3S1RI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1rI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1rI02
4BBRI 4A3MI 3HOVI 3RZDI 4NBCA 4NBGA 3HOXI 2JA8I 3HOZI 2AKLA 2E2JI 4NBEA 4A93I 5FLMI 1ZB9A 3I4MI 3S2DI 3H3VJ 3GTQI 5C4JI 2E2II 3H0GI 3GTMI 2B63I 2JNYA 1I6HI 2NVTI 4BBSI 2JS4A 3S1QI 2VUMI 1RO4A 1SFOI 1R9TI 3LUSA 1I50I 4BXXI 2F4MA 2JA6I 2F4OA 5C44I 4A3JI 1X3WA 4A3II 2DE5A 1DL6A 2J6AA 3GCFA 1RLYA 3I07A 2NVQI 1TWGI 3VB9A 3S2HI 4A3KI 1TWAI 3GTLI 1WW9A 3Q87A 3U50C 2R93I 1QYPA 1ML8A 2KPIA 3HOUI 4XX2A 1PFTA 3M4OI 4BY1I 3I4NI 3GTKI 2R92I 2JR6A 3VMIA 2DE6A 3S16I 3S17I 3VMHA 3GTPI 3S1NI 3S14I 3RZOI 4NBDA 4A3GI 5IP9I 4NBFA 1Y1VI 1USPA 3GKQA 4QTUA 4NB9A 4BY7I 2JA7I 3HOYI 4X6AI 4NBBA 3CQZI 1N2FA 3GTMS 1L1OC 2NVXI 1TWHI 5IP7I 4MH4A 3D6WA 3S1MI 1ZB8A 1WCMI 4Y52I 4QTTA 2HF1A 3S1RI 3EERA 4A3CI 4NOZA 3PO3I 1Y1WI 2RBLA 4A3DI 3FKII 1X3ZA 2DE7A 4A3FI 3ESWA 4Y7NI 2E2HI 5C4XI 3S15I 2NVYI 1Y1VS 3GTOI 3GTJI 3K7AI 4A3LI 3HOWI 1K83I 2K5RA 4A3EI 1I3QI 1LQLA 3VMGA 3M3YI 2BJOA 2P3YA 1TFIA 5CM2M 3PO3S 1YUAA 2YU9I 3GTGI 1TWCI 1USPB 3PO2I 2PK7A 2R7ZI 5C3EI 1TWFI 4NBHA 4NB8A 2JA5I 1NUIA 4NBAA 4A3BI 1VLAA
chains in the Genus database with same CATH superfamily
4A3MI 1K8A1 3TE5B 1VQ61 1ZB9A 2QRCB 3I4MI 4E2YA 2Y0SA 3GTQI 3MZLB 3J80b 2B63I 1YJW1 2GTIA 2RT9A 1WJ2A 4BBSI 2JS4A 3NDJA 4NH1C 2PM9A 3BG1B 3CC4Z 2NAPA 1YIT1 1KQSZ 1I50I 4BXXI 2E9HA 4RVHA 2GU2A 3MONA 4A3II 1VQPZ 3G6EZ 3GCFA 3I07A 2V8IA 2VPWA 1TWAI 1VQ71 2JIOA 2VPZA 3Q87A 3CPWY 3CXCY 2E7ZA 2K3RA 2KPIA 2JIPA 4AYBA 1YIJZ 1PFTA 1VQO1 3CD61 3CMA1 2JR6A 2DE6A 4HGZA 1VQ51 3FQMA 5IP9I 2RHBA 4NBFA 2Q4ZA 1USPA 2JUBA 2EGTA 4QTUA 4HH4A 3CMEZ 2O53A 1W2BZ 3CQZI 1RO2A 1YUKA 1TWHI 4MH4A 3S1MI 3I551 3EEDA 1ZB8A 2JIRA 2QRDB 3G4S1 1JJ2Y 4A3CI 4NOZA 4E30A 1VQ81 1YHQZ 1K8A2 1X3ZA 1VQ41 5C4XI 2V8JA 4A3LI 2RPRA 3MZKB 1K83I 2K5RA 4A3EI 1QVFZ 1SIWA 1VQK1 3CPWZ 3VMGA 2IZ3A 2BJOA 1YI2Z 4DK1A 3PO2I 5C3EI 4NBAA 3CCRZ 4A3BI 2QLVB 4A93I 3CCUZ 2IZ4A 3RZDI 4NBGA 5D1PA 5FLXf 3G711 3IFUA 1YJN1 5C4JI 3H0GI 3KIHA 4E2WA 3J7A4 1Z02A 2OTLZ 1RO4A 1VQN1 1VQL1 1R9TI 3LUSA 2F4MA 2JA6I 5C44I 4A3JI 1NJI2 2Q51A 2LFUA 1DL6A 2J6AA 1YJWZ 1TWGI 4HGYA 1ZH1A 4E2ZA 