3S1RI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1rI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1rI02
1TWHI 2NVQI 1USPB 5CM2M 3GTMI 3RZOI 4A93I 1X3WA 4NBBA 1ML8A 2P3YA 1TFIA 1YUAA 3S14I 4NBHA 1RLYA 3GTPI 2R92I 1Y1VS 4NBEA 3GCFA 1LQLA 2HF1A 1DL6A 3GTGI 1Y1VI 1VLAA 5C44I 2JS4A 3GKQA 3EERA 4NOZA 4A3EI 2AKLA 1TWAI 3I07A 1L1OC 2DE7A 4NBFA 4BY1I 3ESWA 3HOXI 1RO4A 2E2JI 5IP9I 2JR6A 3S1MI 1I6HI 1WW9A 2E2II 3LUSA 1SFOI 3S1QI 3HOZI 1I50I 1NUIA 5FLMI 3GTJI 3D6WA 4A3JI 4A3GI 2J6AA 3VMGA 3VB9A 3S1RI 3HOUI 3I4NI 1QYPA 2VUMI 3FKII 5C4XI 4QTUA 4X6AI 3Q87A 2KPIA 1X3ZA 2B63I 1N2FA 3VMIA 2YU9I 4NB8A 4BBRI 3HOWI 4A3LI 1I3QI 2DE5A 2JA7I 3PO2I 3HOVI 4NB9A 4A3FI 2F4MA 3S17I 4NBAA 2NVYI 1TWFI 4A3MI 2NVXI 4MH4A 2BJOA 4BBSI 1K83I 4A3KI 2RBLA 4BY7I 4NBGA 3K7AI 5C4JI 3U50C 2JA6I 4Y7NI 4A3CI 3GTOI 1TWCI 4BXXI 3GTQI 3HOYI 2F4OA 3VMHA 3I4MI 1ZB9A 5IP7I 5C3EI 2R7ZI 3CQZI 3M3YI 2JA5I 1Y1WI 4XX2A 1PFTA 4NBDA 2E2HI 3H3VJ 4A3II 2JNYA 3RZDI 1USPA 2NVTI 3S1NI 4A3DI 3PO3S 4QTTA 1ZB8A 3GTKI 3S2DI 4NBCA 1TWGI 2K5RA 1R9TI 2JA8I 3PO3I 3GTLI 4A3BI 2R93I 3H0GI 2DE6A 3S16I 3S2HI 4Y52I 1WCMI 3M4OI 3S15I 2PK7A 3GTMS
chains in the Genus database with same CATH superfamily
1TWHI 1RO0A 2RPRA 5CM2M 3RZOI 4A93I 2GTHA 4E32A 4RV9A 5LL6f 3CXCY 1ML8A 1QVGY 3MZKB 4E33A 1DL6A 4NH1C 1K9M1 4DGLA 1Y8CA 4A3EI 1K732 3HOXI 1YIJZ 3NDIA 1KD12 3QWUA 2GU2A 2AYDA 2IZ3A 5FLMI 5FLXb 1JWHC 3D6WA 1Q861 4A3JI 4A3GI 2Q4ZA 1M901 2I3CA 2QREB 1RQFA 2R6MA 3S1RI 3HOUI 3MONA 1YI21 1QYPA 1JJ2Y 2VUMI 3BG1B 3FKII 4QTUA 1VQ81 1M1K2 3F3PC 1X3ZA 1S72Z 2B63I 2YU9I 4BBRI 3HOWI 2G2KA 2OZKA 1KRLA 5T64A 3HOVI 4MD9A 1YJ9Z 2F4MA 3S17I 2WAQA 4E30A 4A3MI 1JJ2Z 3G6EZ 1S7MA 3K7AI 4TNUA 3G71Z 3NH4A 1QVFY 3NFZA 4MD7A 3VMHA 4NFRA 2JUBA 5IP7I 1ZH1A 3I551 3CCSZ 1Y1WI 1PFTA 1SIWA 3NDJA 1K8A1 2JNYA 3RZDI 4DQYB 3S2DI 4A3BI 2VF1A 2R93I 3S16I 2DE6A 2OTL1 2GTIA 2PK7A 3HKZA 2OOXB 3FQMA 1YUKA 3KIFA 4DK1A 3CCJZ 1X3WA 2P3YA 3S14I 3GTPI 4E31A 4NBEA 1LQLA 4E2XA 1N8R2 1VLAA 3J80b 2O4HA 2V8IA 3CC2Z 3CCL1 4NOZA 1YI2Z 3CMEZ 4MONA 1TWAI 1NP6A 1Z02A 3I07A 3CCM1 3CCS1 2DE7A 2VPWA 1VQ8Z 5IP9I 3NH5A 1YJW1 1VQMZ 1Q16A 4HGZA 3S1QI 3HOZI 2W04A 1W2BZ 1Z01A 