1VQPZ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqpZ00
1YJ9Z 1VQ91 1VQN1 1K8A2 1YJW1 3CC4Z 2OTLZ 3CCQZ 3CCUZ 3CCR1 1W2BZ 1VQ71 1YHQ1 3G71Z 3CMA1 3CD6Z 1VQO1 2OTJ1 1K8A1 1VQ51 3G6E1 3CCL1 3CMEZ 1VQPZ 1M1K1 1VQMZ 1JJ2Y 3I56Z 1Q821 1KQSZ 1YIJ1 3CXCY 3OW2Y 1KC82 3CPWY 1S721 1VQK1 1N8R2 3I551 3CC41 1YJNZ 1VQ41 1Q7Y2 3CCM1 1Q811 3CC2Z 3CCU1 1KD12 1W2BY 1NJI2 1QVFZ 1VQLZ 3G4S1 3CC71 3CCJZ 1N8R1 3CCV1 2QA4Z 1YI2Z 1VQ6Z 1K9M2 2QEXZ 1YITZ 1NJI1 1VQM1 3CCE1 3CCS1 1YJWZ 1KQSY 1YJ91 1K9M1 1K732 1VQ7Z 1YHQZ 2OTL1 3CCQ1 1VQ8Z 2OTJZ 3CCLZ 1KC81 3G711 3CD61 1QVGZ 1K731 1YI21 1Q7Y1 3CME1 1VQP1 1KD11 1YIJZ 1YIT1 3CPWZ 1S72Z 1VQ9Z 1VQKZ 1VQNZ 3I55Z 3I561 1M902 1VQ4Z 3CCMZ 3CCRZ 1M1K2 1YJN1 3CMAZ 3G4SZ 3CC21 3CC7Z 1VQOZ 1VQ81 1Q822 1Q862 3CCVZ 1M901 1VQ5Z 1QVFY 3G6EZ 1VQL1 3CCJ1 1QVGY 1Q861 1Q812 2QA41 1VQ61 1JJ2Z 3CCEZ 2QEX1 3CCSZ 3CXCZ 3OW2Z
chains in the Genus database with same CATH superfamily
2QREB 2AYDA 1YJW1 1WW9A 3GTJI 3CD6Z 3PO2I 2R93I 1YUAA 1VQ51 4DK1A 1VQPZ 4NBCA 3GTMS 1M1K1 3S2DI 1TWAI 5IP7I 3PO3S 4BBSI 3M3YI 4MD7A 1JJ2Y 4RV9A 1KC82 3CPWY 3NH4A 1VQK1 4E30A 2QRDB 1Q811 2JNYA 3CC2Z 3CCU1 1ZH1A 3H3VJ 2IV2X 4XX2A 1NJI2 1QVFZ 4MH4A 3F3PC 3CC71 2VUMI 3Q87A 1VQ6Z 3NH8A 3NDIA 4A3FI 1NJI1 2RT9A 3GTLI 4RVHA 4RVDA 2K3RA 2PM9A 2E7ZA 3RZDI 1Y1VI 1VQ7Z 4NBEA 2YADA 2NVXI 3J81b 4DQYB 5FLMI 3CD61 1QVGZ 1N2FA 2VUGA 1Q16A 1YI21 1VQP1 1KD11 3FKII 1YIT1 3CPWZ 3RZOI 5T6BA 2RHBA 1S72Z 1ZB9A 2V8IA 2WAQA 3K7AI 3MZKB 4BBRI 4MRIA 4E2ZA 3KIHA 2V8JA 3G4SZ 3CC21 1VQ81 2NVYI 3GTOI 1VQ5Z 3CCVZ 2HF1A 3HOZI 1I50I 2JA5I 4A3JI 4DGLA 1VQ61 3HKZA 3CCEZ 3CCSZ 5IP9I 3CXCZ 1TFIA 3OW2Z 2R7ZI 2OOYB 1YJ9Z 2DE5A 2P3YA 1ZB8A 1K8A2 2IZ3A 4RVFA 4NB8A 2OTLZ 3GTGI 5C3EI 3CCUZ 3CCR1 1W2BZ 4RVGA 1VQ71 2V3VA 1X0TA 3G71Z 4A93I 1TWFI 1K8A1 2JIOA 1SFOI 3CMEZ 3F3FC 4E2YA 1X3WA 4QTTA 2VPZA 2QKDA 5T64A 3I56Z 1KQSZ 4MD9A 3HOXI 1S721 1RO2A 4Y52I 2PMZA 4AYBA 1FDOA 4BXXI 2IZ4A 4Y7NI 4HGYA 4A3II 1VLAA 2QLVB 3H0GI 2E2JI 3GTMI 1FDIA 4MXUA 3IFUA 4NBHA 5CM2M 2VPWA 3G4S1 2JIRA 3CCJZ 3ESWA 1K83I 4A3MI 4MONA 3I07A 3CCV1 1YI2Z 2QEXZ 2KI7B 1YITZ 5AN9F 