3S1RI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1rI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1rI02
1Y1VI 4QTTA 3GTMI 1QYPA 1RLYA 3GTOI 1L1OC 3S1RI 5CM2M 3PO3S 2E2HI 3LUSA 1WCMI 3VMIA 1R9TI 4A3II 1NUIA 1I50I 3PO3I 1TWFI 5C4XI 1K83I 4NBCA 1USPA 2JA5I 3I4NI 3RZDI 2JA8I 1ML8A 3S14I 3M4OI 1Y1WI 4A3JI 3U50C 3HOYI 2NVXI 4NBFA 3Q87A 4A3LI 2YU9I 2E2II 1TFIA 4NBBA 5IP9I 3GTLI 4A3MI 2B63I 5C44I 4X6AI 1PFTA 5IP7I 5C3EI 3S1NI 4A3CI 4A93I 2RBLA 3S1MI 2KPIA 1USPB 1DL6A 1WW9A 1LQLA 3ESWA 3M3YI 4NBGA 3S17I 4NBDA 3VB9A 3HOWI 3HOVI 5C4JI 2JNYA 4NB8A 3HOXI 4MH4A 1TWAI 2R7ZI 4A3DI 3K7AI 4NBEA 1ZB8A 3I07A 4BY1I 2JA6I 3PO2I 3GTKI 1TWHI 2NVYI 2F4OA 2AKLA 2PK7A 3H3VJ 1TWGI 3S16I 4Y7NI 3GTQI 4BBRI 2F4MA 4A3FI 3HOUI 1X3ZA 1I3QI 3GTGI 2HF1A 3I4MI 3VMHA 1N2FA 2JR6A 2VUMI 4NBHA 2JA7I 3FKII 3S1QI 1TWCI 3GKQA 5FLMI 4BBSI 4A3EI 2DE6A 3D6WA 2E2JI 3S2DI 3S2HI 3GTJI 4NB9A 3GTPI 3CQZI 3H0GI 1YUAA 3VMGA 1SFOI 2BJOA 2J6AA 2R93I 4A3KI 1X3WA 1VLAA 4BXXI 3RZOI 4NOZA 2DE7A 4Y52I 3S15I 1I6HI 2R92I 1ZB9A 3GCFA 3EERA 2K5RA 2NVTI 4NBAA 4BY7I 4XX2A 2DE5A 2JS4A 4A3BI 1Y1VS 1RO4A 2NVQI 4A3GI 3GTMS 3HOZI 2P3YA 4QTUA
chains in the Genus database with same CATH superfamily
3NH4A 3HKZA 1YI2Z 1RLYA 1ZH1A 1L1OC 3S1RI 3PO3S 2LEXA 3VMIA 1NUIA 2PMZA 1QVGY 1VQP1 3CPWY 1TWFI 3J7A4 5IT9f 2JA5I 3I4NI 2JA8I 3NDIA 1K8A2 5AN9F 1ML8A 2VPYA 1Y1WI 1Q862 2AYDA 3U50C 2RPRA 3VTNA 2NVXI 4A3LI 2YU9I 1VQ41 4NBBA 1WJ2A 4E2ZA 4RS4A 4NFRA 5C44I 1YITZ 2Y0SA 2JMOA 2OZKA 1YIT1 1LQLA 2VUGA 3VB9A 3HOVI 1YHQ1 3BG1B 4DK1A 1TWAI 1WIIA 1X0TA 1K732 3G711 3KIFA 3GTKI 5A2Qb 1Q821 2QR1B 2LFUA 1YJNZ 2F4MA 1I3QI 3GTGI 1M1K1 3I4MI 5D1OA 3IX0A 1YJN1 3VMHA 3CCS1 3FKII 4E31A 3MZLB 1Z02A 3D9XA 2DE6A 3D6WA 3S2HI 1QVFY 3CMEZ 3GTJI 2V8IA 1JWHC 2J6AA 3CME1 1VLAA 4BXXI 3RZOI 5D1PA 4S1TA 4RV9A 2K5RA 1WZNA 1VQMZ 4E32A 3CPWZ 2JIQA 2RHBA 3HOZI 1VQM1 4DGLA 3NH8A 2P3YA 1Y1VI 2O53A 1SIWA 4QTTA 2JIOA 1VQ8Z 3GTOI 3CC4Z 5CM2M 2G2KA 3J81b 1R9TI 3CCV1 3CCJZ 3TDHB 3CCJ1 2QLVB 3CCQZ 4RVDA 3HOYI 2V8KA 3CXCY 3CCU1 3CCQ1 1NJI2 4A3MI 2RIQA 4RVGA 3J80b 3CCRZ 3S1NI 5FLXf 4A3CI 4A93I 2RBLA 3T4NB 1USPB 2JIMA 1VQPZ 3CCR1 3JAMf 1WW9A 1S7MA 3ESWA 1K8A1 