1NJI1

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1nji100
1K731 3I561 3G4S1 3CPWZ 1KQSY 3CCJ1 1YITZ 3CD61 1Q822 1M901 1YJ91 1VQ41 1VQ5Z 2OTJZ 3G6EZ 1NJI2 1VQ6Z 1YHQZ 3CXCY 3CMEZ 1Q7Y2 1Q862 1VQP1 1YIJ1 3I56Z 1YIT1 3CC7Z 1VQN1 1KC82 3CC41 3CPWY 1S72Z 3CC2Z 3CCR1 1YJ9Z 3I551 1VQ51 3G6E1 1VQ61 2QA4Z 1YHQ1 1K8A2 1VQPZ 1YIJZ 1VQ8Z 1YJNZ 3CC71 1VQNZ 3CC4Z 1S721 3CC21 1YJWZ 3CCRZ 2OTLZ 3I55Z 2QA41 1M1K2 1KD11 3CCLZ 3CCSZ 1VQ81 1Q812 1YJN1 3CCEZ 1VQM1 1YJW1 2OTL1 2QEXZ 1Q821 3OW2Y 1QVFZ 3CMAZ 1W2BY 3CCL1 1NJI1 1VQOZ 1VQ9Z 3CCS1 1Q7Y1 1K732 3OW2Z 3CCE1 1VQMZ 1W2BZ 2QEX1 1QVGY 1JJ2Z 1M902 3CMA1 3CCQ1 1VQO1 1K9M1 1VQ91 1KD12 1N8R1 1QVFY 1QVGZ 3CCU1 1VQ71 3CCQZ 1VQK1 1YI2Z 1VQLZ 1JJ2Y 3CCMZ 1M1K1 1Q861 1KQSZ 3G711 3CCVZ 1Q811 3CCUZ 3G4SZ 1KC81 3CCJZ 1VQ7Z 3CD6Z 1VQKZ 3CXCZ 1YI21 1VQL1 3CCM1 1VQ4Z 2OTJ1 1K8A1 1K9M2 1N8R2 3G71Z 3CME1 3CCV1
chains in the Genus database with same CATH superfamily
1K731 3G4S1 3S14I 2J6AA 2PMZA 2NVYI 1I6HI 1VQ41 3D2LA 1NJI2 4NOZA 1Z02A 1ZH1A 1YHQZ 2RPRA 3CMEZ 1Q7Y2 1ML8A 1WW9A 3J80b 1YIJ1 2QRCB 5C44I 3LUSA 4E33A 3CC41 3MZKB 1S72Z 2QA4Z 2VPXA 4XX2A 1PFTA 2EGTA 4NBBA 4Y52I 1YIJZ 3MONA 1ZB8A 1QF8A 3CC4Z 3CC21 2IV2X 1YJWZ 4QTUA 2P28A 1M1K2 1KD11 3JAMb 2VPWA 4NH1C 4TNUA 4RV9A 3GTPI 3S1QI 3EEDA 3CCEZ 1RO0A 5FLMI 4RS4A 2HU9A 2Q4ZA 4HGZA 4NBCA 5T64A 3HOXI 1W2BY 3CCL1 1NJI1 3CCS1 1Z01A 1Q7Y1 5A2Qf 3S2HI 3Q87A 3VMHA 2QEX1 1NP6A 3BG0B 3PO3I 1ZB9A 1K9M1 1DL6A 3BG1B 2JUBA 2W03A 2JIPA 4BY1I 2JIQA 3H0GI 2JA6I 3K7AI 3CCU1 2VPZA 4E32A 2VUGA 2PM9A 4BBSI 1VQ71 4MD9A 2BJOA 3QWUA 2H85A 3CCMZ 3EERA 4RVFA 1M1K1 2NVQI 4MD8A 1LQLA 3G711 4NB9A 3CCVZ 3NH8A 1X3WA 3CCUZ 4EWCA 3J81b 2GTIA 3CCJZ 1VQ7Z 3RZDI 2NVTI 3M4OI 4E31A 5IP9I 2OTJ1 5C4JI 1Q16A 4RVDA 3NH4A 1N8R2 3G71Z 2JNYA 4A3II 4NBDA 5C4XI 3F3PC 1RQFA 4BY7I 5FLXb 1RO4A 1VQ5Z 2OTJZ 3G6EZ 1JWHC 2V3VA 4NBEA 4E30A 2NVXI 1WIIA 1VQN1 1KC82 1YUKA 2JMOA 3CPWY 5LL6f 4Y7NI 1TWHI 2QLVB 1FDIA 1YHQ1 4A3FI 2QKDA 1YJNZ 1Y1VS 2G2KA 3VB9A 1VQNZ 1S721 2OTLZ 2DE6A 2QA41 2V8IA 2VUMI 4NBHA 3GTGI 3I4MI 2NAPA 1FDOA 1Q812 3S16I 1P9NA 2YU9I 4BXXI 1VQM1 