4A3KI 5T64A 3OW2Y 1M902 4MXUA 4RVFA 3U50C 2AYDA 2OOYB 1S7MA 3CC21 3M4OI 3I4NI 3GTKI 3VMIA 3S16I 2G2KA 3S1NI 2QKDA 4MD7A 3CCJ1 3CCS1 3GKQA 3JAMf 2V3VA 3NH5A 3I56Z 4E32A 3HOYI 4X6AI 3NDIA 2H85A 1N2FA 3GTMS 2PMZA 1KD12 2NVXI 3D6WA 3J81f 3CD6Z 3CMAZ 2VF1A 4MD8A 4DQYB 1K732 2LIYA 1JWHC 4A3DI 4A3FI 1WZNA 2DE7A 4Y7NI 3CC41 1Y1VS 3K7AI 1Z01A 2JMOA 5AN9F 4RV9A 2VUGA 1QXFA 1VQ9Z 2IV2X 1NJI1 5A2Qf 1QVGY 3PO3S 4RVGA 3CCQ1 1M901 3GTGI 1USPB 1FDOA 3CCEZ 1P9NA 2JIMA 1NUIA 1VLAA 3CCL1 3HOVI 4EWCA 1VQKZ 2JA8I 5D1OA 3CCV1 1VQMZ 2E2JI 3S2DI 1Q16A 2HU9A 2E2II 3GTMI 3CXCZ 3BG0B 4CL1A 3CME1 2R6MA 5IT9f 2NVTI 3IX0A 3CC7Z 4E33A 1KD11 3CCMZ 2W03A 1K731 1RNIA 2GTHA 1Q821 2F4OA 1YHQ1 1YJNZ 2JIQA 1Z03A 2DE5A 2WAQA 3TDHB 3S2HI 2QEXZ 1WW9A 5IT9b 3NFZA 1QYPA 2OTJZ 2QA4Z 1K9M2 1M1K1 1KC81 4TNUA 1Q862 1JJ2Z 1KRLA 1FDIA 4RS4A 4BY1I 1VQ6Z 3S17I 3VMHA 3GTPI 3RZOI 4A3GI 5FLXb 2P28A 3F3PC 4BY7I 4NB9A 4NBBA 1L1OC 5IP7I 3J80f 3IR7A 1YITZ 1Q812 2HF1A 3S1RI 4DGLA 4MONA 4MRIA 3HKZA 3CCJZ 2RBLA 3D2LA 3FKII 1Q7Y1 1S721 2E2HI 2OTL1 3S15I 1X0TA 1VQ7Z 3FQQA 3F3FC 1YJ91 4MD9A 1W2BY 1LQLA 4NFRA 3M3YI 1NP6A 2P3YA 1VQOZ 1VQ5Z 3QWUA 2YU9I 2QR1B 1TWCI 1Q822 1K9M1 3NH8A 4NB8A 1Q861 2RIQA 2ZAEB 4BBRI 4NBCA 3NH4A 5T6BA 3HOXI 3HOZI 3JAMb 3T4NB 2AKLA 4NBEA 1QVFY 5FLMI 3I55Z 2LEXA 3IF8A 1M1K2 3H3VJ 1KC82 3CCQZ 2OZKA 3G4SZ 3OW2Z 1VQP1 3J81b 3I561 3G6E1 1VQ8Z 2JNYA 1I6HI 3CCLZ 1VQ4Z 3S1QI 2VUMI 4S1TA 5T67A 1SFOI 3CCVZ 5LL6f 1Q811 3KIFA 1YIJ1 2YADA 1X3WA 1WIIA 3P5JB 1RLYA 2NVQI 2V8KA 3VB9A 5A2Qb 3GTLI 2R93I 2O4HA 1VQ91 1ML8A 1QF8A 2W04A 3VTNA 3D9XA 1Q7Y2 3HOUI 4XX2A 1N8R2 5D1OB 2R92I 3S14I 4NBDA 2WB1A 3G71Z 3CCE1 1Y1VI 4E31A 2KI7B 2JA7I 2V45A 2QREB 1VQM1 1AA6A 1QVGZ 1VQNZ 4RVDA 1VQLZ 4Y52I 1WCMI 4QTTA 2I3CA 1Y8CA 3EERA 2VPXA 3PO3I 1Y1WI 1RQFA 3ESWA 1YI21 3CC71 1KQSY 2NVYI 3GTOI 3GTJI 3CCM1 2VPYA 3CCR1 3HOWI 2OOXB 3CCU1 1I3QI 3CC2Z 4E2XA 2M48A 1TFIA 5CM2M 1S72Z 2QEX1 1YUAA 2OTJ1 2PK7A 2QA41 2R7ZI 1TWFI 2M6NA 4NBHA 2JA5I 1RO0A 3CCSZ 1YJ9Z 1N8R1
chains in the Genus database with same CATH topology
