1VQ8Z

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq8Z00
3CME1 1M902 2OTLZ 3CPWY 3G6EZ 3CCSZ 1VQM1 2OTL1 1VQ9Z 3CCQZ 1K8A1 3CC4Z 1VQNZ 1YHQ1 3CD6Z 1VQ91 3CCL1 3CC41 1N8R2 1VQ81 1QVGY 3CCUZ 1YI2Z 1VQLZ 1KQSZ 1YITZ 3CCEZ 3CC71 1VQP1 1YI21 1VQL1 1K9M2 1KD12 1YJWZ 1QVFZ 1VQ6Z 3I561 1JJ2Z 1VQO1 1VQ71 3G71Z 1KC82 1VQ61 3CCMZ 1Q812 1S72Z 3G6E1 3CCS1 3CCRZ 1W2BY 1Q7Y2 1Q862 3I55Z 3CCQ1 1VQN1 3CD61 3CMAZ 3OW2Z 1NJI2 3I551 1K732 3CMA1 3CXCZ 3CCU1 1YIJZ 2QA4Z 3CC2Z 1VQKZ 1YIT1 3CCE1 3CPWZ 1QVFY 1VQ4Z 1YJW1 1Q822 1M1K2 3G711 1VQ5Z 1N8R1 1QVGZ 2QEXZ 3CCM1 1K8A2 1S721 1YJNZ 3CCR1 1YJ9Z 1K9M1 1KD11 3CCJZ 1KQSY 3CMEZ 2OTJZ 1KC81 1YIJ1 2QA41 1M901 3CC21 1VQK1 1VQMZ 2OTJ1 3CCVZ 1Q811 1JJ2Y 1VQ41 1YHQZ 3CCV1 3CCLZ 1W2BZ 1VQ8Z 1Q7Y1 1Q861 1VQ51 3CC7Z 1VQPZ 1NJI1 1K731 2QEX1 3G4SZ 1YJN1 3G4S1 3I56Z 1VQOZ 3OW2Y 1VQ7Z 1YJ91 3CCJ1 3CXCY 1Q821 1M1K1
chains in the Genus database with same CATH superfamily
5FLMI 2RT9A 2IZ3A 3H3VJ 2H85A 2K5RA 2O53A 4E2XA 2VPWA 3G6EZ 2RPRA 1VQM1 1TWHI 2JA8I 4RVHA 3GTMS 4E2WA 3CCQZ 2JS4A 1VQNZ 1Y1WI 1SIWA 2AKLA 3GTKI 3CCUZ 3PO2I 1DL6A 1Q16A 5C3EI 1YITZ 1YI21 2E7ZA 1QXFA 1K9M2 1VQO1 1TFIA 3HOWI 1VQ61 2Y0SA 3J81b 1NP6A 3CCMZ 1I50I 4MH4A 1USPA 1PFTA 4DGLA 3CMAZ 3OW2Z 1I3QI 3IFUA 1YIJZ 1RO2A 2I3CA 2WB1A 1VQ4Z 3CQZI 2YU9I 3HOUI 4QTUA 4A3GI 3RZDI 1ML8A 4BXXI 2DE6A 3KIHA 3RZOI 1N8R1 2QEXZ 3P5JB 5FLXf 3S15I 1YJ9Z 1KC81 1FDOA 4A3II 3CC21 1VQMZ 3FQQA 3EEDA 5D1OA 3VMHA 4HGYA 5D1PA 1Q811 3CCV1 4NBDA 1FDIA 5FLXb 2VUMI 1Q861 2E9HA 2PK7A 3TE5B 3Q87A 3NFZA 1K731 1WCMI 4BY7I 1TWCI 1VQOZ 3D9XA 3KIFA 1RNIA 2VUGA 2GU2A 3CXCY 1Q821 4BY1I 3J80f 4NBAA 1M902 2OTLZ 2NAPA 1S7MA 3S2DI 3I07A 1VQ9Z 2JNYA 1K8A1 3FQMA 2LEXA 1YHQ1 1VLAA 3FKII 3CC41 4A3BI 1N8R2 4NOZA 1VQ81 2JMOA 2R92I 1YUAA 1QVGY 3BG0B 1VQLZ 1Y8CA 2RHBA 2DE5A 2EGTA 1VQP1 2IV2X 2Q51A 3J80b 3S1NI 