3HOWI 1YJW1 2LEXA 3OW2Y 1Y1VI 2KI7B 4MONA 1VQ9Z 2R92I 2RBLA 3FQQA 2R93I 3CCE1 3IX0A 4RVHA 2Q51A 1VQMZ 1I3QI 1NUIA 2KPIA 2JIMA 4NB8A 2M6NA 3TE5B 3S1RI 2K3RA 5T6BA 3J80f 1QVGZ 4HGYA 3PO3S 2JR6A 4NFRA 2F4MA 2DE7A 1SIWA 1WZNA 5C3EI 3VTNA 1AA6A 1Q811 1VLAA 4A3BI 3JAMf 2R6MA 3CD6Z 3CCM1 2RHBA 3TDHB 5D1PA 4A93I 3CCV1 4E2YA 3T4NB 3NFZA 3I561 3CPWZ 1KQSY 4E2WA 3CCJ1 3IR7A 1YITZ 1Q822 4A3JI 5CM2M 4MRIA 3NH5A 5IT9b 4DGLA 1VQ6Z 3H3VJ 3HOVI 3NDIA 1Q862 3I56Z 2ZAEB 3CC7Z 2DE5A 2OOYB 4A3MI 2JIOA 3I551 1VQ51 3G6E1 1QYPA 4AYBA 2WB1A 1RLYA 3U50C 1K8A2 2Y0SA 2JA5I 3PO2I 4NBAA 4MD7A 1N2FA 4A3LI 1VQ8Z 2E7ZA 3I55Z 3S2DI 2QRDB 4A3GI 3J81f 1YJN1 1RNIA 2OTL1 1S7MA 1Q821 2VF1A 5IP7I 3CMAZ 1Y1WI 4RVGA 1I50I 1VQOZ 1QXFA 1WJ2A 2WAQA 5FLXf 2RIQA 1W2BZ 3J7A4 1M902 2OOXB 2QR1B 1X0TA 3FQMA 2VPYA 2JA7I 1VQ91 1KD12 1N8R1 1QVFY 3KIFA 3GTJI 2E2JI 4QTTA 2JA8I 3GTLI 3GTMS 3S1NI 1VQK1 2E2HI 1YI2Z 1VQLZ 1JJ2Y 5AN9F 1YUAA 3GCFA 1KQSZ 3I07A 3HOUI 1SFOI 3M3YI 3CQZI 2LFUA 3S17I 4A3DI 3G4SZ 1KC81 3VMIA 2QREB 1VQKZ 3HOYI 2F4OA 4MXUA 4A3EI 3GTMI 3IF8A 1VQ4Z 3MZLB 1K9M2 1L1OC 1X3ZA 2R7ZI 2GU2A 2IZ3A 1RO2A 3CD61 5A2Qb 1M901 3I4NI 4S1TA 1YJ91 2AYDA 2LIYA 2V45A 3P5JB 1WCMI 3CXCY 3HOZI 3RZOI 4HH4A 1VQP1 4A3CI 1YIT1 1TWGI 2PK7A 3CC2Z 3CCR1 4CL1A 1YJ9Z 1VQ61 5D1OB 2RT9A 4E2ZA 3GTKI 2O53A 2O4HA 3F3FC 1VQPZ 2JS4A 2K5RA 3D6WA 1TWCI 5T67A 1TFIA 3CC71 1K83I 4X6AI 2GTHA 5D1OA 3CCRZ 3KIHA 3IFUA 4NBGA 3D9XA 3ESWA 3CCLZ 3CCSZ 1Z03A 2I3CA 1TWFI 4E2XA 1VQ81 2QEXZ 2V8JA 3GKQA 1QVFZ 1KRLA 3NDJA 2E2II 1TWAI 1K732 3OW2Z 5IT9f 2HF1A 1QVGY 1JJ2Z 4DQYB 3CMA1 3CCQ1 2E9HA 2AKLA 4A3KI 1VQO1 1USPB 3S15I 2OZKA 1Y8CA 4NBFA 4BBRI 2IZ4A 2YADA 3GTOI 2W04A 3S1MI 1USPA 3VMGA 3CCQZ 1R9TI 3HKZA 4MH4A 2V8KA 1Q861 3GTQI 2M48A 3FKII 3CXCZ 1YI21 1VQL1 2JIRA 4DK1A 2P3YA 1K8A1 3CME1 2B63I
chains in the Genus database with same CATH topology
