NFZA 2NAPA 1YJNZ 1SIWA 3CCM1 3GKQA 4E2YA 2R6MA 2RPRA 4A3JI 3EEDA 4MRIA 4Y7NI 1TWHI 3BG1B 3U50C 1YUKA 2V3VA 1K9M1 1KD11 3G71Z 1NUIA 4NB9A 1YJ9Z 3GTPI 3CXCY 3CCUZ 4MXUA 3HOXI 1YIJ1 4A3EI 1I6HI 1Y1VS 3CC41 2H85A 4QTUA 2OZKA 3IF8A 5T67A 1YI2Z 4NBHA 5FLXf 2JIMA 1VQ51 1P9NA 1RNIA 1N8R2 4A3KI 4X6AI 3CCEZ 2QRDB 2JUBA 3CCJ1 3M3YI 3CCMZ 1RQFA 4NBCA 4BY1I 1FDIA 3VMHA 4RVFA 1Q811 3LUSA 1Z01A 5IP9I 4A93I 1TWAI 3CCS1 2PK7A 4CL1A 1ZB9A 4MD9A 3CC71 2NVQI 1Q7Y1 3CC21 1YIJZ 3CQZI 5FLXb 1S7MA 3CCQ1 2RIQA 2OOYB
chains in the Genus database with same CATH topology
2YU9I 3CC4Z 4A3MI 3BG0B 1K9M2 1KD12 1ZB8A 5D1OA 3GTKI 2RHBA 1ZH1A 1VQ5Z 3I4MI 1M1K1 1YIT1 1Y1WI 2IZ3A 3CCJZ 4DK1A 4A3DI 3J7A4 3K7AI 2HU9A 3HOYI 2R92I 3FKII 3S1QI 1WW9A 5C4JI 3CCL1 2GU2A 2IZ4A 5D1PA 3TDHB 3CCSZ 1NJI1 3CC7Z 1Q821 4A3LI 3CC2Z 5FLMI 1WCMI 3M4OI 3CCQZ 4RS4A 3KIFA 1Q812 2QEX1 2ZAEB 1K83I 2RT9A 1VQ81 2PMZA 3ESWA 3TE5B 2WB1A 4HH4A 2OOXB 5IT9f 1VQ71 4XX2A 1YITZ 4DGLA 1TFIA 1X0TA 3I561 3I07A 1KRLA 1QVGY 3J80f 4E2XA 2JS4A 2PM9A 1I50I 1QYPA 2KI7B 1M1K2 3S1NI 3EERA 1QF8A 3GTLI 2BJOA 1LQLA 4NBEA 2V8JA 4Y52I 1K731 4RVDA 5D1OB 3G6EZ 2M6NA 1QVGZ 5IT9b 3GTGI 2QEXZ 3MZKB 1VQ8Z 2W04A 2K3RA 1YHQ1 1VQK1 3RZDI 1Q822 5A2Qf 2O53A 4E32A 5C4XI 1VQ7Z 2F4MA 1VQM1 5CM2M 3I56Z 1Q862 2G2KA 3QWUA 4E2WA 1RO4A 3F3FC 4NBAA 1RO0A 4NBFA 3PO3I 1TWGI 5C44I 4NBDA 3NDIA 1VQL1 3H0GI 4BXXI 4RVHA 4E31A 2I3CA 4E30A 3VMIA 2QKDA 5A2Qb 4NOZA 3NH4A 4S1TA 1DL6A 1Z02A 2O4HA 1K732 1WIIA 3I551 1YHQZ 1VQKZ 2B63I 1JWHC 1VQMZ 2GTIA 2QRCB 2LFUA 2E9HA 3PO2I 3J81f 5IP7I 3NH5A 3CD61 5AN9F 1VQLZ 4RVGA 3S2DI 4BY7I 2YADA 5T64A 1USPA 1K8A1 2R93I 4A3FI 1VQ41 3H3VJ 4NBBA 1TWFI 3GTMI 3S1MI 2DE5A 2QLVB 2OTJ1 2AKLA 2NVXI 3CME1 2VF1A 3CCR1 4DQYB 3I55Z 2QREB 3RZOI 3CMA1 1Q7Y2 4MD8A 2HF1A 2E2HI 4A3BI 3CCV1 3GTMS 1VQ91 4NBGA 2JR6A 3HOUI 2Q4ZA 3CD6Z 4A3II 3CCLZ 3HOZI 2QR1B 2DE7A 1VQ4Z 1X3ZA 3G4S1 3GTQI 1YJW1 2OTJZ 2QA41 4MD7A 