1Q7Y1

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q7y100
2OTJ1 1S721 1K8A2 3CCL1 2QEX1 1Q7Y1 3CCE1 1QVFZ 3CCS1 2QA41 1W2BZ 3G711 3CCSZ 3CXCZ 3CCUZ 3CCMZ 1NJI1 1VQL1 3CCJ1 1M901 1KC82 1YJ91 1Q821 3CCJZ 1YIJ1 3I55Z 1YJW1 1QVGZ 3I56Z 3CCRZ 1VQMZ 1VQ51 1YJWZ 1K9M1 1VQK1 2OTJZ 1S72Z 3G4S1 3CCLZ 2QEXZ 1YJN1 1Q811 1YI21 3CCEZ 1VQN1 3G4SZ 3G6E1 2QA4Z 3G71Z 3G6EZ 1VQ91 3CCQ1 1K732 3CME1 1VQ9Z 1VQ41 3OW2Y 3CC21 1M1K2 3CMEZ 1VQO1 3CC71 1KD12 3CPWY 1VQLZ 3CC2Z 1YHQ1 1YJ9Z 3CD61 1YHQZ 1M902 1YIJZ 3CD6Z 1VQ81 1N8R2 1KQSZ 2OTL1 1VQP1 1Q862 1VQ5Z 1KC81 1VQ8Z 2OTLZ 1VQKZ 3CCV1 1YIT1 1JJ2Y 1YJNZ 1YI2Z 1VQ71 1VQNZ 1Q7Y2 1YITZ 1VQ61 1K8A1 1VQ6Z 3CCQZ 3CC41 1VQ4Z 1QVFY 1VQOZ 3OW2Z 3CC7Z 1NJI2 1W2BY 3CMA1 3CPWZ 3CXCY 3CMAZ 3CCU1 1Q822 1K731 3CCM1 1M1K1 1KD11 1VQPZ 1K9M2 3CCVZ 1VQ7Z 1JJ2Z 1Q812 1QVGY 3I551 1N8R1 3I561 1Q861 3CCR1 1VQM1 1KQSY 3CC4Z
chains in the Genus database with same CATH superfamily
3U50C 4MONA 3CCE1 2NVYI 1Z01A 1W2BZ 2F4MA 3JAMb 2R93I 4A3EI 1P9NA 5C4XI 4BY1I 2E2II 1Q821 3IX0A 2VF1A 1PFTA 3CQZI 3MONA 2NVQI 3GTOI 1YJW1 1VQMZ 1Y1VI 4RS4A 2JNYA 2LIYA 2DE5A 4EWCA 1FDOA 3CCEZ 2QRCB 1VQN1 2P28A 3S1RI 3HOUI 1NUIA 2JA7I 3G6EZ 1K732 2O53A 3OW2Y 3RZOI 1VQO1 3CC71 3GTLI 1WJ2A 1YHQ1 5AN9F 4NBEA 5T64A 1USPA 4CL1A 2IV2X 3CD6Z 1VQ81 4HGYA 1N8R2 4A3LI 5IP7I 3GCFA 2BJOA 2V3VA 4A3FI 1JJ2Y 4NBBA 1QYPA 1VQNZ 1VQ61 1X0TA 2OOXB 3NH5A 2LEXA 3LUSA 1K8A1 3ESWA 1DL6A 1VQOZ 3CC7Z 1W2BY 3HOVI 1ML8A 5D1PA 2K5RA 3CMAZ 1K731 2IZ3A 4HH4A 4RVGA 3CCM1 2H85A 3NDIA 4NBHA 2R7ZI 3FQQA 3K7AI 5FLXf 2WB1A 3KIHA 4X6AI 1Q812 5T6BA 1USPB 1N8R1 2JR6A 1S7MA 2JIMA 1WIIA 3FKII 4Y7NI 2LFUA 1X3WA 2OTJ1 4DGLA 1S721 2Q51A 3MZKB 3IR7A 3CCSZ 1YUAA 3CCMZ 2B63I 3S15I 4E30A 1SIWA 3J80b 4DQYB 1VQL1 2RBLA 1KC82 1YJ91 4RVDA 3IFUA 2VPZA 3HOXI 1ZB9A 2RIQA 2KPIA 2IZ4A 1YIJ1 3J81b 4BXXI 2V8KA 1QVGZ 2RPRA 2VPYA 3NFZA 3S17I 1VQ51 4S1TA 2GTIA 2JMOA 2OTJZ 1S72Z 1Q811 2R6MA 3IF8A 4Y52I 3G6E1 3H3VJ 2E9HA 1RO0A 5A2Qf 1ZB8A 5C4JI 3PO3S 2R92I 3EEDA 2YU9I 5FLMI 1M1K2 1K83I 3CMEZ 4QTUA 1VQLZ 3H0GI 1YJ9Z 3VMGA 3CD61 1L1OC 1M902 1YIJZ 2W04A 1QXFA 