1K731 3G4S1 3S14I 2J6AA 2PMZA 2NVYI 1I6HI 1VQ41 1NJI2 4NOZA 1Z02A 1ZH1A 1YHQZ 2RPRA 3CMEZ 1Q7Y2 1ML8A 1WW9A 3J80b 1YIJ1 2QRCB 5C44I 3LUSA 4E33A 3CC41 3MZKB 1S72Z 2QA4Z 4XX2A 1PFTA 2EGTA 4NBBA 4Y52I 1YIJZ 3MONA 1ZB8A 1QF8A 3CC4Z 3CC21 1YJWZ 4QTUA 2P28A 1M1K2 1KD11 3JAMb 4NH1C 4TNUA 4RV9A 3GTPI 3S1QI 3EEDA 3CCEZ 1RO0A 5FLMI 4RS4A 2HU9A 2Q4ZA 4HGZA 4NBCA 5T64A 3HOXI 1W2BY 3CCL1 1NJI1 3CCS1 1Z01A 1Q7Y1 5A2Qf 3S2HI 3Q87A 3VMHA 2QEX1 1NP6A 3BG0B 3PO3I 1ZB9A 1K9M1 1DL6A 3BG1B 2JUBA 2W03A 4BY1I 3H0GI 2JA6I 3K7AI 3CCU1 4E32A 2VUGA 2PM9A 4BBSI 1VQ71 4MD9A 2BJOA 3QWUA 2H85A 3CCMZ 3EERA 4RVFA 1M1K1 2NVQI 4MD8A 1LQLA 3G711 4NB9A 3CCVZ 3NH8A 1X3WA 3CCUZ 4EWCA 3J81b 2GTIA 3CCJZ 1VQ7Z 3RZDI 2NVTI 3M4OI 4E31A 5IP9I 2OTJ1 5C4JI 4RVDA 3NH4A 1N8R2 3G71Z 2JNYA 4A3II 4NBDA 5C4XI 3F3PC 1RQFA 4BY7I 5FLXb 1RO4A 1VQ5Z 2OTJZ 3G6EZ 1JWHC 4NBEA 4E30A 2NVXI 1WIIA 1VQN1 1KC82 1YUKA 2JMOA 3CPWY 5LL6f 4Y7NI 1TWHI 2QLVB 1YHQ1 4A3FI 2QKDA 1YJNZ 1Y1VS 2G2KA 3VB9A 1VQNZ 1S721 2OTLZ 2DE6A 2QA41 2V8IA 2VUMI 4NBHA 3GTGI 3I4MI 1Q812 3S16I 1P9NA 2YU9I 4BXXI 1VQM1 3HOWI 1YJW1 3OW2Y 1Y1VI 2KI7B 4MONA 1VQ9Z 2R92I 2RBLA 3FQQA 2R93I 3CCE1 3IX0A 4RVHA 2Q51A 1VQMZ 1I3QI 1NUIA 2KPIA 4NB8A 2M6NA 3TE5B 3S1RI 2K3RA 5T6BA 3J80f 1QVGZ 4HGYA 3PO3S 2JR6A 4NFRA 2F4MA 2DE7A 5C3EI 3VTNA 1Q811 1VLAA 4A3BI 3JAMf 2R6MA 3CD6Z 3CCM1 2RHBA 3TDHB 5D1PA 4A93I 3CCV1 4E2YA 3T4NB 3NFZA 3I561 3CPWZ 1KQSY 4E2WA 3CCJ1 1YITZ 1Q822 4A3JI 5CM2M 4MRIA 3NH5A 5IT9b 4DGLA 1VQ6Z 3H3VJ 3HOVI 3NDIA 1Q862 3I56Z 2ZAEB 3CC7Z 2DE5A 2OOYB 4A3MI 3I551 1VQ51 3G6E1 1QYPA 4AYBA 2WB1A 1RLYA 3U50C 1K8A2 2Y0SA 2JA5I 3PO2I 4NBAA 4MD7A 1N2FA 4A3LI 1VQ8Z 3I55Z 3S2DI 2QRDB 4A3GI 3J81f 1YJN1 1RNIA 2OTL1 1S7MA 1Q821 2VF1A 5IP7I 3CMAZ 1Y1WI 4RVGA 1I50I 1VQOZ 2WAQA 5FLXf 2RIQA 1W2BZ 3J7A4 1M902 2OOXB 2QR1B 1X0TA 3FQMA 2JA7I 1VQ91 1KD12 1N8R1 1QVFY 3KIFA 3GTJI 2E2JI 4QTTA 2JA8I 3GTLI 3GTMS 3S1NI 1VQK1 2E2HI 1YI2Z 1VQLZ 1JJ2Y 5AN9F 1YUAA 3GCFA 1KQSZ 3I07A 3HOUI 1SFOI 3M3YI 3CQZI 2LFUA 3S17I 4A3DI 3G4SZ 1KC81 3VMIA 2QREB 1VQKZ 3HOYI 2F4OA 4MXUA 4A3EI 3GTMI 3IF8A 1VQ4Z 3MZLB 1K9M2 1L1OC 1X3ZA 2R7ZI 2GU2A 2IZ3A 1RO2A 3CD61 5A2Qb 1M901 3I4NI 4S1TA 1YJ91 2LIYA 3P5JB 1WCMI 3CXCY 3HOZI 3RZOI 4HH4A 1VQP1 4A3CI 1YIT1 1TWGI 2PK7A 3CC2Z 3CCR1 4CL1A 1YJ9Z 1VQ61 5D1OB 2RT9A 4E2ZA 3GTKI 2O53A 2O4HA 3F3FC 1VQPZ 2JS4A 2K5RA 3D6WA 