2F4MA 2RIQA 2VF1A 3MONA 3CCE1 3CCS1 3S16I 1YJ91 3HOVI 2LEXA 2OTL1 1JWHC 1VQ8Z 3MZLB 2KPIA 1KC81 3G711 3JAMb 1I6HI 3I4NI 4HGZA 1RO4A 1RO0A 1PFTA 2Q4ZA 4NFRA 3CME1 3S17I 1YIJZ 1Y8CA 2P28A 3I55Z 3I561 3IX0A 5C44I 3CCMZ 3CCRZ 4X6AI 3JAMf 3U50C 4A3GI 3J80f 2G2KA 3S2HI 4E32A 1Q822 1RNIA 1RQFA 4NB9A 3CCJ1 2AKLA 2E9HA 3VB9A 1R9TI 1JJ2Z 2QEX1 4A3DI 1L1OC 4E2WA 3BG0B 1VQN1 5C4JI 3CCQZ 3IF8A 4A3CI 4A3KI 1USPA 5A2Qb 1VQO1 1KRLA 4A3EI 1AA6A 2R6MA 5D1OA 2K5RA 3IR7A 4NBFA 3NDJA 1YIJ1 4BY1I 1ML8A 5A2Qf 1N8R2 1Z01A 3I551 3CC41 1YJNZ 4MD8A 1Q7Y2 3CCM1 1YUKA 2JS4A 1VQLZ 2NVQI 2E2HI 1N8R1 2JA7I 3VMHA 2LIYA 5D1PA 2QR1B 1K9M2 3S1MI 1USPB 3HOUI 3LUSA 1VQM1 1LQLA 3M4OI 1TWHI 2PK7A 2OOXB 2W04A 4CL1A 2VPYA 5D1OB 4S1TA 1K9M1 3P5JB 2NAPA 3D9XA 1S7MA 5LL6f 1YHQZ 3CCQ1 4E2XA 2OTJZ 1Y1WI 3CCLZ 3PO3I 1WZNA 1NP6A 3GKQA 1Z03A 3KIFA 1SIWA 1VQNZ 1QXFA 2QRCB 4NBGA 4A3BI 3EERA 1VQ4Z 2JIPA 2Y0SA 2DE7A 2Q51A 1M1K2 3I4MI 2H85A 2EGTA 2LFUA 3D2LA 1YJN1 5T67A 2J6AA 1VQOZ 2JA6I 1Q862 1Z02A 4TNUA 2O53A 1VQL1 4EWCA 3J80b 1NUIA 1QVGY 1Q812 4NH1C 3D6WA 2JR6A 4E31A 5FLXb 1Q861 4BY7I 2HU9A 1VQ91 2F4OA 3CC4Z 1DL6A 3HOYI 2RBLA 5IT9b 2R92I 1YHQ1 3CMA1 1I3QI 1X3ZA 2OTJ1 5FLXf 3VTNA 2V45A 1QYPA 3G6E1 3CCL1 3EEDA 3QWUA 1VQMZ 4NBBA 5IT9f 1Q821 3GTQI 3VMIA 3TDHB 3CXCY 3OW2Y 2JIQA 2OZKA 2JA8I 1WJ2A 1VQ41 3S15I 1KD12 4E33A 1W2BY 3FQMA 2GU2A 3CQZI 2V8KA 3TE5B 1Y1VS 3GTPI 3S14I 2JIMA 2QA4Z 4QTUA 2YU9I 2NVTI 2GTIA 2WB1A 3J81f 2B63I 3S1RI 1YJWZ 1KQSY 2JUBA 4NBAA 1K732 2BJOA 3VMGA 3NH5A 3FQQA 5C4XI 3GTKI 3HOWI 1K731 2E2II 1Q7Y1 4RS4A 3S1QI 1WCMI 2W03A 4A3LI 1VQ9Z 1VQKZ 1M902 3T4NB 1TWCI 3NFZA 3J7A4 1TWGI 1QF8A 2M48A 3GCFA 3BG1B 4NOZA 2I3CA 1WIIA 3CMAZ 3CC7Z 1RLYA 2GTHA 2JMOA 1M901 1QVFY 3G6EZ 2ZAEB 2DE6A 2RPRA 2O4HA 2QA41 1P9NA 3S1NI 2M6NA 4NBDA 4HH4A 2VPXA
chains in the Genus database with same CATH topology
