1VQPZ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqpZ00
3CCMZ 3OW2Y 1Q7Y2 1Q822 1VQ9Z 1Q821 3CMAZ 1M901 1K8A1 3CCV1 1YIJZ 3CCM1 1S72Z 1K9M1 1VQ91 1KC81 1JJ2Z 3CC71 2OTJZ 2OTL1 1QVGY 2OTLZ 3CCEZ 1VQN1 1QVFZ 1VQ71 3G6E1 1YI2Z 1N8R2 3CCRZ 3CCSZ 1VQ5Z 3CCR1 3CCS1 1Q861 1VQOZ 1VQM1 3G4S1 3CXCY 1YJ9Z 1M902 1YJ91 1QVGZ 1KD11 3CPWZ 3CC21 1Q7Y1 3CC2Z 3CCL1 1YITZ 1YJWZ 1Q862 1VQP1 3CC41 3OW2Z 3G4SZ 1KQSY 2QA41 3I561 3CMEZ 3CCLZ 1YIT1 1M1K1 1YJW1 1YHQZ 1VQK1 1VQKZ 3CCUZ 2QA4Z 1KC82 3CCU1 1W2BZ 3CCJZ 1K9M2 1JJ2Y 3CCJ1 1VQ41 1VQ4Z 1QVFY 1YHQ1 1K732 1NJI2 3CD6Z 1NJI1 3CXCZ 3G6EZ 1YI21 1N8R1 1VQO1 1VQ6Z 1VQNZ 1M1K2 3I551 3CMA1 1VQ7Z 3I55Z 1VQ51 2OTJ1 1VQPZ 1VQMZ 1YIJ1 1VQ61 3CCE1 1S721 1VQ8Z 3G71Z 1K8A2 3CC7Z 1Q811 3CPWY 1W2BY 1KD12 1Q812 1K731 3CC4Z 2QEXZ 2QEX1 1YJNZ 3G711 1VQ81 1YJN1 3I56Z 3CME1 1VQLZ 1KQSZ 3CCQZ 1VQL1 3CCQ1 3CCVZ 3CD61
chains in the Genus database with same CATH superfamily
3CCMZ 1NP6A 1TWHI 4E2XA 3OW2Y 4E33A 1Q7Y2 3GTMI 1WW9A 3HKZA 1Q821 2RBLA 4MD9A 1M901 1K8A1 3EEDA 4NBBA 2E2HI 1VQ91 2YADA 2OZKA 2JIMA 4MXUA 4BY1I 3GTMS 2OTJZ 3GTLI 4E31A 1QF8A 3VMIA 1VQN1 2JIQA 4EWCA 1VQ71 3G6E1 1N8R2 3CCSZ 1VQ5Z 1RNIA 2W03A 4NBFA 3G4S1 2NVTI 1QVGZ 5IT9b 3NFZA 3GTKI 1QYPA 4E2YA 3CCL1 1YITZ 1YJWZ 1VQP1 2NVQI 3GKQA 3VMHA 3S2DI 4HH4A 5D1OB 3M3YI 3J81b 3CCU1 2R7ZI 3NH4A 1QVFY 5C4XI 3LUSA 1NJI2 2KI7B 1SIWA 2HF1A 3TDHB 1Y1VI 3G6EZ 1S7MA 2K3RA 2KPIA 2G2KA 2R92I 3Q87A 2VPXA 4NBCA 3HOXI 2QRCB 2OTJ1 4NBDA 3CCE1 1X0TA 4BXXI 3RZDI 2JIOA 3KIHA 1K8A2 4NFRA 3CC7Z 1W2BY 3CC4Z 2YU9I 1ML8A 1VQ81 1YJN1 3CME1 4A3FI 4A3DI 1VQL1 2VPYA 2WB1A 3GCFA 5CM2M 2OOXB 1WZNA 4MRIA 5T6BA 4DQYB 1K83I 3CQZI 2O53A 3CCQ1 2VPZA 3HOZI 1N2FA 2GTHA 3NDIA 2OOYB 2GU2A 3S1MI 1VQ9Z 2ZAEB 4NB9A 3CMAZ 3S15I 2K5RA 1YIJZ 3CC71 4A3JI 2B63I 3S1RI 3D2LA 3S2HI 2OTL1 3VMGA 3FQQA 3CCRZ 5AN9F 3CCS1 3D9XA 3CXCY 1M902 1DL6A 3CC21 1Q7Y1 3MZLB 1RLYA 1Z03A 5D1PA 3NDJA 2JMOA 1R9TI 1ZB9A 3CMEZ 1TWCI 4NH1C 2V45A 3J81f 2QA4Z 4E2WA 1JJ2Y 3CCJZ 2P3YA 1VQ41 2NVXI 3I4MI 1YHQ1 3TE5B 4RVDA 1YUKA 2GTIA 3BG0B 1X3WA 2PMZA 4MD8A 3JAMf 2PK7A 1M1K2 2JA6I 2F4MA 