2ZAEB 1VQ5Z 1JWHC 1KC81 3CCV1 2JS4A 3F3PC 3S2DI 3M3YI 5CM2M 4MD9A 2PMZA 2NVXI 1TWFI 3JAMf 1TWHI 2JUBA 3VMIA 3CMA1 3D2LA 3FQMA 3VMHA 2PM9A 1M1K1 2NVTI 2K3RA 2EGTA 2DE7A 3S1NI 1K9M2 3CCVZ 4BY7I 5IT9b 2QLVB 4E2YA 3D9XA 1RO4A 1QVGY 4NB9A 1KQSY 2PK7A 3GTKI 3CCL1 4MH4A 4E31A 2Q4ZA 2QEX1 1QVFZ 4NOZA 3CCS1 2QA41 3G711 2V8JA 3HOZI 3CXCZ 3T4NB 2VUGA 3EERA 5C3EI 2E2HI 3TDHB 3GTPI 2I3CA 1SFOI 4DK1A 3CCJZ 3P5JB 3GTMS 4NBFA 5IT9f 3NH4A 2RT9A 1RQFA 2RHBA 4E32A 1K9M1 2OOYB 1VQK1 4QTTA 2DE6A 3CCLZ 2QEXZ 1YJN1 3S1MI 1YI21 3G4SZ 3J7A4 1Y8CA 4AYBA 2QA4Z 3G71Z 3F3FC 4NBDA 2JA5I 2KI7B 3GTJI 3CME1 1VQ9Z 1VQ41 4RVHA 2E7ZA 3S2HI 2JIPA 3CC2Z 2NAPA 4TNUA 3VB9A 1N2FA 2W03A 1KQSZ 2VPXA 1I6HI 3QWUA 3GTMI 2OTLZ 1VQKZ 4NBGA 1WZNA 3NDJA 4A93I 1YJNZ 1YI2Z 1Q7Y2 1YITZ 1I50I 1Y1VS 5LL6f 1TWGI 4E2XA 3CC41 1ZH1A 4A3DI 1VQ4Z 1QVFY 2V8IA 2JA8I 2AKLA 4RVFA 1NJI2 3CPWZ 4RV9A 3J80f 3CXCY 5D1OA 2HU9A 3BG1B 4MD8A 2G2KA 3MZLB 3CCU1 4MXUA 3KIFA 1RLYA 1I3QI 1R9TI 2E2JI 2VUMI 3J81f 1X3ZA 2QRDB 4A3MI 2JIOA 1AA6A 3NH8A 1TFIA 1RO2A 3HOYI 3I551 3M4OI 3I561 1RNIA 3CCR1 4A3KI 2WAQA 3CC4Z 3D6WA 1K8A2 1Q7Y1 3PO3I 4A3BI 1Q16A 2Y0SA 3I4NI 3S1QI 4MD7A 3CCUZ 2F4OA 3VTNA 3HKZA 4BBRI 1LQLA 1NJI1 4BBSI 2J6AA 3CCJ1 1M901 4HGZA 2V45A 5D1OB 1WCMI 1Z02A 3GKQA 4E2WA 3PO2I 3S14I 3I55Z 3I56Z 5FLXb 3CCRZ 1YJWZ 2OZKA 3G4S1 1TWCI 3HOWI 2M6NA 2QKDA 4A3II 1VQ91 3CCQ1 2QR1B 3S16I 3CC21 1KD12 3CPWY 1NP6A 3RZDI 4A3GI 2JA6I 3GTGI 2JIQA 4XX2A 1YHQZ 2O4HA 2GTHA 1Y1WI 1KRLA 2YADA 2OTL1 1VQP1 1Q862 1VQ8Z 2QREB 4NBCA 3GTQI 1YIT1 1VQ71 4MRIA 4A3JI 4NH1C 5C44I 1YUKA 1VQ6Z 5T67A 2P3YA 2HF1A 3CCQZ 1QF8A 3BG0B 2GU2A 3I4MI 4E2ZA 1VLAA 3OW2Z 4NBAA 1FDIA 1Z03A 4A3CI 5A2Qb 1Q822 2JIRA 2VPWA 1TWAI 4NB8A 3TE5B 1KD11 1VQPZ 3I07A 2M48A 3Q87A 4NFRA 1VQ7Z 1JJ2Z 1WW9A 4E33A 5IP9I 1Q861 1VQM1 2AYDA
chains in the Genus database with same CATH topology