3VMGA 1FDIA 3TE5B 1Q811 3Q87A 2KPIA 3P5JB 3CCVZ 1Q7Y1 2E9HA 2LEXA 3VMIA 2VPYA 2O53A 1Q862 3CCJ1 4A3LI 2Q51A 5D1OA 3J80f 2V45A 3I55Z 2IV2X 1P9NA 4NB9A 2NVYI 3CCQZ 3CPWZ 1QXFA 1K83I 3CC21 4BY7I 2QRCB 1KQSZ 5C4JI 3CME1 4A3CI 4Y7NI 3NH8A 2PMZA 3GTQI 2F4OA 1VQM1 4E2YA 2OTLZ 2RT9A 4XX2A 4NBDA 5A2Qb 4A3II 3J81b 1YITZ 4A3DI 3GTKI 4RVGA 4NBCA 3CCV1 2JA8I 3GTLI 2QLVB 4HH4A 1KC81 3H0GI 3FQQA 3CCEZ 4RS4A 5FLXf 5D1OB 3M4OI 3S15I 3TDHB 3CCLZ 2WB1A 1WZNA 3GTMS 5D1PA 2NVQI 1USPB 2M6NA 3CCMZ 1WJ2A 3GTMI 2P28A 3F3FC 4RVDA 3CCQ1 4NBBA 1YJWZ 2Y0SA 1TFIA 1RLYA 2QRDB 2JIMA 2HF1A 3GTGI 4MRIA 2IZ4A 1YHQ1 2PM9A 5C44I 2QEX1 2JS4A 3EERA 5A2Qf 3JAMb 3J81f 2AKLA 1VQL1 4NBFA 3ESWA 1RO4A 3S1MI 2JR6A 2RIQA 2QA41 1I6HI 3IR7A 3CMA1 1YIT1 1YJN1 1I50I 1VQKZ 1NUIA 1X0TA 4EWCA 3I56Z 3VB9A 1QF8A 3I4NI 2V8KA 3CCE1 1W2BY 3CD61 3T4NB 5C4XI 4X6AI 3CCU1 1N2FA 2VUGA 1FDOA 4NB8A 2OTJ1 1VQ51 4MXUA 1I3QI 2DE5A 4RVFA 2V8JA 4RVHA 2JA7I 4E2ZA 1VQ41 1K9M2 3VTNA 3JAMf 1Q812 4A3FI 2JIPA 4NBAA 2JIQA 1Q7Y2 4MH4A 1NJI1 5AN9F 2RBLA 1VQPZ 4NBGA 2YADA 3CPWY 1VQOZ 4S1TA 3GTOI 4BXXI 3CC41 3HOYI 2QKDA 1KQSY 1Z03A 1VQ91 5T6BA 2R7ZI 3CQZI 3M3YI 2JA5I 2OOYB 1M902 1VQK1 1Q821 2HU9A 3I561 2KI7B 3H3VJ 3OW2Z 2V3VA 1USPA 1AA6A 3CC7Z 3IX0A 1ZB8A 2JMOA 1VQ61 1TWGI 2E7ZA 2K5RA 1WIIA 3S2HI 4Y52I 1WCMI 1YHQZ 2VPXA 2RHBA 2QEXZ 3CXCZ 1QVGZ 1VQLZ 1RNIA 4MD8A 1K731 2QA4Z 3CMAZ 1YUAA 1VQP1 3D2LA 4NBHA 1KC82 1KD11 2R92I 1Y1VS 2LFUA 3GCFA 1YJNZ 1VQO1 1Y1VI 3CCR1 2M48A 3KIHA 3GKQA 1L1OC 3CD6Z 4BY1I 1K8A2 2E2JI 3CCUZ 1WW9A 2E2II 1VQNZ 2QR1B 3LUSA 1SFOI 1M1K1 5IT9b 2OTJZ 1VQ5Z 3G4SZ 3IFUA 3GTJI 3CC71 3EEDA 3MZLB 2J6AA 1VQ4Z 2EGTA 4HGYA 1YIJ1 2VPZA 3CC4Z 2JIOA 3J7A4 2W03A 1VQ9Z 1VQ7Z 3PO2I 2K3RA 3IF8A 2ZAEB 2NVXI 1TWFI 4BBSI 2BJOA 4A3KI 1QVFZ 1S721 3U50C 5IT9f 2JA6I 2H85A 1TWCI 1VQ6Z 3I4MI 1ZB9A 1VQN1 5C3EI 1YJ91 1NJI2 3G4S1 2NAPA 3G6E1 2JIRA 4AYBA 2LIYA 3D9XA 3G711 2NVTI 3S1NI 3BG0B 3PO3S 4QTTA 3OW2Y 4CL1A 1R9TI 3PO3I 4E2WA 1Q822 5T67A 3CCRZ 1N8R1 1RO2A 2E2HI 1VQ71
chains in the Genus database with same CATH topology