2QREB 1YJW1 1WW9A 3GTJI 3CD6Z 3PO2I 2R93I 1YUAA 1VQ51 4DK1A 1VQPZ 4NBCA 3GTMS 1M1K1 3S2DI 1TWAI 5IP7I 3PO3S 4BBSI 3M3YI 4MD7A 1JJ2Y 4RV9A 1KC82 3CPWY 3NH4A 1VQK1 4E30A 2QRDB 1Q811 2JNYA 3CC2Z 3CCU1 1ZH1A 3H3VJ 4XX2A 1NJI2 1QVFZ 4MH4A 3F3PC 3CC71 2VUMI 3Q87A 1VQ6Z 3NH8A 3NDIA 4A3FI 1NJI1 2RT9A 3GTLI 4RVHA 4RVDA 2K3RA 2PM9A 3RZDI 1Y1VI 1VQ7Z 4NBEA 2YADA 2NVXI 3J81b 4DQYB 5FLMI 3CD61 1QVGZ 1N2FA 2VUGA 1YI21 1VQP1 1KD11 3FKII 1YIT1 3CPWZ 3RZOI 5T6BA 2RHBA 1S72Z 1ZB9A 2V8IA 2WAQA 3K7AI 3MZKB 4BBRI 4MRIA 4E2ZA 3KIHA 2V8JA 3G4SZ 3CC21 1VQ81 2NVYI 3GTOI 1VQ5Z 3CCVZ 2HF1A 3HOZI 1I50I 2JA5I 4A3JI 4DGLA 1VQ61 3HKZA 3CCEZ 3CCSZ 5IP9I 3CXCZ 1TFIA 3OW2Z 2R7ZI 2OOYB 1YJ9Z 2DE5A 2P3YA 1ZB8A 1K8A2 2IZ3A 4RVFA 4NB8A 2OTLZ 3GTGI 5C3EI 3CCUZ 3CCR1 1W2BZ 4RVGA 1VQ71 1X0TA 3G71Z 4A93I 1TWFI 1K8A1 1SFOI 3CMEZ 3F3FC 4E2YA 1X3WA 4QTTA 2QKDA 5T64A 3I56Z 1KQSZ 4MD9A 3HOXI 1S721 1RO2A 4Y52I 2PMZA 4AYBA 4BXXI 2IZ4A 4Y7NI 4HGYA 4A3II 1VLAA 2QLVB 3H0GI 2E2JI 3GTMI 4MXUA 3IFUA 4NBHA 5CM2M 3G4S1 3CCJZ 3ESWA 1K83I 4A3MI 4MONA 3I07A 3CCV1 1YI2Z 2QEXZ 2KI7B 1YITZ 5AN9F 2F4MA 2RIQA 2VF1A 3MONA 3CCE1 3CCS1 3S16I 1YJ91 3HOVI 2OTL1 1JWHC 1VQ8Z 3MZLB 2KPIA 1KC81 3G711 3JAMb 1I6HI 3I4NI 4HGZA 1RO4A 1RO0A 1PFTA 2Q4ZA 4NFRA 3CME1 3S17I 1YIJZ 2P28A 3I55Z 3I561 3IX0A 5C44I 3CCMZ 3CCRZ 4X6AI 3JAMf 3U50C 4A3GI 3J80f 2G2KA 3S2HI 4E32A 1Q822 1RNIA 1RQFA 4NB9A 3CCJ1 2AKLA 2E9HA 3VB9A 1R9TI 1JJ2Z 2QEX1 4A3DI 1L1OC 4E2WA 3BG0B 1VQN1 5C4JI 3CCQZ 3IF8A 4A3CI 4A3KI 1USPA 5A2Qb 1VQO1 1KRLA 4A3EI 2R6MA 5D1OA 2K5RA 4NBFA 3NDJA 1YIJ1 4BY1I 1ML8A 5A2Qf 1N8R2 1Z01A 3I551 3CC41 1YJNZ 4MD8A 1Q7Y2 3CCM1 1YUKA 2JS4A 1VQLZ 2NVQI 2E2HI 1N8R1 2JA7I 3VMHA 2LIYA 5D1PA 2QR1B 1K9M2 3S1MI 1USPB 3HOUI 3LUSA 1VQM1 1LQLA 3M4OI 1TWHI 2PK7A 2OOXB 2W04A 4CL1A 5D1OB 4S1TA 1K9M1 3P5JB 3D9XA 1S7MA 5LL6f 1YHQZ 3CCQ1 4E2XA 2OTJZ 1Y1WI 3CCLZ 3PO3I 1NP6A 3GKQA 1Z03A 3KIFA 1VQNZ 2QRCB 4NBGA 4A3BI 3EERA 1VQ4Z 2Y0SA 2DE7A 2Q51A 1M1K2 3I4MI 2H85A 2EGTA 2LFUA 1YJN1 5T67A 2J6AA 1VQOZ 2JA6I 1Q862 1Z02A 4TNUA 2O53A 1VQL1 4EWCA 3J80b 1NUIA 1QVGY 1Q812 4NH1C 3D6WA 2JR6A 4E31A 5FLXb 1Q861 4BY7I 2HU9A 1VQ91 2F4OA 3CC4Z 1DL6A 3HOYI 2RBLA 5IT9b 2R92I 1YHQ1 3CMA1 1I3QI 1X3ZA 2OTJ1 5FLXf 3VTNA 1QYPA 3G6E1 3CCL1 3EEDA 3QWUA 1VQMZ 4NBBA 5IT9f 1Q821 3GTQI 3VMIA 3TDHB 3CXCY 3OW2Y 2OZKA 2JA8I 1VQ41 3S15I 1KD12 4E33A 