3U50C 4MONA 3CCE1 2NVYI 1Z01A 1W2BZ 2F4MA 3JAMb 2R93I 4A3EI 1P9NA 5C4XI 4BY1I 2E2II 1Q821 3IX0A 2VF1A 1PFTA 3CQZI 3MONA 2NVQI 3GTOI 1YJW1 1VQMZ 1Y1VI 4RS4A 2JNYA 2LIYA 2DE5A 4EWCA 3CCEZ 2QRCB 1VQN1 2P28A 3S1RI 3HOUI 1NUIA 2JA7I 3G6EZ 1K732 2O53A 3OW2Y 3RZOI 1VQO1 3CC71 3GTLI 1YHQ1 5AN9F 4NBEA 5T64A 1USPA 4CL1A 3CD6Z 1VQ81 4HGYA 1N8R2 4A3LI 5IP7I 3GCFA 2BJOA 4A3FI 1JJ2Y 4NBBA 1QYPA 1VQNZ 1VQ61 1X0TA 2OOXB 3NH5A 3LUSA 1K8A1 3ESWA 1DL6A 1VQOZ 3CC7Z 1W2BY 3HOVI 1ML8A 5D1PA 2K5RA 3CMAZ 1K731 2IZ3A 4HH4A 4RVGA 3CCM1 2H85A 3NDIA 4NBHA 2R7ZI 3FQQA 3K7AI 5FLXf 2WB1A 3KIHA 4X6AI 1Q812 5T6BA 1USPB 1N8R1 2JR6A 1S7MA 1WIIA 3FKII 4Y7NI 2LFUA 1X3WA 2OTJ1 4DGLA 1S721 2Q51A 3MZKB 3CCSZ 1YUAA 3CCMZ 2B63I 3S15I 4E30A 3J80b 4DQYB 1VQL1 2RBLA 1KC82 1YJ91 4RVDA 3IFUA 3HOXI 1ZB9A 2RIQA 2KPIA 2IZ4A 1YIJ1 3J81b 4BXXI 2V8KA 1QVGZ 2RPRA 3NFZA 3S17I 1VQ51 4S1TA 2GTIA 2JMOA 2OTJZ 1S72Z 1Q811 2R6MA 3IF8A 4Y52I 3G6E1 3H3VJ 2E9HA 1RO0A 5A2Qf 1ZB8A 5C4JI 3PO3S 2R92I 3EEDA 2YU9I 5FLMI 1M1K2 1K83I 3CMEZ 4QTUA 1VQLZ 3H0GI 1YJ9Z 3VMGA 3CD61 1L1OC 1M902 1YIJZ 2W04A 2ZAEB 1VQ5Z 1JWHC 1KC81 3CCV1 2JS4A 3F3PC 3S2DI 3M3YI 5CM2M 4MD9A 2PMZA 2NVXI 1TWFI 3JAMf 1TWHI 2JUBA 3VMIA 3CMA1 3FQMA 3VMHA 2PM9A 1M1K1 2NVTI 2K3RA 2EGTA 2DE7A 3S1NI 1K9M2 3CCVZ 4BY7I 5IT9b 2QLVB 4E2YA 3D9XA 1RO4A 1QVGY 4NB9A 1KQSY 2PK7A 3GTKI 3CCL1 4MH4A 4E31A 2Q4ZA 2QEX1 1QVFZ 4NOZA 3CCS1 2QA41 3G711 2V8JA 3HOZI 3CXCZ 3T4NB 2VUGA 3EERA 5C3EI 2E2HI 3TDHB 3GTPI 2I3CA 1SFOI 4DK1A 3CCJZ 3P5JB 3GTMS 4NBFA 5IT9f 3NH4A 2RT9A 1RQFA 2RHBA 4E32A 1K9M1 2OOYB 1VQK1 4QTTA 2DE6A 3CCLZ 2QEXZ 1YJN1 3S1MI 1YI21 3G4SZ 3J7A4 4AYBA 2QA4Z 3G71Z 3F3FC 4NBDA 2JA5I 2KI7B 3GTJI 3CME1 1VQ9Z 1VQ41 4RVHA 3S2HI 3CC2Z 4TNUA 3VB9A 1N2FA 2W03A 1KQSZ 1I6HI 3QWUA 3GTMI 2OTLZ 1VQKZ 4NBGA 3NDJA 4A93I 1YJNZ 1YI2Z 1Q7Y2 1YITZ 1I50I 1Y1VS 5LL6f 1TWGI 4E2XA 3CC41 1ZH1A 4A3DI 1VQ4Z 1QVFY 2V8IA 2JA8I 2AKLA 4RVFA 1NJI2 3CPWZ 4RV9A 3J80f 3CXCY 5D1OA 2HU9A 3BG1B 4MD8A 2G2KA 3MZLB 3CCU1 4MXUA 3KIFA 1RLYA 1I3QI 1R9TI 2E2JI 2VUMI 3J81f 1X3ZA 2QRDB 4A3MI 3NH8A 1TFIA 1RO2A 3HOYI 3I551 3M4OI 3I561 1RNIA 3CCR1 4A3KI 2WAQA 3CC4Z 3D6WA 1K8A2 1Q7Y1 3PO3I 4A3BI 2Y0SA 3I4NI 3S1QI 4MD7A 3CCUZ 2F4OA 3VTNA 3HKZA 4BBRI 1LQLA 1NJI1 4BBSI 2J6AA 3CCJ1 1M901 4HGZA 5D1OB 1WCMI 1Z02A 3GKQA 4E2WA 3PO2I 3S14I 3I55Z 3I56Z 5FLXb 3CCRZ 1YJWZ 2OZKA 3G4S1 