1TWCI 5T67A 1TFIA 3CC71 1K83I 4X6AI 2GTHA 5D1OA 3CCRZ 3KIHA 3IFUA 4NBGA 3D9XA 3ESWA 3CCLZ 3CCSZ 1Z03A 2I3CA 1TWFI 4E2XA 1VQ81 2QEXZ 2V8JA 3GKQA 1QVFZ 1KRLA 3NDJA 2E2II 1TWAI 1K732 3OW2Z 5IT9f 2HF1A 1QVGY 1JJ2Z 4DQYB 3CMA1 3CCQ1 2E9HA 2AKLA 4A3KI 1VQO1 1USPB 3S15I 2OZKA 4NBFA 4BBRI 2IZ4A 2YADA 3GTOI 2W04A 3S1MI 1USPA 3VMGA 3CCQZ 1R9TI 3HKZA 4MH4A 2V8KA 1Q861 3GTQI 2M48A 3FKII 3CXCZ 1YI21 1VQL1 4DK1A 2P3YA 1K8A1 3CME1 2B63I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 1;  3I56 1;  3G4S 1;  3CPW Z;  1KQS Y;  3CCJ 1;  1YIT Z;  3CD6 1;  1Q82 2;  1M90 1;  1YJ9 1;  1VQ4 1;  1VQ5 Z;  2OTJ Z;  3G6E Z;  1NJI 2;  1VQ6 Z;  1YHQ Z;  3CXC Y;  3CME Z;  1Q7Y 2;  1Q86 2;  1VQP 1;  1YIJ 1;  3I56 Z;  1YIT 1;  3CC7 Z;  1VQN 1;  1KC8 2;  3CC4 1;  3CPW Y;  1S72 Z;  3CC2 Z;  3CCR 1;  1YJ9 Z;  3I55 1;  1VQ5 1;  3G6E 1;  1VQ6 1;  2QA4 Z;  1YHQ 1;  1K8A 2;  1VQP Z;  1YIJ Z;  1VQ8 Z;  1YJN Z;  3CC7 1;  1VQN Z;  3CC4 Z;  1S72 1;  3CC2 1;  1YJW Z;  3CCR Z;  2OTL Z;  3I55 Z;  2QA4 1;  1M1K 2;  1KD1 1;  3CCL Z;  3CCS Z;  1VQ8 1;  1Q81 2;  1YJN 1;  3CCE Z;  1VQM 1;  1YJW 1;  2OTL 1;  2QEX Z;  1Q82 1;  3OW2 Y;  1QVF Z;  3CMA Z;  1W2B Y;  3CCL 1;  1NJI 1;  1VQO Z;  1VQ9 Z;  3CCS 1;  1Q7Y 1;  1K73 2;  3OW2 Z;  3CCE 1;  1VQM Z;  1W2B Z;  2QEX 1;  1QVG Y;  1JJ2 Z;  1M90 2;  3CMA 1;  3CCQ 1;  1VQO 1;  1K9M 1;  1VQ9 1;  1KD1 2;  1N8R 1;  1QVF Y;  1QVG Z;  3CCU 1;  1VQ7 1;  3CCQ Z;  1VQK 1;  1YI2 Z;  1VQL Z;  1JJ2 Y;  3CCM Z;  1M1K 1;  1Q86 1;  1KQS Z;  3G71 1;  3CCV Z;  1Q81 1;  3CCU Z;  3G4S Z;  1KC8 1;  3CCJ Z;  1VQ7 Z;  3CD6 Z;  1VQK Z;  3CXC Z;  1YI2 1;  1VQL 1;  3CCM 1;  1VQ4 Z;  2OTJ 1;  1K8A 1;  1K9M 2;  1N8R 2;  3G71 Z;  3CME 1;  3CCV 1; 
#chains in the Genus database with same CATH topology
 1K73 1;  3G4S 1;  3S14 I;  2J6A A;  2PMZ A;  2NVY I;  1I6H I;  1VQ4 1;  3D2L A;  1NJI 2;  4NOZ A;  1Z02 A;  1ZH1 A;  1YHQ Z;  2RPR A;  3CME Z;  1Q7Y 2;  1ML8 A;  1WW9 A;  3J80 b;  1YIJ 1;  2QRC B;  5C44 I;  3LUS A;  4E33 A;  3CC4 1;  3MZK B;  1S72 Z;  2QA4 Z;  2VPX A;  4XX2 A;  1PFT A;  2EGT A;  4NBB A;  4Y52 I;  