4NBGA 2NAPA 4NBDA 2PM9A 2JIPA 1VQ4Z 3D2LA 3HOXI 4MH4A 5T64A 1YJW1 4BY1I 2JA6I 1KD11 2F4OA 2JUBA 5D1OB 3H3VJ 1TWGI 2WB1A 4Y7NI 1QVFZ 3GTQI 1N8R2 3IFUA 1X3ZA 3CD61 3QWUA 2HF1A 2GTIA 1YHQZ 2VUMI 3CCEZ 4NBHA 4MD8A 1K9M2 3S1QI 1TWCI 3G71Z 4BBSI 1K731 3CCE1 2YADA 2KI7B 2QEXZ 5IT9b 1SFOI 2R93I 1Q7Y2 4TNUA 2QEX1 1NP6A 3IF8A 3KIHA 4RVHA 4NOZA 4Y52I 1VQNZ 1I6HI 1JJ2Z 3CCSZ 3GCFA 3EERA 2M48A 2Q4ZA 2E7ZA 4BY7I 3P5JB 1VQN1 3F3FC 4A3BI 1Y1VS 3NH5A 4A3GI 2VPXA 4E2XA 3BG0B 3G4S1 2QRDB 2QKDA 2IZ4A 2I3CA 3LUSA 3NFZA 4A3II 1YUKA 1I50I 1VQO1 1K83I 4NBCA 3TE5B 1VQKZ 3RZDI 1M1K2 1KQSY 3S14I 1KC82 1VQ51 3M4OI 4A3JI 1VQK1 1QVGZ 5T6BA 3Q87A 2VF1A 2QRCB 1RQFA 3OW2Y 4AYBA 1Y8CA 2OOXB 2KPIA 3CCVZ 3IR7A 3CCLZ 2OOYB 3CMAZ 2M6NA 2GTHA 3M3YI 3CCL1 4HH4A 2QA41 3FQMA 4EWCA 3CMA1 3CCUZ 3CCMZ 1VQ6Z 1NJI1 1W2BY 2OTJZ 2R7ZI 1M902 2W03A 3K7AI 1ZB8A 3I07A 3PO2I 1YJ91 3CCM1 1VQ61 2NVYI 1Q812 2OTJ1 2PK7A 3I55Z 3S16I 4BBRI 3I551 4A3FI 3HOUI 3CC71 4E30A 2W04A 2V8JA 4E2WA 1YIJZ 1Q861 5LL6f 1AA6A 1YJWZ 2JIRA 3GKQA 2ZAEB 4MONA 4A3EI 1Z01A 1YIJ1 2E2JI 3S2DI 3GTPI 1YUAA 2V45A 2H85A 1N8R1 2WAQA 1VQ7Z 1Z03A 3FQQA 4A3KI 3CD6Z 1VQLZ 1YI21 1X3WA 4HGZA 2EGTA 1FDIA 3S15I 1VQ71 1ZB9A 2O4HA 5A2Qf 2P28A 1K9M1 1VQL1 2VPWA 2NVTI 4MD9A 1FDOA 5FLXb 1RNIA 1QF8A 2JS4A 1RO4A 2QREB 5T67A 1KQSZ 3JAMb 4QTUA 2Q51A 3GTMI 1QYPA 1Q7Y1 1KD12 2E2HI 4E33A 1WCMI 2VPZA 3OW2Z 3PO3I 5C4XI 1P9NA 3EEDA 1USPA 2HU9A 3G4SZ 4MXUA 4NBFA 2E2II 1TFIA 2V3VA 5IP9I 3GTLI 2B63I 4X6AI 1PFTA 5IP7I 5C3EI 2LIYA 3S1MI 1W2BZ 1VQOZ 1Q822 3CXCZ 1DL6A 2IZ3A 1VQ5Z 4RVFA 1KC81 3MONA 1RO0A 4DQYB 3S17I 4NH1C 3NDJA 3I56Z 3J81f 3HOWI 5C4JI 2JNYA 2GU2A 4NB8A 2R6MA 3I561 4A3DI 4MRIA 4NBEA 1RO2A 1TWHI 1Q16A 2AKLA 2K3RA 4CL1A 4E2YA 3MZKB 3J80f 2E9HA 2QA4Z 1N2FA 2JR6A 2JA7I 2RT9A 5FLMI 1M901 1S72Z 1YJ9Z 1KRLA 1Q811 4NB9A 3CQZI 2IV2X 1JJ2Y 1S721 3H0GI 4MD7A 3VMGA 3F3PC 2BJOA 3CC7Z 1VQ81 3CC2Z 3CC41 1QXFA 2DE7A 2R92I 1VQ9Z 3CC21 3G6EZ 4NBAA 4HGYA 2OTLZ 4XX2A 1VQ91 2DE5A 2NVQI 3G6E1 3GTMS 2OTL1
chains in the Genus database with same CATH topology