1TWHI 1RO0A 2RPRA 5CM2M 3RZOI 4A93I 2GTHA 4E32A 4RV9A 5LL6f 3CXCY 1ML8A 1QVGY 3MZKB 4E33A 1DL6A 4NH1C 1K9M1 4DGLA 4A3EI 1K732 3HOXI 1YIJZ 3NDIA 1KD12 3QWUA 2GU2A 2IZ3A 5FLMI 5FLXb 1JWHC 3D6WA 1Q861 4A3JI 4A3GI 2Q4ZA 1M901 2I3CA 2QREB 1RQFA 2R6MA 3S1RI 3HOUI 3MONA 1YI21 1QYPA 1JJ2Y 2VUMI 3BG1B 3FKII 4QTUA 1VQ81 1M1K2 3F3PC 1X3ZA 1S72Z 2B63I 2YU9I 4BBRI 3HOWI 2G2KA 2OZKA 1KRLA 5T64A 3HOVI 4MD9A 1YJ9Z 2F4MA 3S17I 2WAQA 4E30A 4A3MI 1JJ2Z 3G6EZ 1S7MA 3K7AI 4TNUA 3G71Z 3NH4A 1QVFY 3NFZA 4MD7A 3VMHA 4NFRA 2JUBA 5IP7I 1ZH1A 3I551 3CCSZ 1Y1WI 1PFTA 3NDJA 1K8A1 2JNYA 3RZDI 4DQYB 3S2DI 4A3BI 2VF1A 2R93I 3S16I 2DE6A 2OTL1 2GTIA 2PK7A 3HKZA 2OOXB 3FQMA 1YUKA 3KIFA 4DK1A 3CCJZ 1X3WA 2P3YA 3S14I 3GTPI 4E31A 4NBEA 1LQLA 4E2XA 1N8R2 1VLAA 3J80b 2O4HA 2V8IA 3CC2Z 3CCL1 4NOZA 1YI2Z 3CMEZ 4MONA 1TWAI 1NP6A 1Z02A 3I07A 3CCM1 3CCS1 2DE7A 1VQ8Z 5IP9I 3NH5A 1YJW1 1VQMZ 3S1QI 4HGZA 3HOZI 2W04A 1W2BZ 1Z01A 3VMGA 3TE5B 1Q811 3Q87A 2KPIA 3P5JB 3CCVZ 1Q7Y1 2E9HA 3VMIA 2O53A 1Q862 3CCJ1 4A3LI 2Q51A 5D1OA 3J80f 3I55Z 1P9NA 4NB9A 2NVYI 3CCQZ 3CPWZ 1K83I 3CC21 4BY7I 2QRCB 1KQSZ 5C4JI 3CME1 4A3CI 4Y7NI 3NH8A 2PMZA 3GTQI 2F4OA 1VQM1 4E2YA 2OTLZ 2RT9A 4XX2A 4NBDA 5A2Qb 4A3II 3J81b 1YITZ 4A3DI 3GTKI 4RVGA 4NBCA 3CCV1 2JA8I 3GTLI 2QLVB 4HH4A 1KC81 3H0GI 3FQQA 3CCEZ 4RS4A 5FLXf 5D1OB 3M4OI 3S15I 3TDHB 3CCLZ 2WB1A 3GTMS 5D1PA 2NVQI 1USPB 2M6NA 3CCMZ 3GTMI 2P28A 3F3FC 4RVDA 3CCQ1 4NBBA 1YJWZ 2Y0SA 1TFIA 1RLYA 2QRDB 2HF1A 3GTGI 4MRIA 2IZ4A 1YHQ1 2PM9A 5C44I 2QEX1 2JS4A 3EERA 5A2Qf 3JAMb 3J81f 2AKLA 1VQL1 4NBFA 3ESWA 1RO4A 3S1MI 2JR6A 2RIQA 2QA41 1I6HI 3CMA1 1YIT1 1YJN1 1I50I 1VQKZ 1NUIA 1X0TA 4EWCA 3I56Z 3VB9A 1QF8A 3I4NI 2V8KA 3CCE1 1W2BY 3CD61 3T4NB 5C4XI 4X6AI 3CCU1 1N2FA 2VUGA 4NB8A 2OTJ1 1VQ51 4MXUA 1I3QI 2DE5A 4RVFA 2V8JA 4RVHA 2JA7I 4E2ZA 1VQ41 1K9M2 3VTNA 3JAMf 1Q812 4A3FI 4NBAA 1Q7Y2 4MH4A 1NJI1 5AN9F 2RBLA 1VQPZ 4NBGA 2YADA 3CPWY 1VQOZ 4S1TA 3GTOI 4BXXI 3CC41 3HOYI 2QKDA 1KQSY 1Z03A 1VQ91 5T6BA 2R7ZI 3CQZI 3M3YI 2JA5I 2OOYB 1M902 1VQK1 1Q821 2HU9A 3I561 2KI7B 3H3VJ 3OW2Z 1USPA 3CC7Z 3IX0A 1ZB8A 2JMOA 1VQ61 1TWGI 2K5RA 1WIIA 3S2HI 4Y52I 1WCMI 1YHQZ 2RHBA 2QEXZ 3CXCZ 1QVGZ 1VQLZ 1RNIA 4MD8A 1K731 2QA4Z 3CMAZ 1YUAA 1VQP1 4NBHA 1KC82 1KD11 2R92I 1Y1VS 2LFUA 3GCFA 1YJNZ 1VQO1 1Y1VI 3CCR1 2M48A 3KIHA 3GKQA 