3CMA1 1Y1VS 1VQMZ 1YIJ1 1VQ61 2VPWA 1VQ8Z 4A93I 4NBAA 1Q811 2P28A 4NBGA 2JIRA 4Y7NI 3G711 3I56Z 1KQSZ 1LQLA 2E7ZA 3CCQZ 2DE6A 2JIPA 1I3QI 2RPRA 2WAQA 2EGTA 1VLAA 2RHBA 4MH4A 4A3II 1I6HI 3IF8A 1JWHC 2BJOA 2HU9A 4HGYA 1RO2A 3KIFA 3VB9A 3IR7A 3CCV1 1PFTA 4NB8A 3CCM1 3PO3I 1Z02A 1K9M1 1KC81 4AYBA 4A3KI 1ZH1A 3S17I 4A3CI 2OTLZ 2PM9A 2W04A 2Y0SA 3NH5A 3S1QI 1QVFZ 2VUMI 1TFIA 3CCR1 1Q861 1VQOZ 3J7A4 1VQM1 1Q16A 3HOYI 3CC2Z 2O4HA 2AKLA 2QLVB 3FKII 3J80f 3CC41 2AYDA 1FDOA 3OW2Z 1KQSY 1TWFI 3I07A 3I561 3CCLZ 1YIT1 1Y8CA 1M1K1 1YJW1 1YHQZ 2DE7A 2H85A 2R6MA 2E2JI 2JNYA 2QR1B 1KC82 1K9M2 2JA5I 3CCJ1 1YUAA 4DGLA 1VQ4Z 1Y1WI 3GTPI 3BG1B 1NJI1 4NBHA 4Y52I 5FLXb 3JAMb 1VQO1 1WJ2A 1NUIA 1FDIA 2V3VA 2F4OA 1VQNZ 4XX2A 3J80b 1Z01A 2JR6A 3M4OI 3EERA 3S1NI 3GTQI 3D6WA 1SFOI 5FLMI 5IT9f 3G71Z 4HGZA 3CPWY 1K731 1AA6A 2QEXZ 1X3ZA 2E9HA 3T4NB 4MONA 4E2ZA 3P5JB 3H3VJ 2V8KA 1L1OC 3PO3S 3CD61 4QTTA 4MD7A 1WIIA 1Q822 3PO2I 3FQMA 4CL1A 4RS4A 4X6AI 5C4JI 3GTGI 2DE5A 1S72Z 5A2Qb 1USPA 1I50I 2QKDA 2V8IA 4RV9A 2JUBA 1JJ2Z 1RQFA 2RT9A 1TWAI 2NAPA 2V8JA 2IZ3A 1QVGY 3CCEZ 1YI2Z 2E2II 1YJ9Z 1YJ91 3HOUI 1KD11 2JA7I 3CPWZ 3HOVI 4E32A 1P9NA 1Q862 3G4SZ 3U50C 4A3MI 3ESWA 2QA41 5T67A 5LL6f 2VF1A 2JA8I 2NVYI 1ZB8A 1VQK1 5C44I 1VQKZ 4A3EI 4DK1A 3CCUZ 5C3EI 2LEXA 1W2BZ 1WCMI 5IP7I 2Q4ZA 3H0GI 2I3CA 4BBRI 1RO4A 3MONA 3NH8A 2J6AA 2IV2X 3GTJI 1K732 3S16I 3CD6Z 3GTOI 3CXCZ 3HOWI 2LIYA 2Q51A 3F3FC 1YI21 1N8R1 2RIQA 1TWGI 3F3PC 3QWUA 1VQ6Z 5A2Qf 1QXFA 2JS4A 2M48A 3I551 1VQ7Z 3I55Z 1VQ51 2QRDB 1VQPZ 4QTUA 3IX0A 3K7AI 3S14I 1S721 4S1TA 1USPB 2LFUA 4RVHA 5IP9I 4E30A 1KD12 4A3GI 1Q812 5FLXf 5T64A 4BBSI 2QREB 2QEX1 1YJNZ 4BY7I 3I4NI 4RVGA 1VQLZ 3RZOI 2M6NA 4NOZA 3MZKB 2R93I 2VUGA 3VTNA 4NBEA 4A3BI 2IZ4A 4A3LI 3IFUA 5D1OA 1RO0A 4TNUA 3CCVZ 1KRLA 4RVFA
chains in the Genus database with same CATH topology