1P9NA 2JA6I 3I561 1KC82 3NH8A 1WW9A 2QR1B 3S1QI 2HF1A 4MD9A 1Q812 1WJ2A 1W2BY 1Q862 3I55Z 1SFOI 2VF1A 3CD61 4HGZA 4BBRI 2KI7B 3GTMI 1K732 2BJOA 2M6NA 1RO4A 3CC2Z 2P3YA 4RVGA 3CPWZ 2R7ZI 1YJW1 2PM9A 1Q822 3EERA 2VPZA 2QKDA 3G711 3S16I 3S17I 1K8A2 1S721 4NBCA 1YUKA 4NFRA 1NUIA 2JIOA 3CCR1 2QREB 4A3JI 2JUBA 3HOYI 3S14I 5LL6f 2OTJZ 2QA41 1M901 2W04A 1X3WA 5T67A 1K83I 3VMIA 4E30A 5IT9f 4MONA 1YHQZ 1VQ8Z 1Q7Y1 3S2HI 3NH4A 3H0GI 4HH4A 1VQPZ 1NJI1 3M3YI 5IP9I 3G4SZ 2E2II 1WIIA 4E32A 3MONA 1KRLA 3I56Z 5C4XI 1YJN1 3OW2Y 2ZAEB 3BG1B 2O4HA 2NVQI 3IX0A 2VPYA 1M1K1 1QF8A 5IT9b 3I4NI 2QRDB 2AYDA 3M4OI 2G2KA 3U50C 4A3LI 4A3FI 3CD6Z 4NBBA 2V8IA 1QYPA 3F3FC 1Z02A 2KPIA 4NBFA 1YI2Z 2J6AA 2P28A 1KQSZ 1TWFI 3CC71 4MXUA 3LUSA 5CM2M 1YJWZ 1QVFZ 2JIRA 2NVYI 2NVXI 1VQ6Z 4DK1A 2WAQA 1JJ2Z 5C4JI 2B63I 3G71Z 1USPB 1LQLA 4A93I 3HOXI 4RV9A 3PO3S 2M48A 4S1TA 3S1MI 4E31A 5T64A 1S72Z 2V3VA 3CCS1 3VMGA 5A2Qf 3CCRZ 1Q7Y2 2OOYB 1NJI2 1ZH1A 3CMA1 4QTTA 2QA4Z 4MRIA 3CCE1 3GTQI 2HU9A 1QVFY 2V8KA 3HOVI 2OZKA 2W03A 1M1K2 3S1RI 4RVFA 2JA7I 4NH1C 5A2Qb 4BBSI 1TWAI 3J7A4 1JWHC 1ZB8A 1Y1VS 1N2FA 1X3ZA 4Y52I 2GTHA 4NBHA 2YADA 1YJNZ 4A3MI 1KD11 4RS4A 2JIPA 3D6WA 2LIYA 3QWUA 4XX2A 3VB9A 1VQK1 3HKZA 1I6HI 3CCVZ 4NB8A 1TWGI 5C44I 3NDJA 2R6MA 3GCFA 3J81f 3ESWA 2VPXA 1VQ51 3CC7Z 2V8JA 3F3PC 4AYBA 4X6AI 4A3DI 4E33A 4TNUA 3HOZI 2JIQA 3CCJ1 3CME1 2R93I 3CPWY 3CCSZ 4Y7NI 3GKQA 2OTL1 2E2JI 3CC4Z 1VQ91 3CCL1 4E2YA 1AA6A 4E2ZA 4A3KI 2JR6A 2V45A 3CCEZ 1VQL1 1KD12 1R9TI 1RLYA 4NBEA 4A3CI 1Z03A 1VQ71 3GTJI 5IP7I 3G6E1 3MZKB 4RVDA 1ZB9A 2NVTI 2OOXB 2F4MA 3CCQ1 4A3EI 1VQN1 1WZNA 3NH5A 3T4NB 3I551 3TDHB 3GTOI 2QLVB 3CXCZ 3CCU1 1VQKZ 1YIT1 2RBLA 3JAMf 1Z01A 4NBGA 2K3RA 4EWCA 2LFUA 5AN9F 5T6BA 2PMZA 1VQ5Z 4MD7A 1QVGZ 3CCM1 3PO3I 2Q4ZA 3IF8A 1K9M1 1L1OC 4NB9A 3MZLB 3CCJZ 1X0TA 3JAMb 1KQSY 3CMEZ 2GTIA 2QRCB 1YIJ1 2OTJ1 3GTGI 1RO0A 3K7AI 2JA5I 1JJ2Y 1VQ41 3CCLZ 1W2BZ 2JIMA 3D2LA 2IZ4A 4MD8A 2F4OA 4CL1A 3GTLI 2RIQA 3NDIA 2QEX1 1Y1VI 5D1OB 3G4S1 1VQ7Z 2E2HI 3IR7A 1YJ91 3I4MI 3VTNA 1RQFA 2DE7A 3GTPI 4DQYB