1TWCI 3HOWI 2M6NA 2QKDA 4A3II 1VQ91 3CCQ1 2QR1B 3S16I 3CC21 1KD12 3CPWY 1NP6A 3RZDI 4A3GI 2JA6I 3GTGI 4XX2A 1YHQZ 2O4HA 2GTHA 1Y1WI 1KRLA 2YADA 2OTL1 1VQP1 1Q862 1VQ8Z 2QREB 4NBCA 3GTQI 1YIT1 1VQ71 4MRIA 4A3JI 4NH1C 5C44I 1YUKA 1VQ6Z 5T67A 2P3YA 2HF1A 3CCQZ 1QF8A 3BG0B 2GU2A 3I4MI 4E2ZA 1VLAA 3OW2Z 4NBAA 1Z03A 4A3CI 5A2Qb 1Q822 1TWAI 4NB8A 3TE5B 1KD11 1VQPZ 3I07A 2M48A 3Q87A 4NFRA 1VQ7Z 1JJ2Z 1WW9A 4E33A 5IP9I 1Q861 1VQM1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ 1;  1S72 1;  1K8A 2;  3CCL 1;  2QEX 1;  1Q7Y 1;  3CCE 1;  1QVF Z;  3CCS 1;  2QA4 1;  1W2B Z;  3G71 1;  3CCS Z;  3CXC Z;  3CCU Z;  3CCM Z;  1NJI 1;  1VQL 1;  3CCJ 1;  1M90 1;  1KC8 2;  1YJ9 1;  1Q82 1;  3CCJ Z;  1YIJ 1;  3I55 Z;  1YJW 1;  1QVG Z;  3I56 Z;  3CCR Z;  1VQM Z;  1VQ5 1;  1YJW Z;  1K9M 1;  1VQK 1;  2OTJ Z;  1S72 Z;  3G4S 1;  3CCL Z;  2QEX Z;  1YJN 1;  1Q81 1;  1YI2 1;  3CCE Z;  1VQN 1;  3G4S Z;  3G6E 1;  2QA4 Z;  3G71 Z;  3G6E Z;  1VQ9 1;  3CCQ 1;  1K73 2;  3CME 1;  1VQ9 Z;  1VQ4 1;  3OW2 Y;  3CC2 1;  1M1K 2;  3CME Z;  1VQO 1;  3CC7 1;  1KD1 2;  3CPW Y;  1VQL Z;  3CC2 Z;  1YHQ 1;  1YJ9 Z;  3CD6 1;  1YHQ Z;  1M90 2;  1YIJ Z;  3CD6 Z;  1VQ8 1;  1N8R 2;  1KQS Z;  2OTL 1;  1VQP 1;  1Q86 2;  1VQ5 Z;  1KC8 1;  1VQ8 Z;  2OTL Z;  1VQK Z;  3CCV 1;  1YIT 1;  1JJ2 Y;  1YJN Z;  1YI2 Z;  1VQ7 1;  1VQN Z;  1Q7Y 2;  1YIT Z;  1VQ6 1;  1K8A 1;  1VQ6 Z;  3CCQ Z;  3CC4 1;  1VQ4 Z;  1QVF Y;  1VQO Z;  3OW2 Z;  3CC7 Z;  1NJI 2;  1W2B Y;  3CMA 1;  3CPW Z;  3CXC Y;  3CMA Z;  3CCU 1;  1Q82 2;  1K73 1;  3CCM 1;  1M1K 1;  1KD1 1;  1VQP Z;  1K9M 2;  3CCV Z;  1VQ7 Z;  1JJ2 Z;  1Q81 2;  1QVG Y;  3I55 1;  1N8R 1;  3I56 1;  1Q86 1;  3CCR 1;  1VQM 1;  1KQS Y;  3CC4 Z; 
#chains in the Genus database with same CATH topology
 3U50 C;  4MON A;  3CCE 1;  2NVY I;  1Z01 A;  1W2B Z;  2F4M A;  3JAM b;  2R93 I;  4A3E I;  1P9N A;  5C4X I;  4BY1 I;  2E2I I;  1Q82 1;  3IX0 A;  2VF1 A;  1PFT A;  3CQZ I;  3MON A;  2NVQ I;  3GTO I;  1YJW 1;  1VQM Z;  1Y1V I;  4RS4 A;  2JNY A;  2LIY A;  2DE5 A;  4EWC A;  1FDO A;  3CCE Z;  2QRC B;  1VQN 1;  2P28 A;  