1W2BY 3FQMA 2GU2A 3CQZI 2V8KA 3TE5B 1Y1VS 3GTPI 3S14I 2QA4Z 4QTUA 2YU9I 2NVTI 2GTIA 2WB1A 3J81f 2B63I 3S1RI 1YJWZ 1KQSY 2JUBA 4NBAA 1K732 2BJOA 3VMGA 3NH5A 3FQQA 5C4XI 3GTKI 3HOWI 1K731 2E2II 1Q7Y1 4RS4A 3S1QI 1WCMI 2W03A 4A3LI 1VQ9Z 1VQKZ 1M902 3T4NB 1TWCI 3NFZA 3J7A4 1TWGI 1QF8A 2M48A 3GCFA 3BG1B 4NOZA 2I3CA 1WIIA 3CMAZ 3CC7Z 1RLYA 2GTHA 2JMOA 1M901 1QVFY 3G6EZ 2ZAEB 2DE6A 2RPRA 2O4HA 2QA41 1P9NA 3S1NI 2M6NA 4NBDA 4HH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  1VQ9 1;  1VQN 1;  1K8A 2;  1YJW 1;  3CC4 Z;  2OTL Z;  3CCQ Z;  3CCU Z;  3CCR 1;  1W2B Z;  1VQ7 1;  1YHQ 1;  3G71 Z;  3CMA 1;  3CD6 Z;  1VQO 1;  2OTJ 1;  1K8A 1;  1VQ5 1;  3G6E 1;  3CCL 1;  3CME Z;  1VQP Z;  1M1K 1;  1VQM Z;  1JJ2 Y;  3I56 Z;  1Q82 1;  1KQS Z;  1YIJ 1;  3CXC Y;  3OW2 Y;  1KC8 2;  3CPW Y;  1S72 1;  1VQK 1;  1N8R 2;  3I55 1;  3CC4 1;  1YJN Z;  1VQ4 1;  1Q7Y 2;  3CCM 1;  1Q81 1;  3CC2 Z;  3CCU 1;  1KD1 2;  1W2B Y;  1NJI 2;  1QVF Z;  1VQL Z;  3G4S 1;  3CC7 1;  3CCJ Z;  1N8R 1;  3CCV 1;  2QA4 Z;  1YI2 Z;  1VQ6 Z;  1K9M 2;  2QEX Z;  1YIT Z;  1NJI 1;  1VQM 1;  3CCE 1;  3CCS 1;  1YJW Z;  1KQS Y;  1YJ9 1;  1K9M 1;  1K73 2;  1VQ7 Z;  1YHQ Z;  2OTL 1;  3CCQ 1;  1VQ8 Z;  2OTJ Z;  3CCL Z;  1KC8 1;  3G71 1;  3CD6 1;  1QVG Z;  1K73 1;  1YI2 1;  1Q7Y 1;  3CME 1;  1VQP 1;  1KD1 1;  1YIJ Z;  1YIT 1;  3CPW Z;  1S72 Z;  1VQ9 Z;  1VQK Z;  1VQN Z;  3I55 Z;  3I56 1;  1M90 2;  1VQ4 Z;  3CCM Z;  3CCR Z;  1M1K 2;  1YJN 1;  3CMA Z;  3G4S Z;  3CC2 1;  3CC7 Z;  1VQO Z;  1VQ8 1;  1Q82 2;  1Q86 2;  3CCV Z;  1M90 1;  1VQ5 Z;  1QVF Y;  3G6E Z;  1VQL 1;  3CCJ 1;  1QVG Y;  1Q86 1;  1Q81 2;  2QA4 1;  1VQ6 1;  1JJ2 Z;  3CCE Z;  2QEX 1;  3CCS Z;  3CXC Z;  3OW2 Z; 
#chains in the Genus database with same CATH topology
 2QRE B;  2AYD A;  1YJW 1;  1WW9 A;  3GTJ I;  3CD6 Z;  3PO2 I;  2R93 I;  1YUA A;  1VQ5 1;  4DK1 A;  1VQP Z;  4NBC A;  3GTM S;  1M1K 1;  3S2D I;  1TWA I;  5IP7 I;  3PO3 S;  4BBS I;  3M3Y I;  4MD7 A;  1JJ2 Y;  4RV9 A;  1KC8 2;  3CPW Y;  3NH4 A;  1VQK 1;  4E30 A;  2QRD B;  1Q81 1;  2JNY A;  3CC2 Z;  3CCU 1;  1ZH1 A;  3H3V