1L1OC 3CD6Z 4BY1I 1K8A2 2E2JI 3CCUZ 1WW9A 2E2II 1VQNZ 2QR1B 3LUSA 1SFOI 1M1K1 5IT9b 2OTJZ 1VQ5Z 3G4SZ 3IFUA 3GTJI 3CC71 3EEDA 3MZLB 2J6AA 1VQ4Z 2EGTA 4HGYA 1YIJ1 3CC4Z 3J7A4 2W03A 1VQ9Z 1VQ7Z 3PO2I 2K3RA 3IF8A 2ZAEB 2NVXI 1TWFI 4BBSI 2BJOA 4A3KI 1QVFZ 1S721 3U50C 5IT9f 2JA6I 2H85A 1TWCI 1VQ6Z 3I4MI 1ZB9A 1VQN1 5C3EI 1YJ91 1NJI2 3G4S1 3G6E1 4AYBA 2LIYA 3D9XA 3G711 2NVTI 3S1NI 3BG0B 3PO3S 4QTTA 3OW2Y 4CL1A 1R9TI 3PO3I 4E2WA 1Q822 5T67A 3CCRZ 1N8R1 1RO2A 2E2HI 1VQ71
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH I;  2NVQ I;  1USP B;  5CM2 M;  3GTM I;  3RZO I;  4A93 I;  1X3W A;  4NBB A;  1ML8 A;  2P3Y A;  1TFI A;  1YUA A;  3S14 I;  4NBH A;  1RLY A;  3GTP I;  2R92 I;  1Y1V S;  4NBE A;  3GCF A;  1LQL A;  2HF1 A;  1DL6 A;  3GTG I;  1Y1V I;  1VLA A;  5C44 I;  2JS4 A;  3GKQ A;  3EER A;  4NOZ A;  4A3E I;  2AKL A;  1TWA I;  3I07 A;  1L1O C;  2DE7 A;  4NBF A;  4BY1 I;  3ESW A;  3HOX I;  1RO4 A;  2E2J I;  5IP9 I;  2JR6 A;  3S1M I;  1I6H I;  1WW9 A;  2E2I I;  3LUS A;  1SFO I;  3S1Q I;  3HOZ I;  1I50 I;  1NUI A;  5FLM I;  3GTJ I;  3D6W A;  4A3J I;  4A3G I;  2J6A A;  3VMG A;  3VB9 A;  3S1R I;  3HOU I;  3I4N I;  1QYP A;  2VUM I;  3FKI I;  5C4X I;  4QTU A;  4X6A I;  3Q87 A;  2KPI A;  1X3Z A;  2B63 I;  1N2F A;  3VMI A;  2YU9 I;  4NB8 A;  4BBR I;  3HOW I;  4A3L I;  1I3Q I;  2DE5 A;  2JA7 I;  3PO2 I;  3HOV I;  4NB9 A;  4A3F I;  2F4M A;  3S17 I;  4NBA A;  2NVY I;  1TWF I;  4A3M I;  2NVX I;  4MH4 A;  2BJO A;  4BBS I;  1K83 I;  4A3K I;  2RBL A;  4BY7 I;  4NBG A;  3K7A I;  5C4J I;  3U50 C;  2JA6 I;  4Y7N I;  4A3C I;  3GTO I;  1TWC I;  4BXX I;  3GTQ I;  3HOY I;  2F4O A;  3VMH A;  3I4M I;  1ZB9 A;  5IP7 I;  5C3E I;  2R7Z I;  3CQZ I;  3M3Y I;  2JA5 I;  1Y1W I;  4XX2 A;  1PFT A;  4NBD A;  2E2H I;  3H3V J;  4A3I I;  2JNY A;  3RZD I;  1USP A;  2NVT I;  3S1N I;  4A3D I;  3PO3 S;  4QTT A;  1ZB8 A;  3GTK I;  3S2D I;  4NBC A;  1TWG I;  2K5R A;  1R9T I;  2JA8 I;  3PO3 I;  3GTL I;  4A3B I;  2R93 I;  3H0G I;  2DE6 A;  3S16 I;  3S2H I;  4Y52 I;  1WCM I;  3M4O I;  3S15 I;  2PK7 A;  3GTM S; 
#chains in the Genus database with same CATH topology