4A3MI 1K8A1 3TE5B 1VQ61 1ZB9A 2QRCB 3I4MI 4E2YA 2Y0SA 3GTQI 3MZLB 3J80b 2B63I 1YJW1 2GTIA 2RT9A 4BBSI 2JS4A 3NDJA 4NH1C 2PM9A 3BG1B 3CC4Z 1YIT1 1KQSZ 1I50I 4BXXI 2E9HA 4RVHA 2GU2A 3MONA 4A3II 1VQPZ 3G6EZ 3GCFA 3I07A 2V8IA 1TWAI 1VQ71 3CPWY 3Q87A 3CXCY 2K3RA 2KPIA 4AYBA 1YIJZ 1PFTA 1VQO1 3CD61 3CMA1 2JR6A 2DE6A 4HGZA 1VQ51 3FQMA 5IP9I 2RHBA 4NBFA 2Q4ZA 1USPA 2JUBA 2EGTA 4QTUA 4HH4A 3CMEZ 2O53A 1W2BZ 3CQZI 1RO2A 1YUKA 1TWHI 4MH4A 3S1MI 3I551 3EEDA 1ZB8A 2QRDB 3G4S1 1JJ2Y 4A3CI 4NOZA 4E30A 1VQ81 1YHQZ 1K8A2 1X3ZA 1VQ41 5C4XI 2V8JA 4A3LI 2RPRA 3MZKB 1K83I 2K5RA 4A3EI 1QVFZ 1VQK1 3CPWZ 3VMGA 2IZ3A 2BJOA 1YI2Z 4DK1A 3PO2I 5C3EI 4NBAA 3CCRZ 4A3BI 2QLVB 4A93I 3CCUZ 2IZ4A 3RZDI 4NBGA 5D1PA 5FLXf 3G711 3IFUA 1YJN1 5C4JI 3H0GI 3KIHA 4E2WA 3J7A4 1Z02A 2OTLZ 1RO4A 1VQN1 1VQL1 1R9TI 3LUSA 2F4MA 2JA6I 5C44I 4A3JI 1NJI2 2Q51A 2LFUA 1DL6A 2J6AA 1YJWZ 1TWGI 4HGYA 1ZH1A 4E2ZA 4A3KI 5T64A 3OW2Y 1M902 4MXUA 4RVFA 3U50C 2OOYB 1S7MA 3CC21 3M4OI 3I4NI 3GTKI 3VMIA 3S16I 2G2KA 3S1NI 2QKDA 4MD7A 3CCJ1 3CCS1 3GKQA 3JAMf 3NH5A 3I56Z 4E32A 3HOYI 4X6AI 3NDIA 2H85A 1N2FA 3GTMS 2PMZA 1KD12 2NVXI 3D6WA 3J81f 3CD6Z 2VF1A 3CMAZ 4MD8A 4DQYB 1K732 2LIYA 1JWHC 4A3DI 4A3FI 2DE7A 4Y7NI 3CC41 1Y1VS 3K7AI 1Z01A 2JMOA 5AN9F 4RV9A 2VUGA 1VQ9Z 1NJI1 5A2Qf 1QVGY 3PO3S 4RVGA 3CCQ1 1M901 3GTGI 1USPB 3CCEZ 1P9NA 1NUIA 1VLAA 3CCL1 3HOVI 4EWCA 1VQKZ 2JA8I 5D1OA 3CCV1 1VQMZ 2E2JI 3S2DI 2HU9A 2E2II 3GTMI 3CXCZ 3BG0B 4CL1A 3CME1 2R6MA 5IT9f 2NVTI 3IX0A 3CC7Z 4E33A 1KD11 3CCMZ 2W03A 1K731 1RNIA 2GTHA 1Q821 2F4OA 1YHQ1 1YJNZ 1Z03A 2DE5A 2WAQA 3TDHB 3S2HI 2QEXZ 1WW9A 5IT9b 3NFZA 1QYPA 2OTJZ 2QA4Z 1K9M2 1M1K1 1KC81 4TNUA 1Q862 1JJ2Z 1KRLA 4RS4A 4BY1I 1VQ6Z 3S17I 3VMHA 3GTPI 3RZOI 4A3GI 5FLXb 2P28A 3F3PC 4BY7I 4NB9A 4NBBA 1L1OC 5IP7I 3J80f 1YITZ 1Q812 2HF1A 3S1RI 4DGLA 4MONA 4MRIA 3HKZA 3CCJZ 2RBLA 3FKII 1Q7Y1 1S721 2E2HI 2OTL1 3S15I 1X0TA 1VQ7Z 3FQQA 3F3FC 1YJ91 4MD9A 1W2BY 1LQLA 4NFRA 3M3YI 1NP6A 2P3YA 1VQOZ 1VQ5Z 3QWUA 2YU9I 2QR1B 1TWCI 1Q822 1K9M1 3NH8A 4NB8A 1Q861 2RIQA 2ZAEB 4BBRI 4NBCA 3NH4A 5T6BA 3HOXI 3HOZI 3JAMb 3T4NB 2AKLA 4NBEA 1QVFY 5FLMI 3I55Z 3IF8A 1M1K2 3H3VJ 1KC82 3G4SZ 2OZKA 3CCQZ 1VQP1 3OW2Z 3J81b 3I561 3G6E1 1VQ8Z 2JNYA 1I6HI 3CCLZ 1VQ4Z 3S1QI 2VUMI 4S1TA 5T67A 1SFOI 3CCVZ 5LL6f 1Q811 3KIFA 1YIJ1 2YADA 1X3WA 