J;  2IV2 X;  4XX2 A;  1NJI 2;  1QVF Z;  4MH4 A;  3F3P C;  3CC7 1;  2VUM I;  3Q87 A;  1VQ6 Z;  3NH8 A;  3NDI A;  4A3F I;  1NJI 1;  2RT9 A;  3GTL I;  4RVH A;  4RVD A;  2K3R A;  2PM9 A;  2E7Z A;  3RZD I;  1Y1V I;  1VQ7 Z;  4NBE A;  2YAD A;  2NVX I;  3J81 b;  4DQY B;  5FLM I;  3CD6 1;  1QVG Z;  1N2F A;  2VUG A;  1Q16 A;  1YI2 1;  1VQP 1;  1KD1 1;  3FKI I;  1YIT 1;  3CPW Z;  3RZO I;  5T6B A;  2RHB A;  1S72 Z;  1ZB9 A;  2V8I A;  2WAQ A;  3K7A I;  3MZK B;  4BBR I;  4MRI A;  4E2Z A;  3KIH A;  2V8J A;  3G4S Z;  3CC2 1;  1VQ8 1;  2NVY I;  3GTO I;  1VQ5 Z;  3CCV Z;  2HF1 A;  3HOZ I;  1I50 I;  2JA5 I;  4A3J I;  4DGL A;  1VQ6 1;  3HKZ A;  3CCE Z;  3CCS Z;  5IP9 I;  3CXC Z;  1TFI A;  3OW2 Z;  2R7Z I;  2OOY B;  1YJ9 Z;  2DE5 A;  2P3Y A;  1ZB8 A;  1K8A 2;  2IZ3 A;  4RVF A;  4NB8 A;  2OTL Z;  3GTG I;  5C3E I;  3CCU Z;  3CCR 1;  1W2B Z;  4RVG A;  1VQ7 1;  2V3V A;  1X0T A;  3G71 Z;  4A93 I;  1TWF I;  1K8A 1;  2JIO A;  1SFO I;  3CME Z;  3F3F C;  4E2Y A;  1X3W A;  4QTT A;  2VPZ A;  2QKD A;  5T64 A;  3I56 Z;  1KQS Z;  4MD9 A;  3HOX I;  1S72 1;  1RO2 A;  4Y52 I;  2PMZ A;  4AYB A;  1FDO A;  4BXX I;  2IZ4 A;  4Y7N I;  4HGY A;  4A3I I;  1VLA A;  2QLV B;  3H0G I;  2E2J I;  3GTM I;  1FDI A;  4MXU A;  3IFU A;  4NBH A;  5CM2 M;  2VPW A;  3G4S 1;  2JIR A;  3CCJ Z;  3ESW A;  1K83 I;  4A3M I;  4MON A;  3I07 A;  3CCV 1;  1YI2 Z;  2QEX Z;  2KI7 B;  1YIT Z;  5AN9 F;  2F4M A;  2RIQ A;  2VF1 A;  3MON A;  3CCE 1;  3CCS 1;  3S16 I;  1YJ9 1;  3HOV I;  2LEX A;  2OTL 1;  1JWH C;  1VQ8 Z;  3MZL B;  2KPI A;  1KC8 1;  3G71 1;  3JAM b;  1I6H I;  3I4N I;  4HGZ A;  1RO4 A;  1RO0 A;  1PFT A;  2Q4Z A;  4NFR A;  3CME 1;  3S17 I;  1YIJ Z;  1Y8C A;  2P28 A;  3I55 Z;  3I56 1;  3IX0 A;  5C44 I;  3CCM Z;  3CCR Z;  4X6A I;  3JAM f;  3U50 C;  4A3G I;  3J80 f;  2G2K A;  3S2H I;  4E32 A;  1Q82 2;  1RNI A;  1RQF A;  4NB9 A;  3CCJ 1;  2AKL A;  2E9H A;  3VB9 A;  1R9T I;  1JJ2 Z;  2QEX 1;  4A3D I;  1L1O C;  4E2W A;  3BG0 B;  1VQN 1;  5C4J I;  3CCQ Z;  3IF8 A;  4A3C I;  4A3K I;  1USP A;  5A2Q b;  1VQO 1;  1KRL A;  4A3E I;  1AA6 A;  2R6M A;  5D1O