1YIJ Z;  3MON A;  1ZB8 A;  1QF8 A;  3CC4 Z;  3CC2 1;  2IV2 X;  1YJW Z;  4QTU A;  2P28 A;  1M1K 2;  1KD1 1;  3JAM b;  2VPW A;  4NH1 C;  4TNU A;  4RV9 A;  3GTP I;  3S1Q I;  3EED A;  3CCE Z;  1RO0 A;  5FLM I;  4RS4 A;  2HU9 A;  2Q4Z A;  4HGZ A;  4NBC A;  5T64 A;  3HOX I;  1W2B Y;  3CCL 1;  1NJI 1;  3CCS 1;  1Z01 A;  1Q7Y 1;  5A2Q f;  3S2H I;  3Q87 A;  3VMH A;  2QEX 1;  1NP6 A;  3BG0 B;  3PO3 I;  1ZB9 A;  1K9M 1;  1DL6 A;  3BG1 B;  2JUB A;  2W03 A;  2JIP A;  4BY1 I;  2JIQ A;  3H0G I;  2JA6 I;  3K7A I;  3CCU 1;  2VPZ A;  4E32 A;  2VUG A;  2PM9 A;  4BBS I;  1VQ7 1;  4MD9 A;  2BJO A;  3QWU A;  2H85 A;  3CCM Z;  3EER A;  4RVF A;  1M1K 1;  2NVQ I;  4MD8 A;  1LQL A;  3G71 1;  4NB9 A;  3CCV Z;  3NH8 A;  1X3W A;  3CCU Z;  4EWC A;  3J81 b;  2GTI A;  3CCJ Z;  1VQ7 Z;  3RZD I;  2NVT I;  3M4O I;  4E31 A;  5IP9 I;  2OTJ 1;  5C4J I;  1Q16 A;  4RVD A;  3NH4 A;  1N8R 2;  3G71 Z;  2JNY A;  4A3I I;  4NBD A;  5C4X I;  3F3P C;  1RQF A;  4BY7 I;  5FLX b;  1RO4 A;  1VQ5 Z;  2OTJ Z;  3G6E Z;  1JWH C;  2V3V A;  4NBE A;  4E30 A;  2NVX I;  1WII A;  1VQN 1;  1KC8 2;  1YUK A;  2JMO A;  3CPW Y;  5LL6 f;  4Y7N I;  1TWH I;  2QLV B;  1FDI A;  1YHQ 1;  4A3F I;  2QKD A;  1YJN Z;  1Y1V S;  2G2K A;  3VB9 A;  1VQN Z;  1S72 1;  2OTL Z;  2DE6 A;  2QA4 1;  2V8I A;  2VUM I;  4NBH A;  3GTG I;  3I4M I;  2NAP A;  1FDO A;  1Q81 2;  3S16 I;  1P9N A;  2YU9 I;  4BXX I;  1VQM 1;  3HOW I;  1YJW 1;  2LEX A;  3OW2 Y;  1Y1V I;  2KI7 B;  4MON A;  1VQ9 Z;  2R92 I;  2RBL A;  3FQQ A;  2R93 I;  3CCE 1;  3IX0 A;  4RVH A;  2Q51 A;  1VQM Z;  1I3Q I;  1NUI A;  2KPI A;  2JIM A;  4NB8 A;  2M6N A;  3TE5 B;  3S1R I;  2K3R A;  5T6B A;  3J80 f;  1QVG Z;  4HGY A;  3PO3 S;  2JR6 A;  4NFR A;  2F4M A;  2DE7 A;  1SIW A;  1WZN A;  5C3E I;  3VTN A;  1AA6 A;  1Q81 1;  1VLA A;  4A3B I;  3JAM f;  2R6M A;  3CD6 Z;  3CCM 1;  2RHB A;  3TDH B;  5D1P A;  4A93 I;  3CCV 1;  4E2Y A;  3T4N B;  3NFZ A;  3I56 1;  3CPW Z;  1KQS Y;  4E2W A;  3CCJ 1;  3IR7 A;  1YIT Z;  1Q82 2;  4A3J I;  5CM2 M;  4MRI A;  3NH5 A;  5IT9 b;  4DGL A;  1VQ6 Z;  3H3V J;  3HOV I;  3NDI A;  1Q86 2;  