4RV9A 2JNYA 1ML8A 4AYBA 3CMEZ 3CCRZ 1Y1VI 1NJI2 3J80b 3NH8A 1K8A2 3D6WA 3HOVI 3CMAZ 4HGYA 2P28A 3S16I 2JA8I 2OTL1 4A3CI 4BBRI 1W2BY 3S15I 3CCVZ 1USPB 3OW2Z 1VQ9Z 1R9TI 3CPWY 5LL6f 3GCFA 4EWCA 3S14I 3Q87A 2VUGA 2JA6I 2LIYA 2P3YA 1TWCI 1S721 3MZLB 3I4NI 4NB8A 2Q51A 2W03A 1VQN1 1RLYA 2WAQA 2V8IA 1W2BZ 1SFOI 2VUMI 1NP6A 3G4SZ 1JJ2Y 2RBLA 3CXCZ 1KC81 1YJWZ 1X3WA 3CPWZ 2QA4Z 3FQQA 3NDJA 1M901 1I3QI 3PO3S 1Z03A 1KQSY 2NVYI 1QVFY 4TNUA 1YUAA 3GTOI 2OTLZ 3T4NB 2E2II 3HOWI 4MONA 2EGTA 3IFUA 2M48A 1JJ2Z 1VQ61 1N2FA 2JA7I 3P5JB 1RO2A 3HKZA 3S17I 1S72Z 1KQSZ 2R7ZI 3VMGA 1QVFZ 1VQP1 2GTHA 3JAMf 1VQNZ 3IX0A 2V8KA 2E2JI 2JA5I 1VQO1 2Y0SA 2NVTI 4BBSI 2DE6A 1YJN1 3FQMA 3MONA 4NH1C 3VTNA 3J81b 4E2ZA 1KC82 3G711 3G6E1 1YJ91 3F3PC 4HGZA 1M902 2F4OA 3CCU1 1VQ6Z 3KIHA 3JAMb 1N8R1 1Q861 5T6BA 1PFTA 3D9XA 3VB9A 3S2HI 4NFRA 4A3GI 1VLAA 2JMOA 5C3EI 4MH4A 1VQPZ 4QTTA 1YI21 3GTJI 1L1OC 2KPIA 4E33A 2K5RA 3OW2Y 1VQOZ 3CCE1 3S1RI 2J6AA 3NFZA 1YJNZ 3CCM1 3GKQA 4E2YA 2R6MA 2RPRA 4A3JI 3EEDA 4MRIA 4Y7NI 1TWHI 3BG1B 3U50C 1YUKA 1K9M1 1KD11 3G71Z 1NUIA 4NB9A 1YJ9Z 3GTPI 3CXCY 3CCUZ 4MXUA 3HOXI 1YIJ1 4A3EI 1I6HI 1Y1VS 3CC41 2H85A 4QTUA 2OZKA 3IF8A 5T67A 1YI2Z 4NBHA 5FLXf 1VQ51 1P9NA 1RNIA 1N8R2 4A3KI 4X6AI 3CCEZ 2QRDB 2JUBA 3CCJ1 3M3YI 3CCMZ 1RQFA 4NBCA 4BY1I 3VMHA 4RVFA 1Q811 3LUSA 1Z01A 5IP9I 4A93I 1TWAI 3CCS1 2PK7A 4CL1A 1ZB9A 4MD9A 3CC71 2NVQI 1Q7Y1 3CC21 1YIJZ 3CQZI 5FLXb 1S7MA 3CCQ1 2RIQA 2OOYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Z;  3G4S 1;  1K9M 2;  1KD1 2;  1KC8 2;  3G71 1;  3G6E 1;  1YJW 1;  2OTJ Z;  1YJ9 1;  2QA4 1;  1VQ5 Z;  1M1K 1;  1M90 2;  1VQL 1;  3CCU 1;  3CME Z;  3CCR Z;  1VQ6 Z;  1N8R 1;  1YIT 1;  1Q86 1;  1NJI 2;  3CCJ Z;  1K8A 2;  3CMA Z;  2OTL 1;  1VQP Z;  1W2B Y;  1YI2 1;  3CCV Z;  3OW2 Z;  3CCL 1;  1VQ9 Z;  3CPW Y;  3CCS Z;  1K73 2;  1NJI 1;  3OW2 Y;  3CC7 Z;  1VQO Z;  3I55 1;  1YHQ Z;  3CCE 1;  1VQK Z;  