1WIIA 3P5JB 1RLYA 2NVQI 2V8KA 3VB9A 5A2Qb 3GTLI 2R93I 2O4HA 1VQ91 1ML8A 1QF8A 2W04A 3VTNA 3D9XA 1Q7Y2 3HOUI 4XX2A 1N8R2 5D1OB 2R92I 3S14I 4NBDA 2WB1A 3G71Z 3CCE1 1Y1VI 4E31A 2KI7B 2JA7I 1VQM1 2QREB 1QVGZ 1VQNZ 4RVDA 1VQLZ 4Y52I 1WCMI 4QTTA 2I3CA 3EERA 3PO3I 1Y1WI 1RQFA 3ESWA 1YI21 3CC71 1KQSY 2NVYI 3GTOI 3GTJI 3CCM1 3CCR1 3HOWI 2OOXB 3CCU1 1I3QI 3CC2Z 4E2XA 2M48A 1TFIA 5CM2M 1S72Z 2QEX1 1YUAA 2OTJ1 2PK7A 2QA41 2R7ZI 1TWFI 2M6NA 4NBHA 2JA5I 1RO0A 3CCSZ 1YJ9Z 1N8R1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBR I;  4A3M I;  3HOV I;  3RZD I;  4NBC A;  4NBG A;  3HOX I;  2JA8 I;  3HOZ I;  2AKL A;  2E2J I;  4NBE A;  4A93 I;  5FLM I;  1ZB9 A;  3I4M I;  3S2D I;  3H3V J;  3GTQ I;  5C4J I;  2E2I I;  3H0G I;  3GTM I;  2B63 I;  2JNY A;  1I6H I;  2NVT I;  4BBS I;  2JS4 A;  3S1Q I;  2VUM I;  1RO4 A;  1SFO I;  1R9T I;  3LUS A;  1I50 I;  4BXX I;  2F4M A;  2JA6 I;  2F4O A;  5C44 I;  4A3J I;  1X3W A;  4A3I I;  2DE5 A;  1DL6 A;  2J6A A;  3GCF A;  1RLY A;  3I07 A;  2NVQ I;  1TWG I;  3VB9 A;  3S2H I;  4A3K I;  1TWA I;  3GTL I;  1WW9 A;  3Q87 A;  3U50 C;  2R93 I;  1QYP A;  1ML8 A;  2KPI A;  3HOU I;  4XX2 A;  1PFT A;  3M4O I;  4BY1 I;  3I4N I;  3GTK I;  2R92 I;  2JR6 A;  3VMI A;  2DE6 A;  3S16 I;  3S17 I;  3VMH A;  3GTP I;  3S1N I;  3S14 I;  3RZO I;  4NBD A;  4A3G I;  5IP9 I;  4NBF A;  1Y1V I;  1USP A;  3GKQ A;  4QTU A;  4NB9 A;  4BY7 I;  2JA7 I;  3HOY I;  4X6A I;  4NBB A;  3CQZ I;  1N2F A;  3GTM S;  1L1O C;  2NVX I;  1TWH I;  5IP7 I;  4MH4 A;  3D6W A;  3S1M I;  1ZB8 A;  1WCM I;  4Y52 I;  4QTT A;  2HF1 A;  3S1R I;  3EER A;  4A3C I;  4NOZ A;  3PO3 I;  1Y1W I;  2RBL A;  4A3D I;  3FKI I;  1X3Z A;  2DE7 A;  4A3F I;  3ESW A;  4Y7N I;  2E2H I;  5C4X I;  3S15 I;  2NVY I;  1Y1V S;  3GTO I;  3GTJ I;  3K7A I;  4A3L I;  3HOW I;  1K83 I;  2K5R A;  4A3E I;  1I3Q I;  1LQL A;  3VMG A;  3M3Y I;  2BJO A;  2P3Y A;  1TFI A;  5CM2 M;  3PO3 S;  1YUA A;  2YU9 I;  3GTG I;  1TWC I;  1USP B;  3PO2 I;  2PK7 A;  2R7Z I;  5C3E I;  1TWF I;  4NBH A;  4NB8 A;  2JA5 I;  1NUI A;  4NBA A;  4A3B I;  1VLA A; 
#chains in the Genus database with same CATH topology