3NH4A 3HKZA 1YI2Z 1RLYA 1ZH1A 1L1OC 3S1RI 3PO3S 3VMIA 1NUIA 2PMZA 1QVGY 1VQP1 3CPWY 1TWFI 3J7A4 5IT9f 2JA5I 3I4NI 2JA8I 3NDIA 1K8A2 5AN9F 1ML8A 1Y1WI 1Q862 3U50C 2RPRA 3VTNA 2NVXI 4A3LI 2YU9I 1VQ41 4NBBA 4E2ZA 4RS4A 4NFRA 5C44I 1YITZ 2Y0SA 2JMOA 2OZKA 1YIT1 1LQLA 2VUGA 3VB9A 3HOVI 1YHQ1 3BG1B 4DK1A 1TWAI 1WIIA 1X0TA 1K732 3G711 3KIFA 3GTKI 5A2Qb 1Q821 2QR1B 2LFUA 1YJNZ 2F4MA 1I3QI 3GTGI 1M1K1 3I4MI 5D1OA 3IX0A 1YJN1 3VMHA 3CCS1 3FKII 4E31A 3MZLB 1Z02A 3D9XA 2DE6A 3D6WA 3S2HI 1QVFY 3CMEZ 3GTJI 2V8IA 1JWHC 2J6AA 3CME1 1VLAA 4BXXI 3RZOI 5D1PA 4S1TA 4RV9A 2K5RA 1VQMZ 4E32A 3CPWZ 2RHBA 3HOZI 1VQM1 4DGLA 3NH8A 2P3YA 1Y1VI 2O53A 4QTTA 1VQ8Z 3GTOI 3CC4Z 5CM2M 2G2KA 3J81b 1R9TI 3CCV1 3CCJZ 3TDHB 3CCJ1 2QLVB 3CCQZ 4RVDA 3HOYI 2V8KA 3CXCY 3CCU1 3CCQ1 1NJI2 4A3MI 2RIQA 4RVGA 3J80b 3CCRZ 3S1NI 5FLXf 4A3CI 4A93I 2RBLA 3T4NB 1USPB 1VQPZ 3CCR1 3JAMf 1WW9A 1S7MA 3ESWA 1K8A1 4NBGA 4NBDA 2PM9A 1VQ4Z 3HOXI 4MH4A 5T64A 1YJW1 4BY1I 2JA6I 1KD11 2F4OA 2JUBA 5D1OB 3H3VJ 1TWGI 2WB1A 4Y7NI 1QVFZ 3GTQI 1N8R2 3IFUA 1X3ZA 3CD61 3QWUA 2HF1A 2GTIA 1YHQZ 2VUMI 3CCEZ 4NBHA 4MD8A 1K9M2 3S1QI 1TWCI 3G71Z 4BBSI 1K731 3CCE1 2YADA 2KI7B 2QEXZ 5IT9b 1SFOI 2R93I 1Q7Y2 4TNUA 2QEX1 1NP6A 3IF8A 3KIHA 4RVHA 4NOZA 4Y52I 1VQNZ 1I6HI 1JJ2Z 3CCSZ 3GCFA 3EERA 2M48A 2Q4ZA 4BY7I 3P5JB 1VQN1 3F3FC 4A3BI 1Y1VS 3NH5A 4A3GI 4E2XA 3BG0B 3G4S1 2QRDB 2QKDA 2IZ4A 2I3CA 3LUSA 3NFZA 4A3II 1YUKA 1I50I 1VQO1 1K83I 4NBCA 3TE5B 1VQKZ 3RZDI 1M1K2 1KQSY 3S14I 1KC82 1VQ51 3M4OI 4A3JI 1VQK1 1QVGZ 5T6BA 3Q87A 2VF1A 2QRCB 1RQFA 3OW2Y 4AYBA 2OOXB 2KPIA 3CCVZ 3CCLZ 2OOYB 3CMAZ 2M6NA 2GTHA 3M3YI 3CCL1 4HH4A 2QA41 3FQMA 4EWCA 3CMA1 3CCUZ 3CCMZ 1VQ6Z 1NJI1 1W2BY 2OTJZ 2R7ZI 1M902 2W03A 3K7AI 1ZB8A 3I07A 3PO2I 1YJ91 3CCM1 1VQ61 2NVYI 1Q812 2OTJ1 2PK7A 3I55Z 3S16I 4BBRI 3I551 4A3FI 3HOUI 3CC71 4E30A 2W04A 2V8JA 4E2WA 1YIJZ 1Q861 5LL6f 1YJWZ 3GKQA 2ZAEB 4MONA 4A3EI 1Z01A 1YIJ1 2E2JI 3S2DI 3GTPI 1YUAA 2H85A 1N8R1 2WAQA 1VQ7Z 1Z03A 3FQQA 4A3KI 3CD6Z 1VQLZ 1YI21 1X3WA 4HGZA 2EGTA 3S15I 1VQ71 1ZB9A 2O4HA 5A2Qf 2P28A 1K9M1 1VQL1 2NVTI 4MD9A 5FLXb 1RNIA 1QF8A 2JS4A 1RO4A 2QREB 5T67A 1KQSZ 3JAMb 4QTUA 2Q51A 3GTMI 1QYPA 1Q7Y1 1KD12 2E2HI 4E33A 1WCMI 3OW2Z 3PO3I 5C4XI 1P9NA 3EEDA 1USPA 2HU9A 3G4SZ 4MXUA 4NBFA 2E2II 1TFIA 5IP9I 3GTLI 2B63I 4X6AI 1PFTA 5IP7I 