1Q82 1;  3CC2 Z;  1YJN Z;  3CCM 1;  1VQM Z;  1S72 1;  3CCQ Z;  1Q81 2;  1VQN 1;  2QEX 1;  1W2B Z;  3G4S Z;  1VQ8 1;  1JJ2 Y;  1K9M 1;  3CXC Z;  1KD1 1;  3G71 Z;  1KC8 1;  1YJW Z;  1YJ9 Z;  2QA4 Z;  3CPW Z;  3CD6 1;  1VQL Z;  3CXC Y;  1VQ7 1;  3CCU Z;  1M90 1;  1YIT Z;  1YIJ 1;  1KQS Y;  3I56 1;  1QVG Y;  1K8A 1;  1VQ4 1;  1QVF Y;  3CC4 1;  2OTL Z;  1YI2 Z;  2OTJ 1;  1M1K 2;  1VQ5 1;  1JJ2 Z;  3CME 1;  3CCR 1;  1N8R 2;  1VQ6 1;  3I55 Z;  1K73 1;  3CCE Z;  3CCJ 1;  3CMA 1;  1Q7Y 2;  3G6E Z;  3CCM Z;  1S72 Z;  1KQS Z;  1QVG Z;  1QVF Z;  1VQP 1;  1Q81 1;  1VQN Z;  3CCV 1;  2QEX Z;  1VQ9 1;  3CCS 1;  1VQ8 Z;  3CC7 1;  1VQO 1;  1YHQ 1;  1VQK 1;  3CD6 Z;  1Q82 2;  1Q7Y 1;  1VQ7 Z;  3CC2 1;  1YJN 1;  3CCL Z;  1VQM 1;  1YIJ Z;  3I56 Z;  1Q86 2;  3CCQ 1;  1VQ4 Z; 
#chains in the Genus database with same CATH topology
 2YU9 I;  3CC4 Z;  4A3M I;  3BG0 B;  1K9M 2;  1KD1 2;  1ZB8 A;  5D1O A;  3GTK I;  2RHB A;  1ZH1 A;  1VQ5 Z;  3I4M I;  1M1K 1;  2VPX A;  1YIT 1;  1Y1W I;  2IZ3 A;  3CCJ Z;  4DK1 A;  4A3D I;  3J7A 4;  3K7A I;  2HU9 A;  3HOY I;  2R92 I;  3FKI I;  3S1Q I;  1WW9 A;  5C4J I;  3CCL 1;  2GU2 A;  2IZ4 A;  1Q16 A;  5D1P A;  3TDH B;  3CCS Z;  1NJI 1;  3CC7 Z;  2E7Z A;  1Q82 1;  4A3L I;  3CC2 Z;  5FLM I;  1WCM I;  3M4O I;  3CCQ Z;  4RS4 A;  3KIF A;  1Q81 2;  2QEX 1;  2ZAE B;  1K83 I;  2RT9 A;  1VQ8 1;  2PMZ A;  3ESW A;  3TE5 B;  2WB1 A;  4HH4 A;  2OOX B;  5IT9 f;  1VQ7 1;  2JIO A;  4XX2 A;  1YIT Z;  4DGL A;  1TFI A;  1X0T A;  3I56 1;  3I07 A;  1KRL A;  1QVG Y;  3J80 f;  4E2X A;  2JS4 A;  2PM9 A;  1I50 I;  1QYP A;  2KI7 B;  1M1K 2;  3S1N I;  2VPW A;  3EER A;  1QF8 A;  3GTL I;  2BJO A;  1LQL A;  4NBE A;  2V8J A;  4Y52 I;  1K73 1;  4RVD A;  5D1O B;  3G6E Z;  2M6N A;  2JIR A;  1QVG Z;  5IT9 b;  3GTG I;  2QEX Z;  3MZK B;  1VQ8 Z;  2W04 A;  2K3R A;  2IV2 X;  1YHQ 1;  1VQK 1;  3RZD I;  1Q82 2;  5A2Q f;  2O53 A;  4E32 A;  5C4X