3CCMZ 1NP6A 1TWHI 4E2XA 3OW2Y 4E33A 1Q7Y2 3GTMI 1WW9A 3HKZA 1Q821 2RBLA 4MD9A 1M901 1K8A1 3EEDA 4NBBA 2E2HI 1VQ91 2YADA 2OZKA 4MXUA 4BY1I 3GTMS 2OTJZ 3GTLI 4E31A 1QF8A 3VMIA 1VQN1 4EWCA 1VQ71 3G6E1 1N8R2 3CCSZ 1VQ5Z 1RNIA 2W03A 4NBFA 3G4S1 2NVTI 1QVGZ 5IT9b 3NFZA 3GTKI 1QYPA 4E2YA 3CCL1 1YITZ 1YJWZ 1VQP1 2NVQI 3GKQA 3VMHA 3S2DI 4HH4A 5D1OB 3M3YI 3J81b 3CCU1 2R7ZI 3NH4A 1QVFY 5C4XI 3LUSA 1NJI2 2KI7B 2HF1A 3TDHB 1Y1VI 3G6EZ 1S7MA 2K3RA 2KPIA 2G2KA 2R92I 3Q87A 4NBCA 3HOXI 2QRCB 2OTJ1 4NBDA 3CCE1 1X0TA 4BXXI 3RZDI 3KIHA 1K8A2 4NFRA 3CC7Z 1W2BY 3CC4Z 2YU9I 1ML8A 1VQ81 1YJN1 3CME1 4A3FI 4A3DI 1VQL1 2WB1A 3GCFA 5CM2M 2OOXB 4MRIA 5T6BA 4DQYB 1K83I 3CQZI 2O53A 3CCQ1 3HOZI 1N2FA 2GTHA 3NDIA 2OOYB 2GU2A 3S1MI 1VQ9Z 2ZAEB 4NB9A 3CMAZ 3S15I 2K5RA 1YIJZ 3CC71 4A3JI 2B63I 3S1RI 3S2HI 2OTL1 3VMGA 3FQQA 3CCRZ 5AN9F 3CCS1 3D9XA 3CXCY 1M902 1DL6A 3CC21 1Q7Y1 3MZLB 1RLYA 1Z03A 5D1PA 3NDJA 2JMOA 1R9TI 1ZB9A 3CMEZ 1TWCI 4NH1C 3J81f 2QA4Z 4E2WA 1JJ2Y 3CCJZ 2P3YA 1VQ41 2NVXI 3I4MI 1YHQ1 3TE5B 4RVDA 1YUKA 2GTIA 3BG0B 1X3WA 2PMZA 4MD8A 3JAMf 2PK7A 1M1K2 2JA6I 2F4MA 3CMA1 1Y1VS 1VQMZ 1YIJ1 1VQ61 1VQ8Z 4A93I 4NBAA 1Q811 2P28A 4NBGA 4Y7NI 3G711 3I56Z 1KQSZ 1LQLA 3CCQZ 2DE6A 1I3QI 2RPRA 2WAQA 2EGTA 1VLAA 2RHBA 4MH4A 4A3II 1I6HI 3IF8A 1JWHC 2BJOA 2HU9A 4HGYA 1RO2A 3KIFA 3VB9A 3CCV1 1PFTA 4NB8A 3CCM1 3PO3I 1Z02A 1K9M1 1KC81 4AYBA 4A3KI 1ZH1A 3S17I 4A3CI 2OTLZ 2PM9A 2W04A 2Y0SA 3NH5A 3S1QI 1QVFZ 2VUMI 1TFIA 3CCR1 1Q861 1VQOZ 3J7A4 1VQM1 3HOYI 3CC2Z 2O4HA 2AKLA 2QLVB 3FKII 3J80f 3CC41 3OW2Z 1KQSY 1TWFI 3I07A 3I561 3CCLZ 1YIT1 1M1K1 1YJW1 1YHQZ 2DE7A 2H85A 2R6MA 2E2JI 2JNYA 2QR1B 1KC82 1K9M2 2JA5I 3CCJ1 1YUAA 4DGLA 1VQ4Z 1Y1WI 3GTPI 3BG1B 1NJI1 4NBHA 4Y52I 5FLXb 3JAMb 1VQO1 1NUIA 2F4OA 1VQNZ 4XX2A 3J80b 1Z01A 2JR6A 3M4OI 3EERA 3S1NI 3GTQI 3D6WA 1SFOI 5FLMI 5IT9f 3G71Z 4HGZA 3CPWY 1K731 2QEXZ 1X3ZA 2E9HA 3T4NB 4MONA 4E2ZA 3P5JB 3H3VJ 2V8KA 1L1OC 3PO3S 3CD61 4QTTA 4MD7A 1WIIA 1Q822 3PO2I 3FQMA 4CL1A 4RS4A 4X6AI 5C4JI 3GTGI 2DE5A 1S72Z 5A2Qb 1USPA 1I50I 2QKDA 2V8IA 4RV9A 2JUBA 1JJ2Z 1RQFA 2RT9A 1TWAI 2V8JA 2IZ3A 1QVGY 3CCEZ 1YI2Z 2E2II 1YJ9Z 1YJ91 3HOUI 1KD11 2JA7I 3CPWZ 3HOVI 4E32A 1P9NA 1Q862 3G4SZ 3U50C 4A3MI 3ESWA 2QA41 5T67A 5LL6f 2VF1A 2JA8I 2NVYI 1ZB8A 1VQK1 5C44I 1VQKZ 4A3EI 4DK1A 3CCUZ 5C3EI 1W2BZ 1WCMI 5IP7I 2Q4ZA 3H0GI 2I3CA 4BBRI 1RO4A 