A;  2K5R A;  3IR7 A;  4NBF A;  3NDJ A;  1YIJ 1;  4BY1 I;  1ML8 A;  5A2Q f;  1N8R 2;  1Z01 A;  3I55 1;  3CC4 1;  1YJN Z;  4MD8 A;  1Q7Y 2;  3CCM 1;  1YUK A;  2JS4 A;  1VQL Z;  2NVQ I;  2E2H I;  1N8R 1;  2JA7 I;  3VMH A;  2LIY A;  5D1P A;  2QR1 B;  1K9M 2;  3S1M I;  1USP B;  3HOU I;  3LUS A;  1VQM 1;  1LQL A;  3M4O I;  1TWH I;  2PK7 A;  2OOX B;  2W04 A;  4CL1 A;  2VPY A;  5D1O B;  4S1T A;  1K9M 1;  3P5J B;  2NAP A;  3D9X A;  1S7M A;  5LL6 f;  1YHQ Z;  3CCQ 1;  4E2X A;  2OTJ Z;  1Y1W I;  3CCL Z;  3PO3 I;  1WZN A;  1NP6 A;  3GKQ A;  1Z03 A;  3KIF A;  1SIW A;  1VQN Z;  1QXF A;  2QRC B;  4NBG A;  4A3B I;  3EER A;  1VQ4 Z;  2JIP A;  2Y0S A;  2DE7 A;  2Q51 A;  1M1K 2;  3I4M I;  2H85 A;  2EGT A;  2LFU A;  3D2L A;  1YJN 1;  5T67 A;  2J6A A;  1VQO Z;  2JA6 I;  1Q86 2;  1Z02 A;  4TNU A;  2O53 A;  1VQL 1;  4EWC A;  3J80 b;  1NUI A;  1QVG Y;  1Q81 2;  4NH1 C;  3D6W A;  2JR6 A;  4E31 A;  5FLX b;  1Q86 1;  4BY7 I;  2HU9 A;  1VQ9 1;  2F4O A;  3CC4 Z;  1DL6 A;  3HOY I;  2RBL A;  5IT9 b;  2R92 I;  1YHQ 1;  3CMA 1;  1I3Q I;  1X3Z A;  2OTJ 1;  5FLX f;  3VTN A;  2V45 A;  1QYP A;  3G6E 1;  3CCL 1;  3EED A;  3QWU A;  1VQM Z;  4NBB A;  5IT9 f;  1Q82 1;  3GTQ I;  3VMI A;  3TDH B;  3CXC Y;  3OW2 Y;  2JIQ A;  2OZK A;  2JA8 I;  1WJ2 A;  1VQ4 1;  3S15 I;  1KD1 2;  4E33 A;  1W2B Y;  3FQM A;  2GU2 A;  3CQZ I;  2V8K A;  3TE5 B;  1Y1V S;  3GTP I;  3S14 I;  2JIM A;  2QA4 Z;  4QTU A;  2YU9 I;  2NVT I;  2GTI A;  2WB1 A;  3J81 f;  2B63 I;  3S1R I;  1YJW Z;  1KQS Y;  2JUB A;  4NBA A;  1K73 2;  2BJO A;  3VMG A;  3NH5 A;  3FQQ A;  5C4X I;  3GTK I;  3HOW I;  1K73 1;  2E2I I;  1Q7Y 1;  4RS4 A;  3S1Q I;  1WCM I;  2W03 A;  4A3L I;  1VQ9 Z;  1VQK Z;  1M90 2;  3T4N B;  1TWC I;  3NFZ A;  3J7A 4;  1TWG I;  1QF8 A;  2M48 A;  3GCF A;  3BG1 B;  4NOZ A;  2I3C A;  1WII A;  3CMA Z;  3CC7 Z;  1RLY A;  2GTH A;  2JMO A;  1M90 1;  1QVF Y;  3G6E Z;  2ZAE B;  2DE6 A;  2RPR A;  2O4H A;  2QA4 1;  1P9N A;  3S1N I;  2M6N A;  4NBD A;  4HH4 A;  2VPX A; 
#chains in the Genus database with same CATH homology