chains in the Genus database with same CATH topology
5FLMI 2RT9A 2IZ3A 3H3VJ 2H85A 2K5RA 2O53A 4E2XA 3G6EZ 2RPRA 1VQM1 1TWHI 2JA8I 4RVHA 3GTMS 4E2WA 3CCQZ 2JS4A 1VQNZ 1Y1WI 2AKLA 3GTKI 3CCUZ 3PO2I 1DL6A 5C3EI 1YITZ 1YI21 1K9M2 1VQO1 1TFIA 3HOWI 1VQ61 2Y0SA 3J81b 1NP6A 3CCMZ 1I50I 4MH4A 1USPA 1PFTA 4DGLA 3CMAZ 3OW2Z 1I3QI 3IFUA 1YIJZ 1RO2A 2I3CA 2WB1A 1VQ4Z 3CQZI 2YU9I 3HOUI 4QTUA 4A3GI 3RZDI 1ML8A 4BXXI 2DE6A 3KIHA 3RZOI 1N8R1 2QEXZ 3P5JB 5FLXf 3S15I 1YJ9Z 1KC81 4A3II 3CC21 1VQMZ 3FQQA 3EEDA 5D1OA 3VMHA 4HGYA 5D1PA 1Q811 3CCV1 4NBDA 5FLXb 2VUMI 1Q861 2E9HA 2PK7A 3TE5B 3Q87A 3NFZA 1K731 1WCMI 4BY7I 1TWCI 1VQOZ 3D9XA 3KIFA 1RNIA 2VUGA 2GU2A 3CXCY 1Q821 4BY1I 3J80f 4NBAA 1M902 2OTLZ 1S7MA 3S2DI 3I07A 1VQ9Z 2JNYA 1K8A1 3FQMA 1YHQ1 1VLAA 3FKII 3CC41 4A3BI 1N8R2 4NOZA 1VQ81 2JMOA 2R92I 1YUAA 1QVGY 3BG0B 1VQLZ 2RHBA 2DE5A 2EGTA 1VQP1 2Q51A 3J80b 3S1NI 1P9NA 2JA6I 3I561 1KC82 3NH8A 1WW9A 2QR1B 3S1QI 2HF1A 4MD9A 1Q812 1W2BY 1Q862 3I55Z 1SFOI 2VF1A 3CD61 4HGZA 4BBRI 2KI7B 3GTMI 1K732 2BJOA 2M6NA 1RO4A 3CC2Z 2P3YA 4RVGA 3CPWZ 2R7ZI 1YJW1 2PM9A 1Q822 3EERA 2QKDA 3G711 3S16I 3S17I 1K8A2 1S721 4NBCA 1YUKA 4NFRA 1NUIA 3CCR1 2QREB 4A3JI 2JUBA 3HOYI 3S14I 5LL6f 2OTJZ 2QA41 1M901 2W04A 1X3WA 5T67A 1K83I 3VMIA 4E30A 5IT9f 4MONA 1YHQZ 1VQ8Z 1Q7Y1 3S2HI 3NH4A 3H0GI 4HH4A 1VQPZ 1NJI1 3M3YI 5IP9I 3G4SZ 2E2II 1WIIA 4E32A 3MONA 1KRLA 3I56Z 5C4XI 1YJN1 3OW2Y 2ZAEB 3BG1B 2O4HA 2NVQI 3IX0A 1M1K1 1QF8A 5IT9b 3I4NI 2QRDB 3M4OI 2G2KA 3U50C 4A3LI 4A3FI 3CD6Z 4NBBA 2V8IA 1QYPA 3F3FC 1Z02A 2KPIA 4NBFA 1YI2Z 2J6AA 2P28A 1KQSZ 1TWFI 3CC71 4MXUA 3LUSA 5CM2M 1YJWZ 1QVFZ 2NVYI 2NVXI 1VQ6Z 