3MONA 3NH8A 2J6AA 3GTJI 1K732 3S16I 3CD6Z 3GTOI 3CXCZ 3HOWI 2LIYA 2Q51A 3F3FC 1YI21 1N8R1 2RIQA 1TWGI 3F3PC 3QWUA 1VQ6Z 5A2Qf 2JS4A 2M48A 3I551 1VQ7Z 3I55Z 1VQ51 2QRDB 1VQPZ 4QTUA 3IX0A 3K7AI 3S14I 1S721 4S1TA 1USPB 2LFUA 4RVHA 5IP9I 4E30A 1KD12 4A3GI 1Q812 5FLXf 5T64A 4BBSI 2QREB 2QEX1 1YJNZ 4BY7I 3I4NI 4RVGA 1VQLZ 3RZOI 2M6NA 4NOZA 3MZKB 2R93I 2VUGA 3VTNA 4NBEA 4A3BI 2IZ4A 4A3LI 3IFUA 5D1OA 1RO0A 4TNUA 3CCVZ 1KRLA 4RVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM Z;  3OW2 Y;  1Q7Y 2;  1Q82 2;  1VQ9 Z;  1Q82 1;  3CMA Z;  1M90 1;  1K8A 1;  3CCV 1;  1YIJ Z;  3CCM 1;  1S72 Z;  1K9M 1;  1VQ9 1;  1KC8 1;  1JJ2 Z;  3CC7 1;  2OTJ Z;  2OTL 1;  1QVG Y;  2OTL Z;  3CCE Z;  1VQN 1;  1QVF Z;  1VQ7 1;  3G6E 1;  1YI2 Z;  1N8R 2;  3CCR Z;  3CCS Z;  1VQ5 Z;  3CCR 1;  3CCS 1;  1Q86 1;  1VQO Z;  1VQM 1;  3G4S 1;  3CXC Y;  1YJ9 Z;  1M90 2;  1YJ9 1;  1QVG Z;  1KD1 1;  3CPW Z;  3CC2 1;  1Q7Y 1;  3CC2 Z;  3CCL 1;  1YIT Z;  1YJW Z;  1Q86 2;  1VQP 1;  3CC4 1;  3OW2 Z;  3G4S Z;  1KQS Y;  2QA4 1;  3I56 1;  3CME Z;  3CCL Z;  1YIT 1;  1M1K 1;  1YJW 1;  1YHQ Z;  1VQK 1;  1VQK Z;  3CCU Z;  2QA4 Z;  1KC8 2;  3CCU 1;  1W2B Z;  3CCJ Z;  1K9M 2;  1JJ2 Y;  3CCJ 1;  1VQ4 1;  1VQ4 Z;  1QVF Y;  1YHQ 1;  1K73 2;  1NJI 2;  3CD6 Z;  1NJI 1;  3CXC Z;  3G6E Z;  1YI2 1;  1N8R 1;  1VQO 1;  1VQ6 Z;  1VQN Z;  1M1K 2;  3I55 1;  3CMA 1;  1VQ7 Z;  3I55 Z;  1VQ5 1;  2OTJ 1;  1VQP Z;  1VQM Z;  1YIJ 1;  1VQ6 1;  3CCE 1;  1S72 1;  1VQ8 Z;  3G71 Z;  1K8A 2;  3CC7 Z;  1Q81 1;  3CPW Y;  1W2B Y;  1KD1 2;  1Q81 2;  1K73 1;  3CC4 Z;  2QEX Z;  2QEX 1;  1YJN Z;  3G71 1;  1VQ8 1;  1YJN 1;  3I56 Z;  3CME 1;  1VQL Z;  1KQS Z;  3CCQ Z;  1VQL 1;  3CCQ 1;  3CCV Z;  3CD6 1; 
#chains in the Genus database with same CATH topology
 3CCM Z;  1NP6 A;  1TWH I;  4E2X A;  3OW2 Y;  4E33 A;  1Q7Y 2;  3GTM I;  1WW9 A;  3HKZ A;  1Q82 1;  2RBL A;  4MD9 A;  1M90 1;  1K8A 1;  3EED A;  4NBB A;  2E2H I;  1VQ9 1;  2YAD A;  2OZK A;  2JIM A;  4MXU A;  4BY1 I;  3GTM S;  2OTJ Z;  3GTL I;  4E31 A;  1QF8 A;  3VMI A;  1VQN 1;  2JIQ A;  4EWC A;  1VQ7 1;  3G6E 1;  1N8R 