 1TWH I;  1RO0 A;  2RPR A;  5CM2 M;  3RZO I;  4A93 I;  2GTH A;  4E32 A;  4RV9 A;  5LL6 f;  3CXC Y;  1ML8 A;  1QVG Y;  3MZK B;  4E33 A;  1DL6 A;  4NH1 C;  1K9M 1;  4DGL A;  1Y8C A;  4A3E I;  1K73 2;  3HOX I;  1YIJ Z;  3NDI A;  1KD1 2;  3QWU A;  2GU2 A;  2AYD A;  2IZ3 A;  5FLM I;  5FLX b;  1JWH C;  3D6W A;  1Q86 1;  4A3J I;  4A3G I;  2Q4Z A;  1M90 1;  2I3C A;  2QRE B;  1RQF A;  2R6M A;  3S1R I;  3HOU I;  3MON A;  1YI2 1;  1QYP A;  1JJ2 Y;  2VUM I;  3BG1 B;  3FKI I;  4QTU A;  1VQ8 1;  1M1K 2;  3F3P C;  1X3Z A;  1S72 Z;  2B63 I;  2YU9 I;  4BBR I;  3HOW I;  2G2K A;  2OZK A;  1KRL A;  5T64 A;  3HOV I;  4MD9 A;  1YJ9 Z;  2F4M A;  3S17 I;  2WAQ A;  4E30 A;  4A3M I;  1JJ2 Z;  3G6E Z;  1S7M A;  3K7A I;  4TNU A;  3G71 Z;  3NH4 A;  1QVF Y;  3NFZ A;  4MD7 A;  3VMH A;  4NFR A;  2JUB A;  5IP7 I;  1ZH1 A;  3I55 1;  3CCS Z;  1Y1W I;  1PFT A;  1SIW A;  3NDJ A;  1K8A 1;  2JNY A;  3RZD I;  4DQY B;  3S2D I;  4A3B I;  2VF1 A;  2R93 I;  3S16 I;  2DE6 A;  2OTL 1;  2GTI A;  2PK7 A;  3HKZ A;  2OOX B;  3FQM A;  1YUK A;  3KIF A;  4DK1 A;  3CCJ Z;  1X3W A;  2P3Y A;  3S14 I;  3GTP I;  4E31 A;  4NBE A;  1LQL A;  4E2X A;  1N8R 2;  1VLA A;  3J80 b;  2O4H A;  2V8I A;  3CC2 Z;  3CCL 1;  4NOZ A;  1YI2 Z;  3CME Z;  4MON A;  1TWA I;  1NP6 A;  1Z02 A;  3I07 A;  3CCM 1;  3CCS 1;  2DE7 A;  2VPW A;  1VQ8 Z;  5IP9 I;  3NH5 A;  1YJW 1;  1VQM Z;  1Q16 A;  4HGZ A;  3S1Q I;  3HOZ I;  2W04 A;  1W2B Z;  1Z01 A;  3VMG A;  1FDI A;  3TE5 B;  1Q81 1;  3Q87 A;  2KPI A;  3P5J B;  3CCV Z;  1Q7Y 1;  2E9H A;  2LEX A;  3VMI A;  2VPY A;  2O53 A;  1Q86 2;  3CCJ 1;  4A3L I;  2Q51 A;  5D1O A;  3J80 f;  2V45 A;  3I55 Z;  2IV2 X;  1P9N A;  4NB9 A;  2NVY I;  3CCQ Z;  3CPW Z;  1QXF A;  1K83 I;  3CC2 1;  4BY7 I;  2QRC B;  1KQS Z;  5C4J I;  3CME 1;  4A3C I;  4Y7N I;  3NH8 A;  2PMZ A;  3GTQ I;  2F4O A;  1VQM 1;  4E2Y A;  2OTL Z;  2RT9 A;  4XX2 A;  4NBD A;  5A2Q b;  4A3I I;  3J81 b;  1YIT Z;  4A3D I;  3GTK I;  4RVG A;  4NBC A;  3CCV 1;  2JA8 I;  3GTL I;  2QLV B;  4HH4 A;  1KC8 1;  3H0G I;  3FQQ A;  3CCE Z;  4RS4 A;  5FLX f;  5D1O B;  3M4O I;  3S15 I;  3TDH B;  3CCL Z;  2WB1 A;  1WZN A;  3GTM S;  5D1P A;  2NVQ I;  1USP B;  2M6N A;  3CCM Z;  1WJ2 A;  3GTM