3S1R I;  3HOU I;  1NUI A;  2JA7 I;  3G6E Z;  1K73 2;  2O53 A;  3OW2 Y;  3RZO I;  1VQO 1;  3CC7 1;  3GTL I;  1WJ2 A;  1YHQ 1;  5AN9 F;  4NBE A;  5T64 A;  1USP A;  4CL1 A;  2IV2 X;  3CD6 Z;  1VQ8 1;  4HGY A;  1N8R 2;  4A3L I;  5IP7 I;  3GCF A;  2BJO A;  2V3V A;  4A3F I;  1JJ2 Y;  4NBB A;  1QYP A;  1VQN Z;  1VQ6 1;  1X0T A;  2OOX B;  3NH5 A;  2LEX A;  3LUS A;  1K8A 1;  3ESW A;  1DL6 A;  1VQO Z;  3CC7 Z;  1W2B Y;  3HOV I;  1ML8 A;  5D1P A;  2K5R A;  3CMA Z;  1K73 1;  2IZ3 A;  4HH4 A;  4RVG A;  3CCM 1;  2H85 A;  3NDI A;  4NBH A;  2R7Z I;  3FQQ A;  3K7A I;  5FLX f;  2WB1 A;  3KIH A;  4X6A I;  1Q81 2;  5T6B A;  1USP B;  1N8R 1;  2JR6 A;  1S7M A;  2JIM A;  1WII A;  3FKI I;  4Y7N I;  2LFU A;  1X3W A;  2OTJ 1;  4DGL A;  1S72 1;  2Q51 A;  3MZK B;  3IR7 A;  3CCS Z;  1YUA A;  3CCM Z;  2B63 I;  3S15 I;  4E30 A;  1SIW A;  3J80 b;  4DQY B;  1VQL 1;  2RBL A;  1KC8 2;  1YJ9 1;  4RVD A;  3IFU A;  2VPZ A;  3HOX I;  1ZB9 A;  2RIQ A;  2KPI A;  2IZ4 A;  1YIJ 1;  3J81 b;  4BXX I;  2V8K A;  1QVG Z;  2RPR A;  2VPY A;  3NFZ A;  3S17 I;  1VQ5 1;  4S1T A;  2GTI A;  2JMO A;  2OTJ Z;  1S72 Z;  1Q81 1;  2R6M A;  3IF8 A;  4Y52 I;  3G6E 1;  3H3V J;  2E9H A;  1RO0 A;  5A2Q f;  1ZB8 A;  5C4J I;  3PO3 S;  2R92 I;  3EED A;  2YU9 I;  5FLM I;  1M1K 2;  1K83 I;  3CME Z;  4QTU A;  1VQL Z;  3H0G I;  1YJ9 Z;  3VMG A;  3CD6 1;  1L1O C;  1M90 2;  1YIJ Z;  2W04 A;  1QXF A;  2ZAE B;  1VQ5 Z;  1JWH C;  1KC8 1;  3CCV 1;  2JS4 A;  3F3P C;  3S2D I;  3M3Y I;  5CM2 M;  4MD9 A;  2PMZ A;  2NVX I;  1TWF I;  3JAM f;  1TWH I;  2JUB A;  3VMI A;  3CMA 1;  3D2L A;  3FQM A;  3VMH A;  2PM9 A;  1M1K 1;  2NVT I;  2K3R A;  2EGT A;  2DE7 A;  3S1N I;  1K9M 2;  3CCV Z;  4BY7 I;  5IT9 b;  2QLV B;  4E2Y A;  3D9X A;  1RO4 A;  1QVG Y;  4NB9 A;  1KQS Y;  2PK7 A;  3GTK I;  3CCL 1;  4MH4 A;  4E31 A;  2Q4Z A;  2QEX 1;  1QVF Z;  4NOZ A;  3CCS 1;  2QA4 1;  3G71 1;  2V8J A;  3HOZ I;  3CXC Z;  3T4N B;  2VUG A;  3EER A;  5C3E I;  2E2H I;  3TDH B;  3GTP I;  2I3C A;  1SFO I;  4DK1 A;  3CCJ Z;  3P5J B;  3GTM S;  4NBF A;  5IT9 f;  3NH4 A;  2RT9 A;  1RQF A;  2RHB A;  