2;  3CCS Z;  1VQ5 Z;  1RNI A;  2W03 A;  4NBF A;  3G4S 1;  2NVT I;  1QVG Z;  5IT9 b;  3NFZ A;  3GTK I;  1QYP A;  4E2Y A;  3CCL 1;  1YIT Z;  1YJW Z;  1VQP 1;  2NVQ I;  3GKQ A;  3VMH A;  3S2D I;  4HH4 A;  5D1O B;  3M3Y I;  3J81 b;  3CCU 1;  2R7Z I;  3NH4 A;  1QVF Y;  5C4X I;  3LUS A;  1NJI 2;  2KI7 B;  1SIW A;  2HF1 A;  3TDH B;  1Y1V I;  3G6E Z;  1S7M A;  2K3R A;  2KPI A;  2G2K A;  2R92 I;  3Q87 A;  2VPX A;  4NBC A;  3HOX I;  2QRC B;  2OTJ 1;  4NBD A;  3CCE 1;  1X0T A;  4BXX I;  3RZD I;  2JIO A;  3KIH A;  1K8A 2;  4NFR A;  3CC7 Z;  1W2B Y;  3CC4 Z;  2YU9 I;  1ML8 A;  1VQ8 1;  1YJN 1;  3CME 1;  4A3F I;  4A3D I;  1VQL 1;  2VPY A;  2WB1 A;  3GCF A;  5CM2 M;  2OOX B;  1WZN A;  4MRI A;  5T6B A;  4DQY B;  1K83 I;  3CQZ I;  2O53 A;  3CCQ 1;  2VPZ A;  3HOZ I;  1N2F A;  2GTH A;  3NDI A;  2OOY B;  2GU2 A;  3S1M I;  1VQ9 Z;  2ZAE B;  4NB9 A;  3CMA Z;  3S15 I;  2K5R A;  1YIJ Z;  3CC7 1;  4A3J I;  2B63 I;  3S1R I;  3D2L A;  3S2H I;  2OTL 1;  3VMG A;  3FQQ A;  3CCR Z;  5AN9 F;  3CCS 1;  3D9X A;  3CXC Y;  1M90 2;  1DL6 A;  3CC2 1;  1Q7Y 1;  3MZL B;  1RLY A;  1Z03 A;  5D1P A;  3NDJ A;  2JMO A;  1R9T I;  1ZB9 A;  3CME Z;  1TWC I;  4NH1 C;  2V45 A;  3J81 f;  2QA4 Z;  4E2W A;  1JJ2 Y;  3CCJ Z;  2P3Y A;  1VQ4 1;  2NVX I;  3I4M I;  1YHQ 1;  3TE5 B;  4RVD A;  1YUK A;  2GTI A;  3BG0 B;  1X3W A;  2PMZ A;  4MD8 A;  3JAM f;  2PK7 A;  1M1K 2;  2JA6 I;  2F4M A;  3CMA 1;  1Y1V S;  1VQM Z;  1YIJ 1;  1VQ6 1;  2VPW A;  1VQ8 Z;  4A93 I;  4NBA A;  1Q81 1;  2P28 A;  4NBG A;  2JIR A;  4Y7N I;  3G71 1;  3I56 Z;  1KQS Z;  1LQL A;  2E7Z A;  3CCQ Z;  2DE6 A;  2JIP A;  1I3Q I;  2RPR A;  2WAQ A;  2EGT A;  1VLA A;  2RHB A;  4MH4 A;  4A3I I;  1I6H I;  3IF8 A;  1JWH C;  2BJO A;  2HU9 A;  4HGY A;  1RO2 A;  3KIF A;  3VB9 A;  3IR7 A;  3CCV 1;  1PFT A;  4NB8 A;  3CCM 1;  3PO3 I;  1Z02 A;  1K9M 1;  1KC8 1;  4AYB A;  4A3K I;  1ZH1 A;  3S17 I;  4A3C I;  2OTL Z;  2PM9 A;  2W04 A;  2Y0S A;  3NH5 A;  3S1Q I;  1QVF Z;  2VUM I;  1TFI A;  3CCR 1;  1Q86 1;  1VQO Z;  3J7A 4;  1VQM 1;  1Q16 A;  3HOY I;  3CC2 Z;  2O4H A;  2AKL A;  2QLV B;  