 4A3M I;  1K8A 1;  3TE5 B;  1VQ6 1;  1ZB9 A;  2QRC B;  3I4M I;  4E2Y A;  2Y0S A;  3GTQ I;  3MZL B;  3J80 b;  2B63 I;  1YJW 1;  2GTI A;  2RT9 A;  1WJ2 A;  4BBS I;  2JS4 A;  3NDJ A;  4NH1 C;  2PM9 A;  3BG1 B;  3CC4 Z;  2NAP A;  1YIT 1;  1KQS Z;  1I50 I;  4BXX I;  2E9H A;  4RVH A;  2GU2 A;  3MON A;  4A3I I;  1VQP Z;  3G6E Z;  3GCF A;  3I07 A;  2V8I A;  2VPW A;  1TWA I;  1VQ7 1;  2JIO A;  2VPZ A;  3Q87 A;  3CPW Y;  3CXC Y;  2E7Z A;  2K3R A;  2KPI A;  2JIP A;  4AYB A;  1YIJ Z;  1PFT A;  1VQO 1;  3CD6 1;  3CMA 1;  2JR6 A;  2DE6 A;  4HGZ A;  1VQ5 1;  3FQM A;  5IP9 I;  2RHB A;  4NBF A;  2Q4Z A;  1USP A;  2JUB A;  2EGT A;  4QTU A;  4HH4 A;  3CME Z;  2O53 A;  1W2B Z;  3CQZ I;  1RO2 A;  1YUK A;  1TWH I;  4MH4 A;  3S1M I;  3I55 1;  3EED A;  1ZB8 A;  2JIR A;  2QRD B;  3G4S 1;  1JJ2 Y;  4A3C I;  4NOZ A;  4E30 A;  1VQ8 1;  1YHQ Z;  1K8A 2;  1X3Z A;  1VQ4 1;  5C4X I;  2V8J A;  4A3L I;  2RPR A;  3MZK B;  1K83 I;  2K5R A;  4A3E I;  1QVF Z;  1SIW A;  1VQK 1;  3CPW Z;  3VMG A;  2IZ3 A;  2BJO A;  1YI2 Z;  4DK1 A;  3PO2 I;  5C3E I;  4NBA A;  3CCR Z;  4A3B I;  2QLV B;  4A93 I;  3CCU Z;  2IZ4 A;  3RZD I;  4NBG A;  5D1P A;  5FLX f;  3G71 1;  3IFU A;  1YJN 1;  5C4J I;  3H0G I;  3KIH A;  4E2W A;  3J7A 4;  1Z02 A;  2OTL Z;  1RO4 A;  1VQN 1;  1VQL 1;  1R9T I;  3LUS A;  2F4M A;  2JA6 I;  5C44 I;  4A3J I;  1NJI 2;  2Q51 A;  2LFU A;  1DL6 A;  2J6A A;  1YJW Z;  1TWG I;  4HGY A;  1ZH1 A;  4E2Z A;  4A3K I;  5T64 A;  3OW2 Y;  1M90 2;  4MXU A;  4RVF A;  3U50 C;  2AYD A;  2OOY B;  1S7M A;  3CC2 1;  3M4O I;  3I4N I;  3GTK I;  3VMI A;  3S16 I;  2G2K A;  3S1N I;  2QKD A;  4MD7 A;  3CCJ 1;  3CCS 1;  3GKQ A;  3JAM f;  2V3V A;  3NH5 A;  3I56 Z;  4E32 A;  3HOY I;  4X6A I;  3NDI A;  2H85 A;  1N2F A;  3GTM S;  2PMZ A;  1KD1 2;  2NVX I;  3D6W A;  3J81 f;  3CD6 Z;  3CMA Z;  2VF1 A;  4MD8 A;  4DQY B;  1K73 2;  2LIY A;  1JWH C;  4A3D I;  4A3F I;  1WZN A;  2DE7 A;  4Y7N I;  3CC4 1;  1Y1V S;  3K7A I;  1Z01 A;  2JMO A;  5AN9 F;  4RV9 A;  2VUG A;  1QXF A;  1VQ9 Z;  2IV2 X;  1NJI 1;  5A2Q f;  1QVG Y;  3PO3 S;  4RVG A;  3CCQ 1;  1M90 1;  3GTG I;  1USP B;  1FDO A;  3CCE Z;  1P9N A;  2JIM A;  1NUI A;  1VLA A;  3CCL 1;  3HOV I;  4EWC A;  1VQK