4DK1A 2WAQA 1JJ2Z 5C4JI 2B63I 3G71Z 1USPB 1LQLA 4A93I 3HOXI 4RV9A 3PO3S 2M48A 4S1TA 3S1MI 4E31A 5T64A 1S72Z 3CCS1 3VMGA 5A2Qf 3CCRZ 1Q7Y2 2OOYB 1NJI2 1ZH1A 3CMA1 4QTTA 2QA4Z 4MRIA 3CCE1 3GTQI 2HU9A 1QVFY 2V8KA 3HOVI 2OZKA 2W03A 1M1K2 3S1RI 4RVFA 2JA7I 4NH1C 5A2Qb 4BBSI 1TWAI 3J7A4 1JWHC 1ZB8A 1Y1VS 1N2FA 1X3ZA 4Y52I 2GTHA 4NBHA 2YADA 1YJNZ 4A3MI 1KD11 4RS4A 3D6WA 2LIYA 3QWUA 4XX2A 3VB9A 1VQK1 3HKZA 1I6HI 3CCVZ 4NB8A 1TWGI 5C44I 3NDJA 2R6MA 3GCFA 3J81f 3ESWA 1VQ51 3CC7Z 2V8JA 3F3PC 4AYBA 4X6AI 4A3DI 4E33A 4TNUA 3HOZI 3CCJ1 3CME1 2R93I 3CPWY 3CCSZ 4Y7NI 3GKQA 2OTL1 2E2JI 3CC4Z 1VQ91 3CCL1 4E2YA 4E2ZA 4A3KI 2JR6A 3CCEZ 1VQL1 1KD12 1R9TI 1RLYA 4NBEA 4A3CI 1Z03A 1VQ71 3GTJI 5IP7I 3G6E1 3MZKB 4RVDA 1ZB9A 2NVTI 2OOXB 2F4MA 3CCQ1 4A3EI 1VQN1 3NH5A 3T4NB 3I551 3TDHB 3GTOI 2QLVB 3CXCZ 3CCU1 1VQKZ 1YIT1 2RBLA 3JAMf 1Z01A 4NBGA 2K3RA 4EWCA 2LFUA 5AN9F 5T6BA 2PMZA 1VQ5Z 4MD7A 1QVGZ 3CCM1 3PO3I 2Q4ZA 3IF8A 1K9M1 1L1OC 4NB9A 3MZLB 3CCJZ 1X0TA 3JAMb 1KQSY 3CMEZ 2GTIA 2QRCB 1YIJ1 2OTJ1 3GTGI 1RO0A 3K7AI 2JA5I 1JJ2Y 1VQ41 3CCLZ 1W2BZ 2IZ4A 4MD8A 2F4OA 4CL1A 3GTLI 2RIQA 3NDIA 2QEX1 1Y1VI 5D1OB 3G4S1 1VQ7Z 2E2HI 1YJ91 3I4MI 3VTNA 1RQFA 2DE7A 3GTPI 4DQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME 1;  1M90 2;  2OTL Z;  3CPW Y;  3G6E Z;  3CCS Z;  1VQM 1;  2OTL 1;  1VQ9 Z;  3CCQ Z;  1K8A 1;  3CC4 Z;  1VQN Z;  1YHQ 1;  3CD6 Z;  1VQ9 1;  3CCL 1;  3CC4 1;  1N8R 2;  1VQ8 1;  1QVG Y;  3CCU Z;  1YI2 Z;  1VQL Z;  1KQS Z;  1YIT Z;  3CCE Z;  3CC7 1;  1VQP 1;  1YI2 1;  1VQL 1;  1K9M 2;  1KD1 2;  1YJW Z;  1QVF Z;  1VQ6 Z;  3I56 1;  1JJ2 Z;  1VQO 1;  1VQ7 1;  3G71 Z;  1KC8 2;  1VQ6 1;  3CCM Z;  1Q81 2;  1S72 Z;  3G6E 1;  3CCS 1;  3CCR Z;  1W2B Y;  1Q7Y 2;  1Q86 2;  3I55 Z;  3CCQ 1;  1VQN 1;  3CD6 1;  3CMA Z;  3OW2 Z;  1NJI 2;  3I55 1;  1K73 2;  3CMA 1;  3CXC Z;  3CCU 