3FKI I;  3J80 f;  3CC4 1;  2AYD A;  1FDO A;  3OW2 Z;  1KQS Y;  1TWF I;  3I07 A;  3I56 1;  3CCL Z;  1YIT 1;  1Y8C A;  1M1K 1;  1YJW 1;  1YHQ Z;  2DE7 A;  2H85 A;  2R6M A;  2E2J I;  2JNY A;  2QR1 B;  1KC8 2;  1K9M 2;  2JA5 I;  3CCJ 1;  1YUA A;  4DGL A;  1VQ4 Z;  1Y1W I;  3GTP I;  3BG1 B;  1NJI 1;  4NBH A;  4Y52 I;  5FLX b;  3JAM b;  1VQO 1;  1WJ2 A;  1NUI A;  1FDI A;  2V3V A;  2F4O A;  1VQN Z;  4XX2 A;  3J80 b;  1Z01 A;  2JR6 A;  3M4O I;  3EER A;  3S1N I;  3GTQ I;  3D6W A;  1SFO I;  5FLM I;  5IT9 f;  3G71 Z;  4HGZ A;  3CPW Y;  1K73 1;  1AA6 A;  2QEX Z;  1X3Z A;  2E9H A;  3T4N B;  4MON A;  4E2Z A;  3P5J B;  3H3V J;  2V8K A;  1L1O C;  3PO3 S;  3CD6 1;  4QTT A;  4MD7 A;  1WII A;  1Q82 2;  3PO2 I;  3FQM A;  4CL1 A;  4RS4 A;  4X6A I;  5C4J I;  3GTG I;  2DE5 A;  1S72 Z;  5A2Q b;  1USP A;  1I50 I;  2QKD A;  2V8I A;  4RV9 A;  2JUB A;  1JJ2 Z;  1RQF A;  2RT9 A;  1TWA I;  2NAP A;  2V8J A;  2IZ3 A;  1QVG Y;  3CCE Z;  1YI2 Z;  2E2I I;  1YJ9 Z;  1YJ9 1;  3HOU I;  1KD1 1;  2JA7 I;  3CPW Z;  3HOV I;  4E32 A;  1P9N A;  1Q86 2;  3G4S Z;  3U50 C;  4A3M I;  3ESW A;  2QA4 1;  5T67 A;  5LL6 f;  2VF1 A;  2JA8 I;  2NVY I;  1ZB8 A;  1VQK 1;  5C44 I;  1VQK Z;  4A3E I;  4DK1 A;  3CCU Z;  5C3E I;  2LEX A;  1W2B Z;  1WCM I;  5IP7 I;  2Q4Z A;  3H0G I;  2I3C A;  4BBR I;  1RO4 A;  3MON A;  3NH8 A;  2J6A A;  2IV2 X;  3GTJ I;  1K73 2;  3S16 I;  3CD6 Z;  3GTO I;  3CXC Z;  3HOW I;  2LIY A;  2Q51 A;  3F3F C;  1YI2 1;  1N8R 1;  2RIQ A;  1TWG I;  3F3P C;  3QWU A;  1VQ6 Z;  5A2Q f;  1QXF A;  2JS4 A;  2M48 A;  3I55 1;  1VQ7 Z;  3I55 Z;  1VQ5 1;  2QRD B;  1VQP Z;  4QTU A;  3IX0 A;  3K7A I;  3S14 I;  1S72 1;  4S1T A;  1USP B;  2LFU A;  4RVH A;  5IP9 I;  4E30 A;  1KD1 2;  4A3G I;  1Q81 2;  5FLX f;  5T64 A;  4BBS I;  2QRE B;  2QEX 1;  1YJN Z;  4BY7 I;  3I4N I;  4RVG A;  1VQL Z;  3RZO I;  2M6N A;  4NOZ A;  3MZK B;  2R93 I;  2VUG A;  3VTN A;  4NBE A;  4A3B I;  2IZ4 A;  4A3L I;  3IFU A;  5D1O A;  1RO0 A;  4TNU A;  3CCV Z;  1KRL A;  4RVF A; 
#chains in the Genus database with same CATH homology