Z;  2JA8 I;  5D1O A;  3CCV 1;  1VQM Z;  2E2J I;  3S2D I;  1Q16 A;  2HU9 A;  2E2I I;  3GTM I;  3CXC Z;  3BG0 B;  4CL1 A;  3CME 1;  2R6M A;  5IT9 f;  2NVT I;  3IX0 A;  3CC7 Z;  4E33 A;  1KD1 1;  3CCM Z;  2W03 A;  1K73 1;  1RNI A;  2GTH A;  1Q82 1;  2F4O A;  1YHQ 1;  1YJN Z;  2JIQ A;  1Z03 A;  2DE5 A;  2WAQ A;  3TDH B;  3S2H I;  2QEX Z;  1WW9 A;  5IT9 b;  3NFZ A;  1QYP A;  2OTJ Z;  2QA4 Z;  1K9M 2;  1M1K 1;  1KC8 1;  4TNU A;  1Q86 2;  1JJ2 Z;  1KRL A;  1FDI A;  4RS4 A;  4BY1 I;  1VQ6 Z;  3S17 I;  3VMH A;  3GTP I;  3RZO I;  4A3G I;  5FLX b;  2P28 A;  3F3P C;  4BY7 I;  4NB9 A;  4NBB A;  1L1O C;  5IP7 I;  3J80 f;  3IR7 A;  1YIT Z;  1Q81 2;  2HF1 A;  3S1R I;  4DGL A;  4MON A;  4MRI A;  3HKZ A;  3CCJ Z;  2RBL A;  3D2L A;  3FKI I;  1Q7Y 1;  1S72 1;  2E2H I;  2OTL 1;  3S15 I;  1X0T A;  1VQ7 Z;  3FQQ A;  3F3F C;  1YJ9 1;  4MD9 A;  1W2B Y;  1LQL A;  4NFR A;  3M3Y I;  1NP6 A;  2P3Y A;  1VQO Z;  1VQ5 Z;  3QWU A;  2YU9 I;  2QR1 B;  1TWC I;  1Q82 2;  1K9M 1;  3NH8 A;  4NB8 A;  1Q86 1;  2RIQ A;  2ZAE B;  4BBR I;  4NBC A;  3NH4 A;  5T6B A;  3HOX I;  3HOZ I;  3JAM b;  3T4N B;  2AKL A;  4NBE A;  1QVF Y;  5FLM I;  3I55 Z;  2LEX A;  3IF8 A;  1M1K 2;  3H3V J;  1KC8 2;  3CCQ Z;  2OZK A;  3G4S Z;  3OW2 Z;  1VQP 1;  3J81 b;  3I56 1;  3G6E 1;  1VQ8 Z;  2JNY A;  1I6H I;  3CCL Z;  1VQ4 Z;  3S1Q I;  2VUM I;  4S1T A;  5T67 A;  1SFO I;  3CCV Z;  5LL6 f;  1Q81 1;  3KIF A;  1YIJ 1;  2YAD A;  1X3W A;  1WII A;  3P5J B;  1RLY A;  2NVQ I;  2V8K A;  3VB9 A;  5A2Q b;  3GTL I;  2R93 I;  2O4H A;  1VQ9 1;  1ML8 A;  1QF8 A;  2W04 A;  3VTN A;  3D9X A;  1Q7Y 2;  3HOU I;  4XX2 A;  1N8R 2;  5D1O B;  2R92 I;  3S14 I;  4NBD A;  2WB1 A;  3G71 Z;  3CCE 1;  1Y1V I;  4E31 A;  2KI7 B;  2JA7 I;  2V45 A;  2QRE B;  1VQM 1;  1AA6 A;  1QVG Z;  1VQN Z;  4RVD A;  1VQL Z;  4Y52 I;  1WCM I;  4QTT A;  2I3C A;  1Y8C A;  3EER A;  2VPX A;  3PO3 I;  1Y1W I;  1RQF A;  3ESW A;  1YI2 1;  3CC7 1;  1KQS Y;  2NVY I;  3GTO I;  3GTJ I;  3CCM 1;  2VPY A;  3CCR 1;  3HOW I;  2OOX B;  3CCU 1;  1I3Q I;  3CC2 Z;  4E2X A;  2M48 A;  1TFI A;  5CM2 M;  1S72 Z;  2QEX 1;  1YUA A;  2OTJ 1;  2PK7 A;  2QA4 1;  2R7Z I;  1TWF I;  2M6N A;  4NBH A;  2JA5 I;  1RO0 A;  3CCS Z;  1YJ9 Z;  1N8R 1; 