5C3EI 2LIYA 3S1MI 1W2BZ 1VQOZ 1Q822 3CXCZ 1DL6A 2IZ3A 1VQ5Z 4RVFA 1KC81 3MONA 1RO0A 4DQYB 3S17I 4NH1C 3NDJA 3I56Z 3J81f 3HOWI 5C4JI 2JNYA 2GU2A 4NB8A 2R6MA 3I561 4A3DI 4MRIA 4NBEA 1RO2A 1TWHI 2AKLA 2K3RA 4CL1A 4E2YA 3MZKB 3J80f 2E9HA 2QA4Z 1N2FA 2JR6A 2JA7I 2RT9A 5FLMI 1M901 1S72Z 1YJ9Z 1KRLA 1Q811 4NB9A 3CQZI 1JJ2Y 1S721 3H0GI 4MD7A 3VMGA 3F3PC 2BJOA 3CC7Z 1VQ81 3CC2Z 3CC41 2DE7A 2R92I 1VQ9Z 3CC21 3G6EZ 4NBAA 4HGYA 2OTLZ 4XX2A 1VQ91 2DE5A 2NVQI 3G6E1 3GTMS 2OTL1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V I;  4QTT A;  3GTM I;  1QYP A;  1RLY A;  3GTO I;  1L1O C;  3S1R I;  5CM2 M;  3PO3 S;  2E2H I;  3LUS A;  1WCM I;  3VMI A;  1R9T I;  4A3I I;  1NUI A;  1I50 I;  3PO3 I;  1TWF I;  5C4X I;  1K83 I;  4NBC A;  1USP A;  2JA5 I;  3I4N I;  3RZD I;  2JA8 I;  1ML8 A;  3S14 I;  3M4O I;  1Y1W I;  4A3J I;  3U50 C;  3HOY I;  2NVX I;  4NBF A;  3Q87 A;  4A3L I;  2YU9 I;  2E2I I;  1TFI A;  4NBB A;  5IP9 I;  3GTL I;  4A3M I;  2B63 I;  5C44 I;  4X6A I;  1PFT A;  5IP7 I;  5C3E I;  3S1N I;  4A3C I;  4A93 I;  2RBL A;  3S1M I;  2KPI A;  1USP B;  1DL6 A;  1WW9 A;  1LQL A;  3ESW A;  3M3Y I;  4NBG A;  3S17 I;  4NBD A;  3VB9 A;  3HOW I;  3HOV I;  5C4J I;  2JNY A;  4NB8 A;  3HOX I;  4MH4 A;  1TWA I;  2R7Z I;  4A3D I;  3K7A I;  4NBE A;  1ZB8 A;  3I07 A;  4BY1 I;  2JA6 I;  3PO2 I;  3GTK I;  1TWH I;  2NVY I;  2F4O A;  2AKL A;  2PK7 A;  3H3V J;  1TWG I;  3S16 I;  4Y7N I;  3GTQ I;  4BBR I;  2F4M A;  4A3F I;  3HOU I;  1X3Z A;  1I3Q I;  3GTG I;  2HF1 A;  3I4M I;  3VMH A;  1N2F A;  2JR6 A;  2VUM I;  4NBH A;  2JA7 I;  3FKI I;  3S1Q I;  1TWC I;  3GKQ A;  5FLM I;  4BBS I;  4A3E I;  2DE6 A;  3D6W A;  2E2J I;  3S2D I;  3S2H I;  3GTJ I;  4NB9 A;  3GTP I;  3CQZ I;  3H0G I;  1YUA A;  3VMG A;  1SFO I;  2BJO A;  2J6A A;  2R93 I;  4A3K I;  1X3W A;  1VLA A;  4BXX I;  3RZO I;  4NOZ A;  2DE7 A;  4Y52 I;  3S15 I;  1I6H I;  2R92 I;  1ZB9 A;  3GCF A;  3EER A;  2K5R A;  2NVT I;  4NBA A;  4BY7 I;  4XX2 A;  2DE5 A;  2JS4 A;  4A3B I;  1Y1V S;  1RO4 A;  2NVQ I;  4A3G I;  3GTM S;  3HOZ I;  2P3Y A;  4QTU A; 
#chains in the Genus database with same CATH topology