4E32 A;  1K9M 1;  2OOY B;  1VQK 1;  4QTT A;  2DE6 A;  3CCL Z;  2QEX Z;  1YJN 1;  3S1M I;  1YI2 1;  3G4S Z;  3J7A 4;  1Y8C A;  4AYB A;  2QA4 Z;  3G71 Z;  3F3F C;  4NBD A;  2JA5 I;  2KI7 B;  3GTJ I;  3CME 1;  1VQ9 Z;  1VQ4 1;  4RVH A;  2E7Z A;  3S2H I;  2JIP A;  3CC2 Z;  2NAP A;  4TNU A;  3VB9 A;  1N2F A;  2W03 A;  1KQS Z;  2VPX A;  1I6H I;  3QWU A;  3GTM I;  2OTL Z;  1VQK Z;  4NBG A;  1WZN A;  3NDJ A;  4A93 I;  1YJN Z;  1YI2 Z;  1Q7Y 2;  1YIT Z;  1I50 I;  1Y1V S;  5LL6 f;  1TWG I;  4E2X A;  3CC4 1;  1ZH1 A;  4A3D I;  1VQ4 Z;  1QVF Y;  2V8I A;  2JA8 I;  2AKL A;  4RVF A;  1NJI 2;  3CPW Z;  4RV9 A;  3J80 f;  3CXC Y;  5D1O A;  2HU9 A;  3BG1 B;  4MD8 A;  2G2K A;  3MZL B;  3CCU 1;  4MXU A;  3KIF A;  1RLY A;  1I3Q I;  1R9T I;  2E2J I;  2VUM I;  3J81 f;  1X3Z A;  2QRD B;  4A3M I;  2JIO A;  1AA6 A;  3NH8 A;  1TFI A;  1RO2 A;  3HOY I;  3I55 1;  3M4O I;  3I56 1;  1RNI A;  3CCR 1;  4A3K I;  2WAQ A;  3CC4 Z;  3D6W A;  1K8A 2;  1Q7Y 1;  3PO3 I;  4A3B I;  1Q16 A;  2Y0S A;  3I4N I;  3S1Q I;  4MD7 A;  3CCU Z;  2F4O A;  3VTN A;  3HKZ A;  4BBR I;  1LQL A;  1NJI 1;  4BBS I;  2J6A A;  3CCJ 1;  1M90 1;  4HGZ A;  2V45 A;  5D1O B;  1WCM I;  1Z02 A;  3GKQ A;  4E2W A;  3PO2 I;  3S14 I;  3I55 Z;  3I56 Z;  5FLX b;  3CCR Z;  1YJW Z;  2OZK A;  3G4S 1;  1TWC I;  3HOW I;  2M6N A;  2QKD A;  4A3I I;  1VQ9 1;  3CCQ 1;  2QR1 B;  3S16 I;  3CC2 1;  1KD1 2;  3CPW Y;  1NP6 A;  3RZD I;  4A3G I;  2JA6 I;  3GTG I;  2JIQ A;  4XX2 A;  1YHQ Z;  2O4H A;  2GTH A;  1Y1W I;  1KRL A;  2YAD A;  2OTL 1;  1VQP 1;  1Q86 2;  1VQ8 Z;  2QRE B;  4NBC A;  3GTQ I;  1YIT 1;  1VQ7 1;  4MRI A;  4A3J I;  4NH1 C;  5C44 I;  1YUK A;  1VQ6 Z;  5T67 A;  2P3Y A;  2HF1 A;  3CCQ Z;  1QF8 A;  3BG0 B;  2GU2 A;  3I4M I;  4E2Z A;  1VLA A;  3OW2 Z;  4NBA A;  1FDI A;  1Z03 A;  4A3C I;  5A2Q b;  1Q82 2;  2JIR A;  2VPW A;  1TWA I;  4NB8 A;  3TE5 B;  1KD1 1;  1VQP Z;  3I07 A;  2M48 A;  3Q87 A;  4NFR A;  1VQ7 Z;  1JJ2 Z;  1WW9 A;  4E33 A;  5IP9 I;  1Q86 1;  1VQM 1;  2AYD A; 
#chains in the Genus database with same CATH homology