I;  1VQ7 Z;  1QXF A;  2F4M A;  1VQM 1;  5CM2 M;  3I56 Z;  1Q86 2;  2G2K A;  3QWU A;  4E2W A;  1RO4 A;  3F3F C;  4NBA A;  1RO0 A;  4NBF A;  3PO3 I;  1TWG I;  5C44 I;  4NBD A;  3NDI A;  1VQL 1;  3H0G I;  1FDO A;  4BXX I;  4RVH A;  4E31 A;  2I3C A;  4E30 A;  3VMI A;  2QKD A;  5A2Q b;  1WJ2 A;  1WZN A;  4NOZ A;  3NH4 A;  4S1T A;  1DL6 A;  1Z02 A;  2O4H A;  1K73 2;  1WII A;  3I55 1;  1YHQ Z;  1VQK Z;  2B63 I;  1JWH C;  1VQM Z;  2GTI A;  2QRC B;  2LFU A;  2E9H A;  3PO2 I;  3J81 f;  5IP7 I;  3NH5 A;  3CD6 1;  5AN9 F;  1VQL Z;  4RVG A;  3S2D I;  4BY7 I;  2YAD A;  5T64 A;  1USP A;  1K8A 1;  2R93 I;  4A3F I;  1VQ4 1;  3H3V J;  4NBB A;  1TWF I;  3GTM I;  3S1M I;  2DE5 A;  2QLV B;  2OTJ 1;  2AKL A;  2NVX I;  3CME 1;  2VF1 A;  3CCR 1;  4DQY B;  3I55 Z;  2QRE B;  3RZO I;  3CMA 1;  1Q7Y 2;  4MD8 A;  2HF1 A;  2E2H I;  4A3B I;  3CCV 1;  3GTM S;  1VQ9 1;  4NBG A;  2JR6 A;  3HOU I;  2Q4Z A;  3CD6 Z;  4A3I I;  2LEX A;  3CCL Z;  3HOZ I;  2V45 A;  2QR1 B;  2DE7 A;  1VQ4 Z;  1X3Z A;  3G4S 1;  3GTQ I;  1YJW 1;  2OTJ Z;  2QA4 1;  4MD7 A;  4RV9 A;  2JNY A;  1ML8 A;  4AYB A;  3CME Z;  3CCR Z;  1Y1V I;  1NJI 2;  3J80 b;  3NH8 A;  1K8A 2;  3D6W A;  3HOV I;  3CMA Z;  4HGY A;  2P28 A;  3S16 I;  2JA8 I;  2OTL 1;  4A3C I;  4BBR I;  1W2B Y;  3S15 I;  3CCV Z;  1USP B;  3OW2 Z;  1VQ9 Z;  1R9T I;  3CPW Y;  5LL6 f;  3GCF A;  4EWC A;  3S14 I;  3Q87 A;  2VUG A;  2JA6 I;  2LIY A;  2P3Y A;  1TWC I;  2JIP A;  1S72 1;  3MZL B;  3I4N I;  4NB8 A;  2Q51 A;  2W03 A;  1VQN 1;  1RLY A;  2WAQ A;  2V8I A;  1W2B Z;  1SFO I;  2VUM I;  1NP6 A;  3G4S Z;  1JJ2 Y;  2RBL A;  3CXC Z;  1KC8 1;  1YJW Z;  1X3W A;  3CPW Z;  2QA4 Z;  3FQQ A;  3NDJ A;  1M90 1;  1I3Q I;  3PO3 S;  3D2L A;  1Z03 A;  1KQS Y;  2NVY I;  1QVF Y;  4TNU A;  1YUA A;  3GTO I;  1AA6 A;  2OTL Z;  3T4N B;  2E2I I;  3HOW I;  2VPZ A;  4MON A;  2EGT A;  3IFU A;  2M48 A;  1JJ2 Z;  1VQ6 1;  1N2F A;  2JA7 