 3NH4 A;  3HKZ A;  1YI2 Z;  1RLY A;  1ZH1 A;  1L1O C;  3S1R I;  3PO3 S;  2LEX A;  3VMI A;  1NUI A;  2PMZ A;  1QVG Y;  1VQP 1;  3CPW Y;  1TWF I;  3J7A 4;  5IT9 f;  2JA5 I;  3I4N I;  2JA8 I;  3NDI A;  1K8A 2;  5AN9 F;  1ML8 A;  2VPY A;  1Y1W I;  1Q86 2;  2AYD A;  3U50 C;  2RPR A;  3VTN A;  2NVX I;  4A3L I;  2YU9 I;  1VQ4 1;  4NBB A;  1WJ2 A;  4E2Z A;  4RS4 A;  4NFR A;  5C44 I;  1YIT Z;  2Y0S A;  2JMO A;  2OZK A;  1YIT 1;  1LQL A;  2VUG A;  3VB9 A;  3HOV I;  1YHQ 1;  3BG1 B;  4DK1 A;  1TWA I;  1WII A;  1X0T A;  1K73 2;  3G71 1;  3KIF A;  3GTK I;  5A2Q b;  1Q82 1;  2QR1 B;  2LFU A;  1YJN Z;  2F4M A;  1I3Q I;  3GTG I;  1M1K 1;  3I4M I;  5D1O A;  3IX0 A;  1YJN 1;  3VMH A;  3CCS 1;  3FKI I;  4E31 A;  3MZL B;  1Z02 A;  3D9X A;  2DE6 A;  3D6W A;  3S2H I;  1QVF Y;  3CME Z;  3GTJ I;  2V8I A;  1JWH C;  2J6A A;  3CME 1;  1VLA A;  4BXX I;  3RZO I;  5D1P A;  4S1T A;  4RV9 A;  2K5R A;  1WZN A;  1VQM Z;  4E32 A;  3CPW Z;  2JIQ A;  2RHB A;  3HOZ I;  1VQM 1;  4DGL A;  3NH8 A;  2P3Y A;  1Y1V I;  2O53 A;  1SIW A;  4QTT A;  2JIO A;  1VQ8 Z;  3GTO I;  3CC4 Z;  5CM2 M;  2G2K A;  3J81 b;  1R9T I;  3CCV 1;  3CCJ Z;  3TDH B;  3CCJ 1;  2QLV B;  3CCQ Z;  4RVD A;  3HOY I;  2V8K A;  3CXC Y;  3CCU 1;  3CCQ 1;  1NJI 2;  4A3M I;  2RIQ A;  4RVG A;  3J80 b;  3CCR Z;  3S1N I;  5FLX f;  4A3C I;  4A93 I;  2RBL A;  3T4N B;  1USP B;  2JIM A;  1VQP Z;  3CCR 1;  3JAM f;  1WW9 A;  1S7M A;  3ESW A;  1K8A 1;  4NBG A;  2NAP A;  4NBD A;  2PM9 A;  2JIP A;  1VQ4 Z;  3D2L A;  3HOX I;  4MH4 A;  5T64 A;  1YJW 1;  4BY1 I;  2JA6 I;  1KD1 1;  2F4O A;  2JUB A;  5D1O B;  3H3V J;  1TWG I;  2WB1 A;  4Y7N I;  1QVF Z;  3GTQ I;  1N8R 2;  3IFU A;  1X3Z A;  3CD6 1;  3QWU A;  2HF1 A;  2GTI A;  1YHQ Z;  2VUM I;  3CCE Z;  4NBH A;  4MD8 A;  1K9M 2;  3S1Q I;  1TWC I;  3G71 Z;  4BBS I;  1K73 1;  3CCE 1;  2YAD A;  2KI7 B;  2QEX Z;  5IT9 b;  1SFO I;  2R93 I;  1Q7Y 2;  4TNU A;  2QEX 1;  1NP6 A;  3IF8 A;  3KIH A;  4RVH A;  4NOZ A;  4Y52 I;  1VQN Z;  1I6H I;  1JJ2 Z;  3CCS Z;  3GCF A;  3EER A;  2M48 A;  2Q4Z A;  2E7Z A;  4BY7 I;  3P5J B;  1VQN 1;  3F3F C;  4A3B I;  1Y1V S;  3NH5 A;  4A3G I;  2VPX A;  4E2X A;  3BG0 B;  3G4S 1;  2QRD B;  2QKD A;  2IZ4 A;  2I3C