 3U50 C;  4MON A;  3CCE 1;  2NVY I;  1Z01 A;  1W2B Z;  2F4M A;  3JAM b;  2R93 I;  4A3E I;  1P9N A;  5C4X I;  4BY1 I;  2E2I I;  1Q82 1;  3IX0 A;  2VF1 A;  1PFT A;  3CQZ I;  3MON A;  2NVQ I;  3GTO I;  1YJW 1;  1VQM Z;  1Y1V I;  4RS4 A;  2JNY A;  2LIY A;  2DE5 A;  4EWC A;  3CCE Z;  2QRC B;  1VQN 1;  2P28 A;  3S1R I;  3HOU I;  1NUI A;  2JA7 I;  3G6E Z;  1K73 2;  2O53 A;  3OW2 Y;  3RZO I;  1VQO 1;  3CC7 1;  3GTL I;  1YHQ 1;  5AN9 F;  4NBE A;  5T64 A;  1USP A;  4CL1 A;  3CD6 Z;  1VQ8 1;  4HGY A;  1N8R 2;  4A3L I;  5IP7 I;  3GCF A;  2BJO A;  4A3F I;  1JJ2 Y;  4NBB A;  1QYP A;  1VQN Z;  1VQ6 1;  1X0T A;  2OOX B;  3NH5 A;  3LUS A;  1K8A 1;  3ESW A;  1DL6 A;  1VQO Z;  3CC7 Z;  1W2B Y;  3HOV I;  1ML8 A;  5D1P A;  2K5R A;  3CMA Z;  1K73 1;  2IZ3 A;  4HH4 A;  4RVG A;  3CCM 1;  2H85 A;  3NDI A;  4NBH A;  2R7Z I;  3FQQ A;  3K7A I;  5FLX f;  2WB1 A;  3KIH A;  4X6A I;  1Q81 2;  5T6B A;  1USP B;  1N8R 1;  2JR6 A;  1S7M A;  1WII A;  3FKI I;  4Y7N I;  2LFU A;  1X3W A;  2OTJ 1;  4DGL A;  1S72 1;  2Q51 A;  3MZK B;  3CCS Z;  1YUA A;  3CCM Z;  2B63 I;  3S15 I;  4E30 A;  3J80 b;  4DQY B;  1VQL 1;  2RBL A;  1KC8 2;  1YJ9 1;  4RVD A;  3IFU A;  3HOX I;  1ZB9 A;  2RIQ A;  2KPI A;  2IZ4 A;  1YIJ 1;  3J81 b;  4BXX I;  2V8K A;  1QVG Z;  2RPR A;  3NFZ A;  3S17 I;  1VQ5 1;  4S1T A;  2GTI A;  2JMO A;  2OTJ Z;  1S72 Z;  1Q81 1;  2R6M A;  3IF8 A;  4Y52 I;  3G6E 1;  3H3V J;  2E9H A;  1RO0 A;  5A2Q f;  1ZB8 A;  5C4J I;  3PO3 S;  2R92 I;  3EED A;  2YU9 I;  5FLM I;  1M1K 2;  1K83 I;  3CME Z;  4QTU A;  1VQL Z;  3H0G I;  1YJ9 Z;  3VMG A;  3CD6 1;  1L1O C;  1M90 2;  1YIJ Z;  2W04 A;  2ZAE B;  1VQ5 Z;  1JWH C;  1KC8 1;  3CCV 1;  2JS4 A;  3F3P C;  3S2D I;  3M3Y I;  5CM2 M;  4MD9 A;  2PMZ A;  2NVX I;  1TWF I;  3JAM f;  1TWH I;  2JUB A;  3VMI A;  3CMA 1;  3FQM A;  3VMH A;  2PM9 A;  1M1K 1;  2NVT I;  2K3R A;  2EGT A;  2DE7 A;  3S1N I;  1K9M 2;  3CCV Z;  4BY7 I;  5IT9 b;  2QLV B;  4E2Y A;  3D9X A;  1RO4 A;  1QVG Y;  4NB9 A;  1KQS Y;  2PK7 A;  3GTK I;  3CCL 1;  4MH4 A;  4E31 A;  2Q4Z A;  2QEX 1;  1QVF Z;  4NOZ A;  3CCS 1;  2QA4 1;  3G71 1;  2V8J A;  3HOZ I;  3CXC Z;  