 2QRE B;  1YJW 1;  1WW9 A;  3GTJ I;  3CD6 Z;  3PO2 I;  2R93 I;  1YUA A;  1VQ5 1;  4DK1 A;  1VQP Z;  4NBC A;  3GTM S;  1M1K 1;  3S2D I;  1TWA I;  5IP7 I;  3PO3 S;  4BBS I;  3M3Y I;  4MD7 A;  1JJ2 Y;  4RV9 A;  1KC8 2;  3CPW Y;  3NH4 A;  1VQK 1;  4E30 A;  2QRD B;  1Q81 1;  2JNY A;  3CC2 Z;  3CCU 1;  1ZH1 A;  3H3V J;  4XX2 A;  1NJI 2;  1QVF Z;  4MH4 A;  3F3P C;  3CC7 1;  2VUM I;  3Q87 A;  1VQ6 Z;  3NH8 A;  3NDI A;  4A3F I;  1NJI 1;  2RT9 A;  3GTL I;  4RVH A;  4RVD A;  2K3R A;  2PM9 A;  3RZD I;  1Y1V I;  1VQ7 Z;  4NBE A;  2YAD A;  2NVX I;  3J81 b;  4DQY B;  5FLM I;  3CD6 1;  1QVG Z;  1N2F A;  2VUG A;  1YI2 1;  1VQP 1;  1KD1 1;  3FKI I;  1YIT 1;  3CPW Z;  3RZO I;  5T6B A;  2RHB A;  1S72 Z;  1ZB9 A;  2V8I A;  2WAQ A;  3K7A I;  3MZK B;  4BBR I;  4MRI A;  4E2Z A;  3KIH A;  2V8J A;  3G4S Z;  3CC2 1;  1VQ8 1;  2NVY I;  3GTO I;  1VQ5 Z;  3CCV Z;  2HF1 A;  3HOZ I;  1I50 I;  2JA5 I;  4A3J I;  4DGL A;  1VQ6 1;  3HKZ A;  3CCE Z;  3CCS Z;  5IP9 I;  3CXC Z;  1TFI A;  3OW2 Z;  2R7Z I;  2OOY B;  1YJ9 Z;  2DE5 A;  2P3Y A;  1ZB8 A;  1K8A 2;  2IZ3 A;  4RVF A;  4NB8 A;  2OTL Z;  3GTG I;  5C3E I;  3CCU Z;  3CCR 1;  1W2B Z;  4RVG A;  1VQ7 1;  1X0T A;  3G71 Z;  4A93 I;  1TWF I;  1K8A 1;  1SFO I;  3CME Z;  3F3F C;  4E2Y A;  1X3W A;  4QTT A;  2QKD A;  5T64 A;  3I56 Z;  1KQS Z;  4MD9 A;  3HOX I;  1S72 1;  1RO2 A;  4Y52 I;  2PMZ A;  4AYB A;  4BXX I;  2IZ4 A;  4Y7N I;  4HGY A;  4A3I I;  1VLA A;  2QLV B;  3H0G I;  2E2J I;  3GTM I;  4MXU A;  3IFU A;  4NBH A;  5CM2 M;  3G4S 1;  3CCJ Z;  3ESW A;  1K83 I;  4A3M I;  4MON A;  3I07 A;  3CCV 1;  1YI2 Z;  2QEX Z;  2KI7 B;  1YIT Z;  5AN9 F;  2F4M A;  2RIQ A;  2VF1 A;  3MON A;  3CCE 1;  3CCS 1;  3S16 I;  1YJ9 1;  3HOV I;  2OTL 1;  1JWH C;  1VQ8 Z;  3MZL B;  2KPI A;  1KC8 1;  3G71 1;  3JAM b;  1I6H I;  3I4N I;  4HGZ A;  1RO4 A;  1RO0 A;  1PFT A;  2Q4Z A;  4NFR A;  3CME 1;  3S17 I;  1YIJ Z;  2P28 A;  3I55 Z;  3I56 1;  3IX0 A;  5C44 I;  3CCM Z;  3CCR Z;  4X6A I;  3JAM f;  3U50 C;  4A3G I;  3J80 f;  2G2K A;  3S2H I;  4E32 A;  1Q82 2;  1RNI A;  1RQF A;  4NB9 A;  3CCJ 1;  2AKL A;  2E9H A;  3VB9 A;  1R9T I;  1JJ2 Z;  