A;  3LUS A;  3NFZ A;  4A3I I;  1YUK A;  1I50 I;  1VQO 1;  1K83 I;  4NBC A;  3TE5 B;  1VQK Z;  3RZD I;  1M1K 2;  1KQS Y;  3S14 I;  1KC8 2;  1VQ5 1;  3M4O I;  4A3J I;  1VQK 1;  1QVG Z;  5T6B A;  3Q87 A;  2VF1 A;  2QRC B;  1RQF A;  3OW2 Y;  4AYB A;  1Y8C A;  2OOX B;  2KPI A;  3CCV Z;  3IR7 A;  3CCL Z;  2OOY B;  3CMA Z;  2M6N A;  2GTH A;  3M3Y I;  3CCL 1;  4HH4 A;  2QA4 1;  3FQM A;  4EWC A;  3CMA 1;  3CCU Z;  3CCM Z;  1VQ6 Z;  1NJI 1;  1W2B Y;  2OTJ Z;  2R7Z I;  1M90 2;  2W03 A;  3K7A I;  1ZB8 A;  3I07 A;  3PO2 I;  1YJ9 1;  3CCM 1;  1VQ6 1;  2NVY I;  1Q81 2;  2OTJ 1;  2PK7 A;  3I55 Z;  3S16 I;  4BBR I;  3I55 1;  4A3F I;  3HOU I;  3CC7 1;  4E30 A;  2W04 A;  2V8J A;  4E2W A;  1YIJ Z;  1Q86 1;  5LL6 f;  1AA6 A;  1YJW Z;  2JIR A;  3GKQ A;  2ZAE B;  4MON A;  4A3E I;  1Z01 A;  1YIJ 1;  2E2J I;  3S2D I;  3GTP I;  1YUA A;  2V45 A;  2H85 A;  1N8R 1;  2WAQ A;  1VQ7 Z;  1Z03 A;  3FQQ A;  4A3K I;  3CD6 Z;  1VQL Z;  1YI2 1;  1X3W A;  4HGZ A;  2EGT A;  1FDI A;  3S15 I;  1VQ7 1;  1ZB9 A;  2O4H A;  5A2Q f;  2P28 A;  1K9M 1;  1VQL 1;  2VPW A;  2NVT I;  4MD9 A;  1FDO A;  5FLX b;  1RNI A;  1QF8 A;  2JS4 A;  1RO4 A;  2QRE B;  5T67 A;  1KQS Z;  3JAM b;  4QTU A;  2Q51 A;  3GTM I;  1QYP A;  1Q7Y 1;  1KD1 2;  2E2H I;  4E33 A;  1WCM I;  2VPZ A;  3OW2 Z;  3PO3 I;  5C4X I;  1P9N A;  3EED A;  1USP A;  2HU9 A;  3G4S Z;  4MXU A;  4NBF A;  2E2I I;  1TFI A;  2V3V A;  5IP9 I;  3GTL I;  2B63 I;  4X6A I;  1PFT A;  5IP7 I;  5C3E I;  2LIY A;  3S1M I;  1W2B Z;  1VQO Z;  1Q82 2;  3CXC Z;  1DL6 A;  2IZ3 A;  1VQ5 Z;  4RVF A;  1KC8 1;  3MON A;  1RO0 A;  4DQY B;  3S17 I;  4NH1 C;  3NDJ A;  3I56 Z;  3J81 f;  3HOW I;  5C4J I;  2JNY A;  2GU2 A;  4NB8 A;  2R6M A;  3I56 1;  4A3D I;  4MRI A;  4NBE A;  1RO2 A;  1TWH I;  1Q16 A;  2AKL A;  2K3R A;  4CL1 A;  4E2Y A;  3MZK B;  3J80 f;  2E9H A;  2QA4 Z;  1N2F A;  2JR6 A;  2JA7 I;  2RT9 A;  5FLM I;  1M90 1;  1S72 Z;  1YJ9 Z;  1KRL A;  1Q81 1;  4NB9 A;  3CQZ I;  2IV2 X;  1JJ2 Y;  1S72 1;  3H0G I;  4MD7 A;  3VMG A;  3F3P C;  2BJO A;  3CC7 Z;  1VQ8 1;  3CC2 Z;  3CC4 1;  1QXF A;  2DE7 A;  2R92 I;  1VQ9 Z;  3CC2 1;  3G6E Z;  4NBA A;  4HGY A;  2OTL Z;  4XX2 A;  1VQ9 1;  2DE5 A;  2NVQ I;  3G6E 1;  3GTM S;  2OTL 1; 