I;  3P5J B;  1RO2 A;  1Y8C A;  3HKZ A;  3S17 I;  1S72 Z;  1KQS Z;  2R7Z I;  3VMG A;  1QVF Z;  1VQP 1;  2GTH A;  3JAM f;  1VQN Z;  3IX0 A;  2V8K A;  2E2J I;  2JA5 I;  1VQO 1;  2Y0S A;  2NVT I;  4BBS I;  2DE6 A;  1YJN 1;  3FQM A;  3MON A;  4NH1 C;  2JIQ A;  3IR7 A;  3VTN A;  3J81 b;  4E2Z A;  1KC8 2;  3G71 1;  3G6E 1;  1YJ9 1;  3F3P C;  4HGZ A;  1M90 2;  2F4O A;  3CCU 1;  1VQ6 Z;  3KIH A;  3JAM b;  1N8R 1;  1Q86 1;  5T6B A;  1PFT A;  3D9X A;  3VB9 A;  3S2H I;  4NFR A;  2AYD A;  1VLA A;  4A3G I;  2JMO A;  5C3E I;  4MH4 A;  1VQP Z;  4QTT A;  1YI2 1;  3GTJ I;  1L1O C;  2VPY A;  2KPI A;  4E33 A;  2K5R A;  3OW2 Y;  1VQO Z;  3CCE 1;  3S1R I;  2J6A A;  3NFZ A;  2NAP A;  1YJN Z;  1SIW A;  3CCM 1;  3GKQ A;  4E2Y A;  2R6M A;  2RPR A;  4A3J I;  3EED A;  4MRI A;  4Y7N I;  1TWH I;  3BG1 B;  3U50 C;  1YUK A;  2V3V A;  1K9M 1;  1KD1 1;  3G71 Z;  1NUI A;  4NB9 A;  1YJ9 Z;  3GTP I;  3CXC Y;  3CCU Z;  4MXU A;  3HOX I;  1YIJ 1;  4A3E I;  1I6H I;  1Y1V S;  3CC4 1;  2H85 A;  4QTU A;  2OZK A;  3IF8 A;  5T67 A;  1YI2 Z;  4NBH A;  5FLX f;  2JIM A;  1VQ5 1;  1P9N A;  1RNI A;  1N8R 2;  4A3K I;  4X6A I;  3CCE Z;  2QRD B;  2JUB A;  3CCJ 1;  3M3Y I;  3CCM Z;  1RQF A;  4NBC A;  4BY1 I;  1FDI A;  3VMH A;  4RVF A;  1Q81 1;  3LUS A;  1Z01 A;  5IP9 I;  4A93 I;  1TWA I;  3CCS 1;  2PK7 A;  4CL1 A;  1ZB9 A;  4MD9 A;  3CC7 1;  2NVQ I;  1Q7Y 1;  3CC2 1;  1YIJ Z;  3CQZ I;  5FLX b;  1S7M A;  3CCQ 1;  2RIQ A;  2OOY B; 
#chains in the Genus database with same CATH homology
 2YU9 I;  3CC4 Z;  4A3M I;  3BG0 B;  1K9M 2;  1KD1 2;  1ZB8 A;  5D1O A;  3GTK I;  2RHB A;  1ZH1 A;  1VQ5 Z;  3I4M I;  1M1K 1;  1YIT 1;  1Y1W I;  2IZ3 A;  3CCJ Z;  4DK1 A;  4A3D I;  3J7A 4;  3K7A I;  2HU9 A;  3HOY I;  2R92 I;  3FKI I;  3S1Q I;  1WW9 A;  5C4J I;  3CCL 1;  2GU2 A;  2IZ4 A;  5D1P A;  3TDH B;  3CCS Z;  1NJI 1;  3CC7 Z;  1Q82 1;  4A3L I;  3CC2 Z;  5FLM I;  1WCM I;  3M4O I;  