3I56 Z;  2ZAE B;  3CC7 Z;  2DE5 A;  2OOY B;  4A3M I;  2JIO A;  3I55 1;  1VQ5 1;  3G6E 1;  1QYP A;  4AYB A;  2WB1 A;  1RLY A;  3U50 C;  1K8A 2;  2Y0S A;  2JA5 I;  3PO2 I;  4NBA A;  4MD7 A;  1N2F A;  4A3L I;  1VQ8 Z;  2E7Z A;  3I55 Z;  3S2D I;  2QRD B;  4A3G I;  3J81 f;  1YJN 1;  1RNI A;  2OTL 1;  1S7M A;  1Q82 1;  2VF1 A;  5IP7 I;  3CMA Z;  1Y1W I;  4RVG A;  1I50 I;  1VQO Z;  1QXF A;  1WJ2 A;  2WAQ A;  5FLX f;  2RIQ A;  1W2B Z;  3J7A 4;  1M90 2;  2OOX B;  2QR1 B;  1X0T A;  3FQM A;  2VPY A;  2JA7 I;  1VQ9 1;  1KD1 2;  1N8R 1;  1QVF Y;  3KIF A;  3GTJ I;  2E2J I;  4QTT A;  2JA8 I;  3GTL I;  3GTM S;  3S1N I;  1VQK 1;  2E2H I;  1YI2 Z;  1VQL Z;  1JJ2 Y;  5AN9 F;  1YUA A;  3GCF A;  1KQS Z;  3I07 A;  3HOU I;  1SFO I;  3M3Y I;  3CQZ I;  2LFU A;  3S17 I;  4A3D I;  3G4S Z;  1KC8 1;  3VMI A;  2QRE B;  1VQK Z;  3HOY I;  2F4O A;  4MXU A;  4A3E I;  3GTM I;  3IF8 A;  1VQ4 Z;  3MZL B;  1K9M 2;  1L1O C;  1X3Z A;  2R7Z I;  2GU2 A;  2IZ3 A;  1RO2 A;  3CD6 1;  5A2Q b;  1M90 1;  3I4N I;  4S1T A;  1YJ9 1;  2AYD A;  2LIY A;  2V45 A;  3P5J B;  1WCM I;  3CXC Y;  3HOZ I;  3RZO I;  4HH4 A;  1VQP 1;  4A3C I;  1YIT 1;  1TWG I;  2PK7 A;  3CC2 Z;  3CCR 1;  4CL1 A;  1YJ9 Z;  1VQ6 1;  5D1O B;  2RT9 A;  4E2Z A;  3GTK I;  2O53 A;  2O4H A;  3F3F C;  1VQP Z;  2JS4 A;  2K5R A;  3D6W A;  1TWC I;  5T67 A;  1TFI A;  3CC7 1;  1K83 I;  4X6A I;  2GTH A;  5D1O A;  3CCR Z;  3KIH A;  3IFU A;  4NBG A;  3D9X A;  3ESW A;  3CCL Z;  3CCS Z;  1Z03 A;  2I3C A;  1TWF I;  4E2X A;  1VQ8 1;  2QEX Z;  2V8J A;  3GKQ A;  1QVF Z;  1KRL A;  3NDJ A;  2E2I I;  1TWA I;  1K73 2;  3OW2 Z;  5IT9 f;  2HF1 A;  1QVG Y;  1JJ2 Z;  4DQY B;  3CMA 1;  3CCQ 1;  2E9H A;  2AKL A;  4A3K I;  1VQO 1;  1USP B;  3S15 I;  2OZK A;  1Y8C A;  4NBF A;  4BBR I;  2IZ4 A;  2YAD A;  3GTO I;  2W04 A;  3S1M I;  1USP A;  3VMG A;  3CCQ Z;  1R9T I;  3HKZ A;  4MH4 A;  2V8K A;  1Q86 1;  3GTQ I;  2M48 A;  3FKI I;  3CXC Z;  1YI2 1;  1VQL 1;  2JIR A;  4DK1 A;  2P3Y A;  1K8A 1;  3CME 1;  2B63 I; 
#chains in the Genus database with same CATH homology