#chains in the Genus database with same CATH homology
 3NH4 A;  3HKZ A;  1YI2 Z;  1RLY A;  1ZH1 A;  1L1O C;  3S1R I;  3PO3 S;  3VMI A;  1NUI A;  2PMZ A;  1QVG Y;  1VQP 1;  3CPW Y;  1TWF I;  3J7A 4;  5IT9 f;  2JA5 I;  3I4N I;  2JA8 I;  3NDI A;  1K8A 2;  5AN9 F;  1ML8 A;  1Y1W I;  1Q86 2;  3U50 C;  2RPR A;  3VTN A;  2NVX I;  4A3L I;  2YU9 I;  1VQ4 1;  4NBB A;  4E2Z A;  4RS4 A;  4NFR A;  5C44 I;  1YIT Z;  2Y0S A;  2JMO A;  2OZK A;  1YIT 1;  1LQL A;  2VUG A;  3VB9 A;  3HOV I;  1YHQ 1;  3BG1 B;  4DK1 A;  1TWA I;  1WII A;  1X0T A;  1K73 2;  3G71 1;  3KIF A;  3GTK I;  5A2Q b;  1Q82 1;  2QR1 B;  2LFU A;  1YJN Z;  2F4M A;  1I3Q I;  3GTG I;  1M1K 1;  3I4M I;  5D1O A;  3IX0 A;  1YJN 1;  3VMH A;  3CCS 1;  3FKI I;  4E31 A;  3MZL B;  1Z02 A;  3D9X A;  2DE6 A;  3D6W A;  3S2H I;  1QVF Y;  3CME Z;  3GTJ I;  2V8I A;  1JWH C;  2J6A A;  3CME 1;  1VLA A;  4BXX I;  3RZO I;  5D1P A;  4S1T A;  4RV9 A;  2K5R A;  1VQM Z;  4E32 A;  3CPW Z;  2RHB A;  3HOZ I;  1VQM 1;  4DGL A;  3NH8 A;  2P3Y A;  1Y1V I;  2O53 A;  4QTT A;  1VQ8 Z;  3GTO I;  3CC4 Z;  5CM2 M;  2G2K A;  3J81 b;  1R9T I;  3CCV 1;  3CCJ Z;  3TDH B;  3CCJ 1;  2QLV B;  3CCQ Z;  4RVD A;  3HOY I;  2V8K A;  3CXC Y;  3CCU 1;  3CCQ 1;  1NJI 2;  4A3M I;  2RIQ A;  4RVG A;  3J80 b;  3CCR Z;  3S1N I;  5FLX f;  4A3C I;  4A93 I;  2RBL A;  3T4N B;  1USP B;  1VQP Z;  3CCR 1;  3JAM f;  1WW9 A;  1S7M A;  3ESW A;  1K8A 1;  4NBG A;  4NBD A;  2PM9 A;  1VQ4 Z;  3HOX I;  4MH4 A;  5T64 A;  1YJW 1;  4BY1 I;  2JA6 I;  1KD1 1;  2F4O A;  2JUB A;  5D1O B;  3H3V J;  1TWG I;  2WB1 A;  4Y7N I;  1QVF Z;  3GTQ I;  1N8R 2;  3IFU A;  1X3Z A;  3CD6 1;  3QWU A;  2HF1 A;  2GTI A;  1YHQ Z;  2VUM I;  3CCE Z;  4NBH A;  4MD8 A;  1K9M 2;  3S1Q I;  1TWC I;  3G71 Z;  4BBS I;  1K73 1;  3CCE 1;  2YAD A;  2KI7 B;  2QEX Z;  5IT9 b;  1SFO I;  2R93 I;  1Q7Y 2;  4TNU A;  2QEX 1;  1NP6 A;  3IF8 A;  3KIH A;  4RVH A;  4NOZ A;  4Y52 I;  1VQN Z;  1I6H I;  1JJ2 Z;  3CCS Z;  3GCF A;  3EER A;  2M48 A;  2Q4Z A;  4BY7 I;  3P5J B;  1VQN 1;  3F3F C;  4A3B I;  1Y1V S;  3NH5 A;  4A3G I;  4E2X A;  3BG0 B;  3G4S 1;  2QRD B;  2QKD A;  