2QEX 1;  4A3D I;  1L1O C;  4E2W A;  3BG0 B;  1VQN 1;  5C4J I;  3CCQ Z;  3IF8 A;  4A3C I;  4A3K I;  1USP A;  5A2Q b;  1VQO 1;  1KRL A;  4A3E I;  2R6M A;  5D1O A;  2K5R A;  4NBF A;  3NDJ A;  1YIJ 1;  4BY1 I;  1ML8 A;  5A2Q f;  1N8R 2;  1Z01 A;  3I55 1;  3CC4 1;  1YJN Z;  4MD8 A;  1Q7Y 2;  3CCM 1;  1YUK A;  2JS4 A;  1VQL Z;  2NVQ I;  2E2H I;  1N8R 1;  2JA7 I;  3VMH A;  2LIY A;  5D1P A;  2QR1 B;  1K9M 2;  3S1M I;  1USP B;  3HOU I;  3LUS A;  1VQM 1;  1LQL A;  3M4O I;  1TWH I;  2PK7 A;  2OOX B;  2W04 A;  4CL1 A;  5D1O B;  4S1T A;  1K9M 1;  3P5J B;  3D9X A;  1S7M A;  5LL6 f;  1YHQ Z;  3CCQ 1;  4E2X A;  2OTJ Z;  1Y1W I;  3CCL Z;  3PO3 I;  1NP6 A;  3GKQ A;  1Z03 A;  3KIF A;  1VQN Z;  2QRC B;  4NBG A;  4A3B I;  3EER A;  1VQ4 Z;  2Y0S A;  2DE7 A;  2Q51 A;  1M1K 2;  3I4M I;  2H85 A;  2EGT A;  2LFU A;  1YJN 1;  5T67 A;  2J6A A;  1VQO Z;  2JA6 I;  1Q86 2;  1Z02 A;  4TNU A;  2O53 A;  1VQL 1;  4EWC A;  3J80 b;  1NUI A;  1QVG Y;  1Q81 2;  4NH1 C;  3D6W A;  2JR6 A;  4E31 A;  5FLX b;  1Q86 1;  4BY7 I;  2HU9 A;  1VQ9 1;  2F4O A;  3CC4 Z;  1DL6 A;  3HOY I;  2RBL A;  5IT9 b;  2R92 I;  1YHQ 1;  3CMA 1;  1I3Q I;  1X3Z A;  2OTJ 1;  5FLX f;  3VTN A;  1QYP A;  3G6E 1;  3CCL 1;  3EED A;  3QWU A;  1VQM Z;  4NBB A;  5IT9 f;  1Q82 1;  3GTQ I;  3VMI A;  3TDH B;  3CXC Y;  3OW2 Y;  2OZK A;  2JA8 I;  1VQ4 1;  3S15 I;  1KD1 2;  4E33 A;  1W2B Y;  3FQM A;  2GU2 A;  3CQZ I;  2V8K A;  3TE5 B;  1Y1V S;  3GTP I;  3S14 I;  2QA4 Z;  4QTU A;  2YU9 I;  2NVT I;  2GTI A;  2WB1 A;  3J81 f;  2B63 I;  3S1R I;  1YJW Z;  1KQS Y;  2JUB A;  4NBA A;  1K73 2;  2BJO A;  3VMG A;  3NH5 A;  3FQQ A;  5C4X I;  3GTK I;  3HOW I;  1K73 1;  2E2I I;  1Q7Y 1;  4RS4 A;  3S1Q I;  1WCM I;  2W03 A;  4A3L I;  1VQ9 Z;  1VQK Z;  1M90 2;  3T4N B;  1TWC I;  3NFZ A;  3J7A 4;  1TWG I;  1QF8 A;  2M48 A;  3GCF A;  3BG1 B;  4NOZ A;  2I3C A;  1WII A;  3CMA Z;  3CC7 Z;  1RLY A;  2GTH A;  2JMO A;  1M90 1;  1QVF Y;  3G6E Z;  2ZAE B;  2DE6 A;  2RPR A;  2O4H A;  2QA4 1;  1P9N A;  3S1N I;  2M6N A;  4NBD A;  4HH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...