 3CCM Z;  1NP6 A;  1TWH I;  4E2X A;  3OW2 Y;  4E33 A;  1Q7Y 2;  3GTM I;  1WW9 A;  3HKZ A;  1Q82 1;  2RBL A;  4MD9 A;  1M90 1;  1K8A 1;  3EED A;  4NBB A;  2E2H I;  1VQ9 1;  2YAD A;  2OZK A;  4MXU A;  4BY1 I;  3GTM S;  2OTJ Z;  3GTL I;  4E31 A;  1QF8 A;  3VMI A;  1VQN 1;  4EWC A;  1VQ7 1;  3G6E 1;  1N8R 2;  3CCS Z;  1VQ5 Z;  1RNI A;  2W03 A;  4NBF A;  3G4S 1;  2NVT I;  1QVG Z;  5IT9 b;  3NFZ A;  3GTK I;  1QYP A;  4E2Y A;  3CCL 1;  1YIT Z;  1YJW Z;  1VQP 1;  2NVQ I;  3GKQ A;  3VMH A;  3S2D I;  4HH4 A;  5D1O B;  3M3Y I;  3J81 b;  3CCU 1;  2R7Z I;  3NH4 A;  1QVF Y;  5C4X I;  3LUS A;  1NJI 2;  2KI7 B;  2HF1 A;  3TDH B;  1Y1V I;  3G6E Z;  1S7M A;  2K3R A;  2KPI A;  2G2K A;  2R92 I;  3Q87 A;  4NBC A;  3HOX I;  2QRC B;  2OTJ 1;  4NBD A;  3CCE 1;  1X0T A;  4BXX I;  3RZD I;  3KIH A;  1K8A 2;  4NFR A;  3CC7 Z;  1W2B Y;  3CC4 Z;  2YU9 I;  1ML8 A;  1VQ8 1;  1YJN 1;  3CME 1;  4A3F I;  4A3D I;  1VQL 1;  2WB1 A;  3GCF A;  5CM2 M;  2OOX B;  4MRI A;  5T6B A;  4DQY B;  1K83 I;  3CQZ I;  2O53 A;  3CCQ 1;  3HOZ I;  1N2F A;  2GTH A;  3NDI A;  2OOY B;  2GU2 A;  3S1M I;  1VQ9 Z;  2ZAE B;  4NB9 A;  3CMA Z;  3S15 I;  2K5R A;  1YIJ Z;  3CC7 1;  4A3J I;  2B63 I;  3S1R I;  3S2H I;  2OTL 1;  3VMG A;  3FQQ A;  3CCR Z;  5AN9 F;  3CCS 1;  3D9X A;  3CXC Y;  1M90 2;  1DL6 A;  3CC2 1;  1Q7Y 1;  3MZL B;  1RLY A;  1Z03 A;  5D1P A;  3NDJ A;  2JMO A;  1R9T I;  1ZB9 A;  3CME Z;  1TWC I;  4NH1 C;  3J81 f;  2QA4 Z;  4E2W A;  1JJ2 Y;  3CCJ Z;  2P3Y A;  1VQ4 1;  2NVX I;  3I4M I;  1YHQ 1;  3TE5 B;  4RVD A;  1YUK A;  2GTI A;  3BG0 B;  1X3W A;  2PMZ A;  4MD8 A;  3JAM f;  2PK7 A;  1M1K 2;  2JA6 I;  2F4M A;  3CMA 1;  1Y1V S;  1VQM Z;  1YIJ 1;  1VQ6 1;  1VQ8 Z;  4A93 I;  4NBA A;  1Q81 1;  2P28 A;  4NBG A;  4Y7N I;  3G71 1;  3I56 Z;  1KQS Z;  1LQL A;  3CCQ Z;  2DE6 A;  1I3Q I;  2RPR A;  2WAQ A;  2EGT A;  1VLA A;  2RHB A;  4MH4 A;  4A3I I;  1I6H I;  3IF8 A;  1JWH C;  2BJO A;  2HU9 A;  4HGY A;  1RO2 A;  3KIF A;  3VB9 A;  3CCV 1;  1PFT A;  4NB8 A;  3CCM 1;  3PO3 I;  1Z02 A;  1K9M 1;  1KC8 1;  4AYB A;  4A3K I;  1ZH1 A;  3S17 I;  4A3C I;  2OTL Z;  2PM9 A;  2W04 A;  2Y0S