#chains in the Genus database with same CATH homology
 4A3M I;  1K8A 1;  3TE5 B;  1VQ6 1;  1ZB9 A;  2QRC B;  3I4M I;  4E2Y A;  2Y0S A;  3GTQ I;  3MZL B;  3J80 b;  2B63 I;  1YJW 1;  2GTI A;  2RT9 A;  4BBS I;  2JS4 A;  3NDJ A;  4NH1 C;  2PM9 A;  3BG1 B;  3CC4 Z;  1YIT 1;  1KQS Z;  1I50 I;  4BXX I;  2E9H A;  4RVH A;  2GU2 A;  3MON A;  4A3I I;  1VQP Z;  3G6E Z;  3GCF A;  3I07 A;  2V8I A;  1TWA I;  1VQ7 1;  3CPW Y;  3Q87 A;  3CXC Y;  2K3R A;  2KPI A;  4AYB A;  1YIJ Z;  1PFT A;  1VQO 1;  3CD6 1;  3CMA 1;  2JR6 A;  2DE6 A;  4HGZ A;  1VQ5 1;  3FQM A;  5IP9 I;  2RHB A;  4NBF A;  2Q4Z A;  1USP A;  2JUB A;  2EGT A;  4QTU A;  4HH4 A;  3CME Z;  2O53 A;  1W2B Z;  3CQZ I;  1RO2 A;  1YUK A;  1TWH I;  4MH4 A;  3S1M I;  3I55 1;  3EED A;  1ZB8 A;  2QRD B;  3G4S 1;  1JJ2 Y;  4A3C I;  4NOZ A;  4E30 A;  1VQ8 1;  1YHQ Z;  1K8A 2;  1X3Z A;  1VQ4 1;  5C4X I;  2V8J A;  4A3L I;  2RPR A;  3MZK B;  1K83 I;  2K5R A;  4A3E I;  1QVF Z;  1VQK 1;  3CPW Z;  3VMG A;  2IZ3 A;  2BJO A;  1YI2 Z;  4DK1 A;  3PO2 I;  5C3E I;  4NBA A;  3CCR Z;  4A3B I;  2QLV B;  4A93 I;  3CCU Z;  2IZ4 A;  3RZD I;  4NBG A;  5D1P A;  5FLX f;  3G71 1;  3IFU A;  1YJN 1;  5C4J I;  3H0G I;  3KIH A;  4E2W A;  3J7A 4;  1Z02 A;  2OTL Z;  1RO4 A;  1VQN 1;  1VQL 1;  1R9T I;  3LUS A;  2F4M A;  2JA6 I;  5C44 I;  4A3J I;  1NJI 2;  2Q51 A;  2LFU A;  1DL6 A;  2J6A A;  1YJW Z;  1TWG I;  4HGY A;  1ZH1 A;  4E2Z A;  4A3K I;  5T64 A;  3OW2 Y;  1M90 2;  4MXU A;  4RVF A;  3U50 C;  2OOY B;  1S7M A;  3CC2 1;  3M4O I;  3I4N I;  3GTK I;  3VMI A;  3S16 I;  2G2K A;  3S1N I;  2QKD A;  4MD7 A;  3CCJ 1;  3CCS 1;  3GKQ A;  3JAM f;  3NH5 A;  3I56 Z;  4E32 A;  3HOY I;  4X6A I;  3NDI A;  2H85 A;  1N2F A;  3GTM S;  2PMZ A;  1KD1 2;  2NVX I;  3D6W A;  3J81 f;  3CD6 Z;  2VF1 A;  3CMA Z;  4MD8 A;  4DQY B;  1K73 2;  2LIY A;  1JWH C;  4A3D I;  4A3F I;  2DE7 A;  4Y7N I;  3CC4 1;  1Y1V S;  3K7A I;  1Z01 A;  2JMO A;  5AN9 F;  4RV9 A;  2VUG A;  1VQ9 Z;  1NJI 1;  5A2Q f;  1QVG Y;  3PO3 S;  4RVG A;  3CCQ 1;  1M90 1;  3GTG I;  1USP B;  3CCE Z;  1P9N A;  1NUI A;  1VLA A;  3CCL 1;  3HOV I;  4EWC A;  1VQK Z;  