I;  2P28 A;  3F3F C;  4RVD A;  3CCQ 1;  4NBB A;  1YJW Z;  2Y0S A;  1TFI A;  1RLY A;  2QRD B;  2JIM A;  2HF1 A;  3GTG I;  4MRI A;  2IZ4 A;  1YHQ 1;  2PM9 A;  5C44 I;  2QEX 1;  2JS4 A;  3EER A;  5A2Q f;  3JAM b;  3J81 f;  2AKL A;  1VQL 1;  4NBF A;  3ESW A;  1RO4 A;  3S1M I;  2JR6 A;  2RIQ A;  2QA4 1;  1I6H I;  3IR7 A;  3CMA 1;  1YIT 1;  1YJN 1;  1I50 I;  1VQK Z;  1NUI A;  1X0T A;  4EWC A;  3I56 Z;  3VB9 A;  1QF8 A;  3I4N I;  2V8K A;  3CCE 1;  1W2B Y;  3CD6 1;  3T4N B;  5C4X I;  4X6A I;  3CCU 1;  1N2F A;  2VUG A;  1FDO A;  4NB8 A;  2OTJ 1;  1VQ5 1;  4MXU A;  1I3Q I;  2DE5 A;  4RVF A;  2V8J A;  4RVH A;  2JA7 I;  4E2Z A;  1VQ4 1;  1K9M 2;  3VTN A;  3JAM f;  1Q81 2;  4A3F I;  2JIP A;  4NBA A;  2JIQ A;  1Q7Y 2;  4MH4 A;  1NJI 1;  5AN9 F;  2RBL A;  1VQP Z;  4NBG A;  2YAD A;  3CPW Y;  1VQO Z;  4S1T A;  3GTO I;  4BXX I;  3CC4 1;  3HOY I;  2QKD A;  1KQS Y;  1Z03 A;  1VQ9 1;  5T6B A;  2R7Z I;  3CQZ I;  3M3Y I;  2JA5 I;  2OOY B;  1M90 2;  1VQK 1;  1Q82 1;  2HU9 A;  3I56 1;  2KI7 B;  3H3V J;  3OW2 Z;  2V3V A;  1USP A;  1AA6 A;  3CC7 Z;  3IX0 A;  1ZB8 A;  2JMO A;  1VQ6 1;  1TWG I;  2E7Z A;  2K5R A;  1WII A;  3S2H I;  4Y52 I;  1WCM I;  1YHQ Z;  2VPX A;  2RHB A;  2QEX Z;  3CXC Z;  1QVG Z;  1VQL Z;  1RNI A;  4MD8 A;  1K73 1;  2QA4 Z;  3CMA Z;  1YUA A;  1VQP 1;  3D2L A;  4NBH A;  1KC8 2;  1KD1 1;  2R92 I;  1Y1V S;  2LFU A;  3GCF A;  1YJN Z;  1VQO 1;  1Y1V I;  3CCR 1;  2M48 A;  3KIH A;  3GKQ A;  1L1O C;  3CD6 Z;  4BY1 I;  1K8A 2;  2E2J I;  3CCU Z;  1WW9 A;  2E2I I;  1VQN Z;  2QR1 B;  3LUS A;  1SFO I;  1M1K 1;  5IT9 b;  2OTJ Z;  1VQ5 Z;  3G4S Z;  3IFU A;  3GTJ I;  3CC7 1;  3EED A;  3MZL B;  2J6A A;  1VQ4 Z;  2EGT A;  4HGY A;  1YIJ 1;  2VPZ A;  3CC4 Z;  2JIO A;  3J7A 4;  2W03 A;  1VQ9 Z;  1VQ7 Z;  3PO2 I;  2K3R A;  3IF8 A;  2ZAE B;  2NVX I;  1TWF I;  4BBS I;  2BJO A;  4A3K I;  1QVF Z;  1S72 1;  3U50 C;  5IT9 f;  2JA6 I;  2H85 A;  1TWC I;  1VQ6 Z;  3I4M I;  1ZB9 A;  1VQN 1;  5C3E I;  1YJ9 1;  1NJI 2;  3G4S 1;  2NAP A;  3G6E 1;  2JIR A;  4AYB A;  2LIY A;  3D9X A;  3G71 1;  2NVT I;  3S1N I;  3BG0 B;  3PO3 S;  4QTT A;  3OW2 Y;  4CL1 A;  1R9T I;  3PO3 I;  4E2W A;  1Q82 2;  5T67 A;  3CCR Z;  1N8R 1;  1RO2 A;  2E2H I;  1VQ7 1; 