A;  3NH5 A;  3S1Q I;  1QVF Z;  2VUM I;  1TFI A;  3CCR 1;  1Q86 1;  1VQO Z;  3J7A 4;  1VQM 1;  3HOY I;  3CC2 Z;  2O4H A;  2AKL A;  2QLV B;  3FKI I;  3J80 f;  3CC4 1;  3OW2 Z;  1KQS Y;  1TWF I;  3I07 A;  3I56 1;  3CCL Z;  1YIT 1;  1M1K 1;  1YJW 1;  1YHQ Z;  2DE7 A;  2H85 A;  2R6M A;  2E2J I;  2JNY A;  2QR1 B;  1KC8 2;  1K9M 2;  2JA5 I;  3CCJ 1;  1YUA A;  4DGL A;  1VQ4 Z;  1Y1W I;  3GTP I;  3BG1 B;  1NJI 1;  4NBH A;  4Y52 I;  5FLX b;  3JAM b;  1VQO 1;  1NUI A;  2F4O A;  1VQN Z;  4XX2 A;  3J80 b;  1Z01 A;  2JR6 A;  3M4O I;  3EER A;  3S1N I;  3GTQ I;  3D6W A;  1SFO I;  5FLM I;  5IT9 f;  3G71 Z;  4HGZ A;  3CPW Y;  1K73 1;  2QEX Z;  1X3Z A;  2E9H A;  3T4N B;  4MON A;  4E2Z A;  3P5J B;  3H3V J;  2V8K A;  1L1O C;  3PO3 S;  3CD6 1;  4QTT A;  4MD7 A;  1WII A;  1Q82 2;  3PO2 I;  3FQM A;  4CL1 A;  4RS4 A;  4X6A I;  5C4J I;  3GTG I;  2DE5 A;  1S72 Z;  5A2Q b;  1USP A;  1I50 I;  2QKD A;  2V8I A;  4RV9 A;  2JUB A;  1JJ2 Z;  1RQF A;  2RT9 A;  1TWA I;  2V8J A;  2IZ3 A;  1QVG Y;  3CCE Z;  1YI2 Z;  2E2I I;  1YJ9 Z;  1YJ9 1;  3HOU I;  1KD1 1;  2JA7 I;  3CPW Z;  3HOV I;  4E32 A;  1P9N A;  1Q86 2;  3G4S Z;  3U50 C;  4A3M I;  3ESW A;  2QA4 1;  5T67 A;  5LL6 f;  2VF1 A;  2JA8 I;  2NVY I;  1ZB8 A;  1VQK 1;  5C44 I;  1VQK Z;  4A3E I;  4DK1 A;  3CCU Z;  5C3E I;  1W2B Z;  1WCM I;  5IP7 I;  2Q4Z A;  3H0G I;  2I3C A;  4BBR I;  1RO4 A;  3MON A;  3NH8 A;  2J6A A;  3GTJ I;  1K73 2;  3S16 I;  3CD6 Z;  3GTO I;  3CXC Z;  3HOW I;  2LIY A;  2Q51 A;  3F3F C;  1YI2 1;  1N8R 1;  2RIQ A;  1TWG I;  3F3P C;  3QWU A;  1VQ6 Z;  5A2Q f;  2JS4 A;  2M48 A;  3I55 1;  1VQ7 Z;  3I55 Z;  1VQ5 1;  2QRD B;  1VQP Z;  4QTU A;  3IX0 A;  3K7A I;  3S14 I;  1S72 1;  4S1T A;  1USP B;  2LFU A;  4RVH A;  5IP9 I;  4E30 A;  1KD1 2;  4A3G I;  1Q81 2;  5FLX f;  5T64 A;  4BBS I;  2QRE B;  2QEX 1;  1YJN Z;  4BY7 I;  3I4N I;  4RVG A;  1VQL Z;  3RZO I;  2M6N A;  4NOZ A;  3MZK B;  2R93 I;  2VUG A;  3VTN A;  4NBE A;  4A3B I;  2IZ4 A;  4A3L I;  3IFU A;  5D1O A;  1RO0 A;  4TNU A;  3CCV Z;  1KRL A;  4RVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...