 1K73 1;  3G4S 1;  3S14 I;  2J6A A;  2PMZ A;  2NVY I;  1I6H I;  1VQ4 1;  1NJI 2;  4NOZ A;  1Z02 A;  1ZH1 A;  1YHQ Z;  2RPR A;  3CME Z;  1Q7Y 2;  1ML8 A;  1WW9 A;  3J80 b;  1YIJ 1;  2QRC B;  5C44 I;  3LUS A;  4E33 A;  3CC4 1;  3MZK B;  1S72 Z;  2QA4 Z;  4XX2 A;  1PFT A;  2EGT A;  4NBB A;  4Y52 I;  1YIJ Z;  3MON A;  1ZB8 A;  1QF8 A;  3CC4 Z;  3CC2 1;  1YJW Z;  4QTU A;  2P28 A;  1M1K 2;  1KD1 1;  3JAM b;  4NH1 C;  4TNU A;  4RV9 A;  3GTP I;  3S1Q I;  3EED A;  3CCE Z;  1RO0 A;  5FLM I;  4RS4 A;  2HU9 A;  2Q4Z A;  4HGZ A;  4NBC A;  5T64 A;  3HOX I;  1W2B Y;  3CCL 1;  1NJI 1;  3CCS 1;  1Z01 A;  1Q7Y 1;  5A2Q f;  3S2H I;  3Q87 A;  3VMH A;  2QEX 1;  1NP6 A;  3BG0 B;  3PO3 I;  1ZB9 A;  1K9M 1;  1DL6 A;  3BG1 B;  2JUB A;  2W03 A;  4BY1 I;  3H0G I;  2JA6 I;  3K7A I;  3CCU 1;  4E32 A;  2VUG A;  2PM9 A;  4BBS I;  1VQ7 1;  4MD9 A;  2BJO A;  3QWU A;  2H85 A;  3CCM Z;  3EER A;  4RVF A;  1M1K 1;  2NVQ I;  4MD8 A;  1LQL A;  3G71 1;  4NB9 A;  3CCV Z;  3NH8 A;  1X3W A;  3CCU Z;  4EWC A;  3J81 b;  2GTI A;  3CCJ Z;  1VQ7 Z;  3RZD I;  2NVT I;  3M4O I;  4E31 A;  5IP9 I;  2OTJ 1;  5C4J I;  4RVD A;  3NH4 A;  1N8R 2;  3G71 Z;  2JNY A;  4A3I I;  4NBD A;  5C4X I;  3F3P C;  1RQF A;  4BY7 I;  5FLX b;  1RO4 A;  1VQ5 Z;  2OTJ Z;  3G6E Z;  1JWH C;  4NBE A;  4E30 A;  2NVX I;  1WII A;  1VQN 1;  1KC8 2;  1YUK A;  2JMO A;  3CPW Y;  5LL6 f;  4Y7N I;  1TWH I;  2QLV B;  1YHQ 1;  4A3F I;  2QKD A;  1YJN Z;  1Y1V S;  2G2K A;  3VB9 A;  1VQN Z;  1S72 1;  2OTL Z;  2DE6 A;  2QA4 1;  2V8I A;  2VUM I;  4NBH A;  3GTG I;  3I4M I;  1Q81 2;  3S16 I;  1P9N A;  2YU9 I;  4BXX I;  1VQM 1;  3HOW I;  1YJW 1;  3OW2 Y;  1Y1V I;  2KI7 B;  4MON A;  1VQ9 Z;  2R92 I;  2RBL A;  3FQQ A;  2R93 I;  3CCE 1;  3IX0 A;  4RVH A;  2Q51 A;  1VQM Z;  1I3Q I;  1NUI A;  2KPI A;  4NB8 A;  2M6N A;  3TE5 B;  3S1R I;  2K3R A;  5T6B A;  3J80 f;  1QVG Z;  4HGY A;  3PO3 S;  2JR6 A;  4NFR A;  2F4M A;  2DE7 A;  5C3E I;  3VTN A;  1Q81 1;  1VLA A;  4A3B I;  3JAM f;  2R6M A;  3CD6 Z;  3CCM 1;  2RHB A;  3TDH B;  5D1P A;  4A93 I;  3CCV 1;  4E2Y A;  3T4N B;  3NFZ A;  3I56 1;  3CPW Z;  1KQS Y;  4E2W A;  3CCJ 1;  