3CCQ Z;  4RS4 A;  3KIF A;  1Q81 2;  2QEX 1;  2ZAE B;  1K83 I;  2RT9 A;  1VQ8 1;  2PMZ A;  3ESW A;  3TE5 B;  2WB1 A;  4HH4 A;  2OOX B;  5IT9 f;  1VQ7 1;  4XX2 A;  1YIT Z;  4DGL A;  1TFI A;  1X0T A;  3I56 1;  3I07 A;  1KRL A;  1QVG Y;  3J80 f;  4E2X A;  2JS4 A;  2PM9 A;  1I50 I;  1QYP A;  2KI7 B;  1M1K 2;  3S1N I;  3EER A;  1QF8 A;  3GTL I;  2BJO A;  1LQL A;  4NBE A;  2V8J A;  4Y52 I;  1K73 1;  4RVD A;  5D1O B;  3G6E Z;  2M6N A;  1QVG Z;  5IT9 b;  3GTG I;  2QEX Z;  3MZK B;  1VQ8 Z;  2W04 A;  2K3R A;  1YHQ 1;  1VQK 1;  3RZD I;  1Q82 2;  5A2Q f;  2O53 A;  4E32 A;  5C4X I;  1VQ7 Z;  2F4M A;  1VQM 1;  5CM2 M;  3I56 Z;  1Q86 2;  2G2K A;  3QWU A;  4E2W A;  1RO4 A;  3F3F C;  4NBA A;  1RO0 A;  4NBF A;  3PO3 I;  1TWG I;  5C44 I;  4NBD A;  3NDI A;  1VQL 1;  3H0G I;  4BXX I;  4RVH A;  4E31 A;  2I3C A;  4E30 A;  3VMI A;  2QKD A;  5A2Q b;  4NOZ A;  3NH4 A;  4S1T A;  1DL6 A;  1Z02 A;  2O4H A;  1K73 2;  1WII A;  3I55 1;  1YHQ Z;  1VQK Z;  2B63 I;  1JWH C;  1VQM Z;  2GTI A;  2QRC B;  2LFU A;  2E9H A;  3PO2 I;  3J81 f;  5IP7 I;  3NH5 A;  3CD6 1;  5AN9 F;  1VQL Z;  4RVG A;  3S2D I;  4BY7 I;  2YAD A;  5T64 A;  1USP A;  1K8A 1;  2R93 I;  4A3F I;  1VQ4 1;  3H3V J;  4NBB A;  1TWF I;  3GTM I;  3S1M I;  2DE5 A;  2QLV B;  2OTJ 1;  2AKL A;  2NVX I;  3CME 1;  2VF1 A;  3CCR 1;  4DQY B;  3I55 Z;  2QRE B;  3RZO I;  3CMA 1;  1Q7Y 2;  4MD8 A;  2HF1 A;  2E2H I;  4A3B I;  3CCV 1;  3GTM S;  1VQ9 1;  4NBG A;  2JR6 A;  3HOU I;  2Q4Z A;  3CD6 Z;  4A3I I;  3CCL Z;  3HOZ I;  2QR1 B;  2DE7 A;  1VQ4 Z;  1X3Z A;  3G4S 1;  3GTQ I;  1YJW 1;  2OTJ Z;  2QA4 1;  4MD7 A;  4RV9 A;  2JNY A;  1ML8 A;  4AYB A;  3CME Z;  3CCR Z;  1Y1V I;  1NJI 2;  3J80 b;  3NH8 A;  1K8A 2;  3D6W A;  3HOV I;  3CMA Z;  4HGY A;  2P28 A;  3S16 I;  2JA8 I;  2OTL 1;  4A3C I;  4BBR I;  1W2B Y;  3S15 I;  3CCV Z;  1USP B;  3OW2 Z;  1VQ9 Z;  1R9T I;  3CPW Y;  5LL6 f;  3GCF A;  4EWC A;  3S14 