3T4N B;  2VUG A;  3EER A;  5C3E I;  2E2H I;  3TDH B;  3GTP I;  2I3C A;  1SFO I;  4DK1 A;  3CCJ Z;  3P5J B;  3GTM S;  4NBF A;  5IT9 f;  3NH4 A;  2RT9 A;  1RQF A;  2RHB A;  4E32 A;  1K9M 1;  2OOY B;  1VQK 1;  4QTT A;  2DE6 A;  3CCL Z;  2QEX Z;  1YJN 1;  3S1M I;  1YI2 1;  3G4S Z;  3J7A 4;  4AYB A;  2QA4 Z;  3G71 Z;  3F3F C;  4NBD A;  2JA5 I;  2KI7 B;  3GTJ I;  3CME 1;  1VQ9 Z;  1VQ4 1;  4RVH A;  3S2H I;  3CC2 Z;  4TNU A;  3VB9 A;  1N2F A;  2W03 A;  1KQS Z;  1I6H I;  3QWU A;  3GTM I;  2OTL Z;  1VQK Z;  4NBG A;  3NDJ A;  4A93 I;  1YJN Z;  1YI2 Z;  1Q7Y 2;  1YIT Z;  1I50 I;  1Y1V S;  5LL6 f;  1TWG I;  4E2X A;  3CC4 1;  1ZH1 A;  4A3D I;  1VQ4 Z;  1QVF Y;  2V8I A;  2JA8 I;  2AKL A;  4RVF A;  1NJI 2;  3CPW Z;  4RV9 A;  3J80 f;  3CXC Y;  5D1O A;  2HU9 A;  3BG1 B;  4MD8 A;  2G2K A;  3MZL B;  3CCU 1;  4MXU A;  3KIF A;  1RLY A;  1I3Q I;  1R9T I;  2E2J I;  2VUM I;  3J81 f;  1X3Z A;  2QRD B;  4A3M I;  3NH8 A;  1TFI A;  1RO2 A;  3HOY I;  3I55 1;  3M4O I;  3I56 1;  1RNI A;  3CCR 1;  4A3K I;  2WAQ A;  3CC4 Z;  3D6W A;  1K8A 2;  1Q7Y 1;  3PO3 I;  4A3B I;  2Y0S A;  3I4N I;  3S1Q I;  4MD7 A;  3CCU Z;  2F4O A;  3VTN A;  3HKZ A;  4BBR I;  1LQL A;  1NJI 1;  4BBS I;  2J6A A;  3CCJ 1;  1M90 1;  4HGZ A;  5D1O B;  1WCM I;  1Z02 A;  3GKQ A;  4E2W A;  3PO2 I;  3S14 I;  3I55 Z;  3I56 Z;  5FLX b;  3CCR Z;  1YJW Z;  2OZK A;  3G4S 1;  1TWC I;  3HOW I;  2M6N A;  2QKD A;  4A3I I;  1VQ9 1;  3CCQ 1;  2QR1 B;  3S16 I;  3CC2 1;  1KD1 2;  3CPW Y;  1NP6 A;  3RZD I;  4A3G I;  2JA6 I;  3GTG I;  4XX2 A;  1YHQ Z;  2O4H A;  2GTH A;  1Y1W I;  1KRL A;  2YAD A;  2OTL 1;  1VQP 1;  1Q86 2;  1VQ8 Z;  2QRE B;  4NBC A;  3GTQ I;  1YIT 1;  1VQ7 1;  4MRI A;  4A3J I;  4NH1 C;  5C44 I;  1YUK A;  1VQ6 Z;  5T67 A;  2P3Y A;  2HF1 A;  3CCQ Z;  1QF8 A;  3BG0 B;  2GU2 A;  3I4M I;  4E2Z A;  1VLA A;  3OW2 Z;  4NBA A;  1Z03 A;  4A3C I;  5A2Q b;  1Q82 2;  1TWA I;  4NB8 A;  3TE5 B;  1KD1 1;  1VQP Z;  3I07 A;  2M48 A;  3Q87 A;  4NFR A;  1VQ7 Z;  1JJ2 Z;  1WW9 A;  4E33 A;  5IP9 I;  1Q86 1;  1VQM 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...