1YIT Z;  1Q82 2;  4A3J I;  5CM2 M;  4MRI A;  3NH5 A;  5IT9 b;  4DGL A;  1VQ6 Z;  3H3V J;  3HOV I;  3NDI A;  1Q86 2;  3I56 Z;  2ZAE B;  3CC7 Z;  2DE5 A;  2OOY B;  4A3M I;  3I55 1;  1VQ5 1;  3G6E 1;  1QYP A;  4AYB A;  2WB1 A;  1RLY A;  3U50 C;  1K8A 2;  2Y0S A;  2JA5 I;  3PO2 I;  4NBA A;  4MD7 A;  1N2F A;  4A3L I;  1VQ8 Z;  3I55 Z;  3S2D I;  2QRD B;  4A3G I;  3J81 f;  1YJN 1;  1RNI A;  2OTL 1;  1S7M A;  1Q82 1;  2VF1 A;  5IP7 I;  3CMA Z;  1Y1W I;  4RVG A;  1I50 I;  1VQO Z;  2WAQ A;  5FLX f;  2RIQ A;  1W2B Z;  3J7A 4;  1M90 2;  2OOX B;  2QR1 B;  1X0T A;  3FQM A;  2JA7 I;  1VQ9 1;  1KD1 2;  1N8R 1;  1QVF Y;  3KIF A;  3GTJ I;  2E2J I;  4QTT A;  2JA8 I;  3GTL I;  3GTM S;  3S1N I;  1VQK 1;  2E2H I;  1YI2 Z;  1VQL Z;  1JJ2 Y;  5AN9 F;  1YUA A;  3GCF A;  1KQS Z;  3I07 A;  3HOU I;  1SFO I;  3M3Y I;  3CQZ I;  2LFU A;  3S17 I;  4A3D I;  3G4S Z;  1KC8 1;  3VMI A;  2QRE B;  1VQK Z;  3HOY I;  2F4O A;  4MXU A;  4A3E I;  3GTM I;  3IF8 A;  1VQ4 Z;  3MZL B;  1K9M 2;  1L1O C;  1X3Z A;  2R7Z I;  2GU2 A;  2IZ3 A;  1RO2 A;  3CD6 1;  5A2Q b;  1M90 1;  3I4N I;  4S1T A;  1YJ9 1;  2LIY A;  3P5J B;  1WCM I;  3CXC Y;  3HOZ I;  3RZO I;  4HH4 A;  1VQP 1;  4A3C I;  1YIT 1;  1TWG I;  2PK7 A;  3CC2 Z;  3CCR 1;  4CL1 A;  1YJ9 Z;  1VQ6 1;  5D1O B;  2RT9 A;  4E2Z A;  3GTK I;  2O53 A;  2O4H A;  3F3F C;  1VQP Z;  2JS4 A;  2K5R A;  3D6W A;  1TWC I;  5T67 A;  1TFI A;  3CC7 1;  1K83 I;  4X6A I;  2GTH A;  5D1O A;  3CCR Z;  3KIH A;  3IFU A;  4NBG A;  3D9X A;  3ESW A;  3CCL Z;  3CCS Z;  1Z03 A;  2I3C A;  1TWF I;  4E2X A;  1VQ8 1;  2QEX Z;  2V8J A;  3GKQ A;  1QVF Z;  1KRL A;  3NDJ A;  2E2I I;  1TWA I;  1K73 2;  3OW2 Z;  5IT9 f;  2HF1 A;  1QVG Y;  1JJ2 Z;  4DQY B;  3CMA 1;  3CCQ 1;  2E9H A;  2AKL A;  4A3K I;  1VQO 1;  1USP B;  3S15 I;  2OZK A;  4NBF A;  4BBR I;  2IZ4 A;  2YAD A;  3GTO I;  2W04 A;  3S1M I;  1USP A;  3VMG A;  3CCQ Z;  1R9T I;  3HKZ A;  4MH4 A;  2V8K A;  1Q86 1;  3GTQ I;  2M48 A;  3FKI I;  3CXC Z;  1YI2 1;  1VQL 1;  4DK1 A;  2P3Y A;  1K8A 1;  3CME 1;  2B63 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...