I;  3Q87 A;  2VUG A;  2JA6 I;  2LIY A;  2P3Y A;  1TWC I;  1S72 1;  3MZL B;  3I4N I;  4NB8 A;  2Q51 A;  2W03 A;  1VQN 1;  1RLY A;  2WAQ A;  2V8I A;  1W2B Z;  1SFO I;  2VUM I;  1NP6 A;  3G4S Z;  1JJ2 Y;  2RBL A;  3CXC Z;  1KC8 1;  1YJW Z;  1X3W A;  3CPW Z;  2QA4 Z;  3FQQ A;  3NDJ A;  1M90 1;  1I3Q I;  3PO3 S;  1Z03 A;  1KQS Y;  2NVY I;  1QVF Y;  4TNU A;  1YUA A;  3GTO I;  2OTL Z;  3T4N B;  2E2I I;  3HOW I;  4MON A;  2EGT A;  3IFU A;  2M48 A;  1JJ2 Z;  1VQ6 1;  1N2F A;  2JA7 I;  3P5J B;  1RO2 A;  3HKZ A;  3S17 I;  1S72 Z;  1KQS Z;  2R7Z I;  3VMG A;  1QVF Z;  1VQP 1;  2GTH A;  3JAM f;  1VQN Z;  3IX0 A;  2V8K A;  2E2J I;  2JA5 I;  1VQO 1;  2Y0S A;  2NVT I;  4BBS I;  2DE6 A;  1YJN 1;  3FQM A;  3MON A;  4NH1 C;  3VTN A;  3J81 b;  4E2Z A;  1KC8 2;  3G71 1;  3G6E 1;  1YJ9 1;  3F3P C;  4HGZ A;  1M90 2;  2F4O A;  3CCU 1;  1VQ6 Z;  3KIH A;  3JAM b;  1N8R 1;  1Q86 1;  5T6B A;  1PFT A;  3D9X A;  3VB9 A;  3S2H I;  4NFR A;  4A3G I;  1VLA A;  2JMO A;  5C3E I;  4MH4 A;  1VQP Z;  4QTT A;  1YI2 1;  3GTJ I;  1L1O C;  2KPI A;  4E33 A;  2K5R A;  3OW2 Y;  1VQO Z;  3CCE 1;  3S1R I;  2J6A A;  3NFZ A;  1YJN Z;  3CCM 1;  3GKQ A;  4E2Y A;  2R6M A;  2RPR A;  4A3J I;  3EED A;  4MRI A;  4Y7N I;  1TWH I;  3BG1 B;  3U50 C;  1YUK A;  1K9M 1;  1KD1 1;  3G71 Z;  1NUI A;  4NB9 A;  1YJ9 Z;  3GTP I;  3CXC Y;  3CCU Z;  4MXU A;  3HOX I;  1YIJ 1;  4A3E I;  1I6H I;  1Y1V S;  3CC4 1;  2H85 A;  4QTU A;  2OZK A;  3IF8 A;  5T67 A;  1YI2 Z;  4NBH A;  5FLX f;  1VQ5 1;  1P9N A;  1RNI A;  1N8R 2;  4A3K I;  4X6A I;  3CCE Z;  2QRD B;  2JUB A;  3CCJ 1;  3M3Y I;  3CCM Z;  1RQF A;  4NBC A;  4BY1 I;  3VMH A;  4RVF A;  1Q81 1;  3LUS A;  1Z01 A;  5IP9 I;  4A93 I;  1TWA I;  3CCS 1;  2PK7 A;  4CL1 A;  1ZB9 A;  4MD9 A;  3CC7 1;  2NVQ I;  1Q7Y 1;  3CC2 1;  1YIJ Z;  3CQZ I;  5FLX b;  1S7M A;  3CCQ 1;  2RIQ A;  2OOY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...