2IZ4 A;  2I3C A;  3LUS A;  3NFZ A;  4A3I I;  1YUK A;  1I50 I;  1VQO 1;  1K83 I;  4NBC A;  3TE5 B;  1VQK Z;  3RZD I;  1M1K 2;  1KQS Y;  3S14 I;  1KC8 2;  1VQ5 1;  3M4O I;  4A3J I;  1VQK 1;  1QVG Z;  5T6B A;  3Q87 A;  2VF1 A;  2QRC B;  1RQF A;  3OW2 Y;  4AYB A;  2OOX B;  2KPI A;  3CCV Z;  3CCL Z;  2OOY B;  3CMA Z;  2M6N A;  2GTH A;  3M3Y I;  3CCL 1;  4HH4 A;  2QA4 1;  3FQM A;  4EWC A;  3CMA 1;  3CCU Z;  3CCM Z;  1VQ6 Z;  1NJI 1;  1W2B Y;  2OTJ Z;  2R7Z I;  1M90 2;  2W03 A;  3K7A I;  1ZB8 A;  3I07 A;  3PO2 I;  1YJ9 1;  3CCM 1;  1VQ6 1;  2NVY I;  1Q81 2;  2OTJ 1;  2PK7 A;  3I55 Z;  3S16 I;  4BBR I;  3I55 1;  4A3F I;  3HOU I;  3CC7 1;  4E30 A;  2W04 A;  2V8J A;  4E2W A;  1YIJ Z;  1Q86 1;  5LL6 f;  1YJW Z;  3GKQ A;  2ZAE B;  4MON A;  4A3E I;  1Z01 A;  1YIJ 1;  2E2J I;  3S2D I;  3GTP I;  1YUA A;  2H85 A;  1N8R 1;  2WAQ A;  1VQ7 Z;  1Z03 A;  3FQQ A;  4A3K I;  3CD6 Z;  1VQL Z;  1YI2 1;  1X3W A;  4HGZ A;  2EGT A;  3S15 I;  1VQ7 1;  1ZB9 A;  2O4H A;  5A2Q f;  2P28 A;  1K9M 1;  1VQL 1;  2NVT I;  4MD9 A;  5FLX b;  1RNI A;  1QF8 A;  2JS4 A;  1RO4 A;  2QRE B;  5T67 A;  1KQS Z;  3JAM b;  4QTU A;  2Q51 A;  3GTM I;  1QYP A;  1Q7Y 1;  1KD1 2;  2E2H I;  4E33 A;  1WCM I;  3OW2 Z;  3PO3 I;  5C4X I;  1P9N A;  3EED A;  1USP A;  2HU9 A;  3G4S Z;  4MXU A;  4NBF A;  2E2I I;  1TFI A;  5IP9 I;  3GTL I;  2B63 I;  4X6A I;  1PFT A;  5IP7 I;  5C3E I;  2LIY A;  3S1M I;  1W2B Z;  1VQO Z;  1Q82 2;  3CXC Z;  1DL6 A;  2IZ3 A;  1VQ5 Z;  4RVF A;  1KC8 1;  3MON A;  1RO0 A;  4DQY B;  3S17 I;  4NH1 C;  3NDJ A;  3I56 Z;  3J81 f;  3HOW I;  5C4J I;  2JNY A;  2GU2 A;  4NB8 A;  2R6M A;  3I56 1;  4A3D I;  4MRI A;  4NBE A;  1RO2 A;  1TWH I;  2AKL A;  2K3R A;  4CL1 A;  4E2Y A;  3MZK B;  3J80 f;  2E9H A;  2QA4 Z;  1N2F A;  2JR6 A;  2JA7 I;  2RT9 A;  5FLM I;  1M90 1;  1S72 Z;  1YJ9 Z;  1KRL A;  1Q81 1;  4NB9 A;  3CQZ I;  1JJ2 Y;  1S72 1;  3H0G I;  4MD7 A;  3VMG A;  3F3P C;  2BJO A;  3CC7 Z;  1VQ8 1;  3CC2 Z;  3CC4 1;  2DE7 A;  2R92 I;  1VQ9 Z;  3CC2 1;  3G6E Z;  4NBA A;  4HGY A;  2OTL Z;  4XX2 A;  1VQ9 1;  2DE5 A;  2NVQ I;  3G6E 1;  3GTM S;  2OTL 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...