2JA8 I;  5D1O A;  3CCV 1;  1VQM Z;  2E2J I;  3S2D I;  2HU9 A;  2E2I I;  3GTM I;  3CXC Z;  3BG0 B;  4CL1 A;  3CME 1;  2R6M A;  5IT9 f;  2NVT I;  3IX0 A;  3CC7 Z;  4E33 A;  1KD1 1;  3CCM Z;  2W03 A;  1K73 1;  1RNI A;  2GTH A;  1Q82 1;  2F4O A;  1YHQ 1;  1YJN Z;  1Z03 A;  2DE5 A;  2WAQ A;  3TDH B;  3S2H I;  2QEX Z;  1WW9 A;  5IT9 b;  3NFZ A;  1QYP A;  2OTJ Z;  2QA4 Z;  1K9M 2;  1M1K 1;  1KC8 1;  4TNU A;  1Q86 2;  1JJ2 Z;  1KRL A;  4RS4 A;  4BY1 I;  1VQ6 Z;  3S17 I;  3VMH A;  3GTP I;  3RZO I;  4A3G I;  5FLX b;  2P28 A;  3F3P C;  4BY7 I;  4NB9 A;  4NBB A;  1L1O C;  5IP7 I;  3J80 f;  1YIT Z;  1Q81 2;  2HF1 A;  3S1R I;  4DGL A;  4MON A;  4MRI A;  3HKZ A;  3CCJ Z;  2RBL A;  3FKI I;  1Q7Y 1;  1S72 1;  2E2H I;  2OTL 1;  3S15 I;  1X0T A;  1VQ7 Z;  3FQQ A;  3F3F C;  1YJ9 1;  4MD9 A;  1W2B Y;  1LQL A;  4NFR A;  3M3Y I;  1NP6 A;  2P3Y A;  1VQO Z;  1VQ5 Z;  3QWU A;  2YU9 I;  2QR1 B;  1TWC I;  1Q82 2;  1K9M 1;  3NH8 A;  4NB8 A;  1Q86 1;  2RIQ A;  2ZAE B;  4BBR I;  4NBC A;  3NH4 A;  5T6B A;  3HOX I;  3HOZ I;  3JAM b;  3T4N B;  2AKL A;  4NBE A;  1QVF Y;  5FLM I;  3I55 Z;  3IF8 A;  1M1K 2;  3H3V J;  1KC8 2;  3G4S Z;  2OZK A;  3CCQ Z;  1VQP 1;  3OW2 Z;  3J81 b;  3I56 1;  3G6E 1;  1VQ8 Z;  2JNY A;  1I6H I;  3CCL Z;  1VQ4 Z;  3S1Q I;  2VUM I;  4S1T A;  5T67 A;  1SFO I;  3CCV Z;  5LL6 f;  1Q81 1;  3KIF A;  1YIJ 1;  2YAD A;  1X3W A;  1WII A;  3P5J B;  1RLY A;  2NVQ I;  2V8K A;  3VB9 A;  5A2Q b;  3GTL I;  2R93 I;  2O4H A;  1VQ9 1;  1ML8 A;  1QF8 A;  2W04 A;  3VTN A;  3D9X A;  1Q7Y 2;  3HOU I;  4XX2 A;  1N8R 2;  5D1O B;  2R92 I;  3S14 I;  4NBD A;  2WB1 A;  3G71 Z;  3CCE 1;  1Y1V I;  4E31 A;  2KI7 B;  2JA7 I;  1VQM 1;  2QRE B;  1QVG Z;  1VQN Z;  4RVD A;  1VQL Z;  4Y52 I;  1WCM I;  4QTT A;  2I3C A;  3EER A;  3PO3 I;  1Y1W I;  1RQF A;  3ESW A;  1YI2 1;  3CC7 1;  1KQS Y;  2NVY I;  3GTO I;  3GTJ I;  3CCM 1;  3CCR 1;  3HOW I;  2OOX B;  3CCU 1;  1I3Q I;  3CC2 Z;  4E2X A;  2M48 A;  1TFI A;  5CM2 M;  1S72 Z;  2QEX 1;  1YUA A;  2OTJ 1;  2PK7 A;  2QA4 1;  2R7Z I;  1TWF I;  2M6N A;  4NBH A;  2JA5 I;  1RO0 A;  3CCS Z;  1YJ9 Z;  1N8R 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...