#chains in the Genus database with same CATH homology
 1TWH I;  1RO0 A;  2RPR A;  5CM2 M;  3RZO I;  4A93 I;  2GTH A;  4E32 A;  4RV9 A;  5LL6 f;  3CXC Y;  1ML8 A;  1QVG Y;  3MZK B;  4E33 A;  1DL6 A;  4NH1 C;  1K9M 1;  4DGL A;  4A3E I;  1K73 2;  3HOX I;  1YIJ Z;  3NDI A;  1KD1 2;  3QWU A;  2GU2 A;  2IZ3 A;  5FLM I;  5FLX b;  1JWH C;  3D6W A;  1Q86 1;  4A3J I;  4A3G I;  2Q4Z A;  1M90 1;  2I3C A;  2QRE B;  1RQF A;  2R6M A;  3S1R I;  3HOU I;  3MON A;  1YI2 1;  1QYP A;  1JJ2 Y;  2VUM I;  3BG1 B;  3FKI I;  4QTU A;  1VQ8 1;  1M1K 2;  3F3P C;  1X3Z A;  1S72 Z;  2B63 I;  2YU9 I;  4BBR I;  3HOW I;  2G2K A;  2OZK A;  1KRL A;  5T64 A;  3HOV I;  4MD9 A;  1YJ9 Z;  2F4M A;  3S17 I;  2WAQ A;  4E30 A;  4A3M I;  1JJ2 Z;  3G6E Z;  1S7M A;  3K7A I;  4TNU A;  3G71 Z;  3NH4 A;  1QVF Y;  3NFZ A;  4MD7 A;  3VMH A;  4NFR A;  2JUB A;  5IP7 I;  1ZH1 A;  3I55 1;  3CCS Z;  1Y1W I;  1PFT A;  3NDJ A;  1K8A 1;  2JNY A;  3RZD I;  4DQY B;  3S2D I;  4A3B I;  2VF1 A;  2R93 I;  3S16 I;  2DE6 A;  2OTL 1;  2GTI A;  2PK7 A;  3HKZ A;  2OOX B;  3FQM A;  1YUK A;  3KIF A;  4DK1 A;  3CCJ Z;  1X3W A;  2P3Y A;  3S14 I;  3GTP I;  4E31 A;  4NBE A;  1LQL A;  4E2X A;  1N8R 2;  1VLA A;  3J80 b;  2O4H A;  2V8I A;  3CC2 Z;  3CCL 1;  4NOZ A;  1YI2 Z;  3CME Z;  4MON A;  1TWA I;  1NP6 A;  1Z02 A;  3I07 A;  3CCM 1;  3CCS 1;  2DE7 A;  1VQ8 Z;  5IP9 I;  3NH5 A;  1YJW 1;  1VQM Z;  3S1Q I;  4HGZ A;  3HOZ I;  2W04 A;  1W2B Z;  1Z01 A;  3VMG A;  3TE5 B;  1Q81 1;  3Q87 A;  2KPI A;  3P5J B;  3CCV Z;  1Q7Y 1;  2E9H A;  3VMI A;  2O53 A;  1Q86 2;  3CCJ 1;  4A3L I;  2Q51 A;  5D1O A;  3J80 f;  3I55 Z;  1P9N A;  4NB9 A;  2NVY I;  3CCQ Z;  3CPW Z;  1K83 I;  3CC2 1;  4BY7 I;  2QRC B;  1KQS Z;  5C4J I;  3CME 1;  4A3C I;  4Y7N I;  3NH8 A;  2PMZ A;  3GTQ I;  2F4O A;  1VQM 1;  4E2Y A;  2OTL Z;  2RT9 A;  4XX2 A;  4NBD A;  5A2Q b;  4A3I I;  3J81 b;  1YIT Z;  4A3D I;  3GTK I;  4RVG A;  4NBC A;  3CCV 1;  2JA8 I;  3GTL I;  2QLV B;  4HH4 A;  1KC8 1;  3H0G I;  3FQQ A;  3CCE Z;  4RS4 A;  5FLX f;  5D1O B;  3M4O I;  3S15 I;  3TDH B;  3CCL Z;  2WB1 A;  3GTM S;  5D1P A;  2NVQ I;  1USP B;  2M6N A;  3CCM Z;  3GTM I;  2P28 A;  3F3F C;  4RVD A;  3CCQ 1;  4NBB A;  1YJW Z;  2Y0S A;  1TFI A;  1RLY A;  2QRD B;  2HF1 A;  3GTG I;  4MRI A;  2IZ4 A;  1YHQ 1;  2PM9 A;  5C44 I;  2QEX 1;  2JS4 A;  3EER A;  5A2Q f;  3JAM b;  3J81 f;  2AKL A;  1VQL 1;  4NBF A;  3ESW A;  1RO4 A;  3S1M I;  2JR6 A;  2RIQ A;  2QA4 1;  1I6H I;  3CMA 1;  1YIT 1;  1YJN 1;  1I50 I;  1VQK Z;  1NUI A;  1X0T A;  4EWC A;  3I56 Z;  3VB9 A;  1QF8 A;  3I4N I;  2V8K A;  3CCE 1;  1W2B Y;  3CD6 1;  3T4N B;  5C4X I;  4X6A I;  3CCU 1;  1N2F A;  2VUG A;  4NB8 A;  2OTJ 1;  1VQ5 1;  4MXU A;  1I3Q I;  2DE5 A;  4RVF A;  2V8J A;  4RVH A;  2JA7 I;  4E2Z A;  1VQ4 1;  1K9M 2;  3VTN A;  3JAM f;  1Q81 2;  4A3F I;  4NBA A;  1Q7Y 2;  4MH4 A;  1NJI 1;  5AN9 F;  2RBL A;  1VQP Z;  4NBG A;  2YAD A;  3CPW Y;  1VQO Z;  4S1T A;  3GTO I;  4BXX I;  3CC4 1;  3HOY I;  2QKD A;  1KQS Y;  1Z03 A;  1VQ9 1;  5T6B A;  2R7Z I;  3CQZ I;  3M3Y I;  2JA5 I;  2OOY B;  1M90 2;  1VQK 1;  1Q82 1;  2HU9 A;  3I56 1;  2KI7 B;  3H3V J;  3OW2 Z;  1USP A;  3CC7 Z;  3IX0 A;  1ZB8 A;  2JMO A;  1VQ6 1;  1TWG I;  2K5R A;  1WII A;  3S2H I;  4Y52 I;  1WCM I;  1YHQ Z;  2RHB A;  2QEX Z;  3CXC Z;  1QVG Z;  1VQL Z;  1RNI A;  4MD8 A;  1K73 1;  2QA4 Z;  3CMA Z;  1YUA A;  1VQP 1;  4NBH A;  1KC8 2;  1KD1 1;  2R92 I;  1Y1V S;  2LFU A;  3GCF A;  1YJN Z;  1VQO 1;  1Y1V I;  3CCR 1;  2M48 A;  3KIH A;  3GKQ A;  1L1O C;  3CD6 Z;  4BY1 I;  1K8A 2;  2E2J I;  3CCU Z;  1WW9 A;  2E2I I;  1VQN Z;  2QR1 B;  3LUS A;  1SFO I;  1M1K 1;  5IT9 b;  2OTJ Z;  1VQ5 Z;  3G4S Z;  3IFU A;  3GTJ I;  3CC7 1;  3EED A;  3MZL B;  2J6A A;  1VQ4 Z;  2EGT A;  4HGY A;  1YIJ 1;  3CC4 Z;  3J7A 4;  2W03 A;  1VQ9 Z;  1VQ7 Z;  3PO2 I;  2K3R A;  3IF8 A;  2ZAE B;  2NVX I;  1TWF I;  4BBS I;  2BJO A;  4A3K I;  1QVF Z;  1S72 1;  3U50 C;  5IT9 f;  2JA6 I;  2H85 A;  1TWC I;  1VQ6 Z;  3I4M I;  1ZB9 A;  1VQN 1;  5C3E I;  1YJ9 1;  1NJI 2;  3G4S 1;  3G6E 1;  4AYB A;  2LIY A;  3D9X A;  3G71 1;  2NVT I;  3S1N I;  3BG0 B;  3PO3 S;  4QTT A;  3OW2 Y;  4CL1 A;  1R9T I;  3PO3 I;  4E2W A;  1Q82 2;  5T67 A;  3CCR Z;  1N8R 1;  1RO2 A;  2E2H I;  1VQ7 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...