1;  1YIJ Z;  2QA4 Z;  3CC2 Z;  1VQK Z;  1YIT 1;  3CCE 1;  3CPW Z;  1QVF Y;  1VQ4 Z;  1YJW 1;  1Q82 2;  1M1K 2;  3G71 1;  1VQ5 Z;  1N8R 1;  1QVG Z;  2QEX Z;  3CCM 1;  1K8A 2;  1S72 1;  1YJN Z;  3CCR 1;  1YJ9 Z;  1K9M 1;  1KD1 1;  3CCJ Z;  1KQS Y;  3CME Z;  2OTJ Z;  1KC8 1;  1YIJ 1;  2QA4 1;  1M90 1;  3CC2 1;  1VQK 1;  1VQM Z;  2OTJ 1;  3CCV Z;  1Q81 1;  1JJ2 Y;  1VQ4 1;  1YHQ Z;  3CCV 1;  3CCL Z;  1W2B Z;  1VQ8 Z;  1Q7Y 1;  1Q86 1;  1VQ5 1;  3CC7 Z;  1VQP Z;  1NJI 1;  1K73 1;  2QEX 1;  3G4S Z;  1YJN 1;  3G4S 1;  3I56 Z;  1VQO Z;  3OW2 Y;  1VQ7 Z;  1YJ9 1;  3CCJ 1;  3CXC Y;  1Q82 1;  1M1K 1; 
#chains in the Genus database with same CATH topology
 5FLM I;  2RT9 A;  2IZ3 A;  3H3V J;  2H85 A;  2K5R A;  2O53 A;  4E2X A;  2VPW A;  3G6E Z;  2RPR A;  1VQM 1;  1TWH I;  2JA8 I;  4RVH A;  3GTM S;  4E2W A;  3CCQ Z;  2JS4 A;  1VQN Z;  1Y1W I;  1SIW A;  2AKL A;  3GTK I;  3CCU Z;  3PO2 I;  1DL6 A;  1Q16 A;  5C3E I;  1YIT Z;  1YI2 1;  2E7Z A;  1QXF A;  1K9M 2;  1VQO 1;  1TFI A;  3HOW I;  1VQ6 1;  2Y0S A;  3J81 b;  1NP6 A;  3CCM Z;  1I50 I;  4MH4 A;  1USP A;  1PFT A;  4DGL A;  3CMA Z;  3OW2 Z;  1I3Q I;  3IFU A;  1YIJ Z;  1RO2 A;  2I3C A;  2WB1 A;  1VQ4 Z;  3CQZ I;  2YU9 I;  3HOU I;  4QTU A;  4A3G I;  3RZD I;  1ML8 A;  4BXX I;  2DE6 A;  3KIH A;  3RZO I;  1N8R 1;  2QEX Z;  3P5J B;  5FLX f;  3S15 I;  1YJ9 Z;  1KC8 1;  1FDO A;  4A3I I;  3CC2 1;  1VQM Z;  3FQQ A;  3EED A;  5D1O A;  3VMH A;  4HGY A;  5D1P A;  1Q81 1;  3CCV 1;  4NBD A;  1FDI A;  5FLX b;  2VUM I;  1Q86 1;  2E9H A;  2PK7 A;  3TE5 B;  3Q87 A;  3NFZ A;  1K73 1;  1WCM I;  4BY7 I;  1TWC I;  1VQO Z;  3D9X A;  3KIF A;  1RNI A;  2VUG A;  2GU2 A;  3CXC Y;  1Q82 1;  4BY1 I;  3J80 f;  4NBA A;  1M90 2;  2OTL Z;  2NAP A;  1S7M A;  3S2D I;  3I07 A;  1VQ9 Z;  2JNY A;  1K8A 1;  3FQM A;  2LEX A;  1YHQ 1;  1VLA A;  3FKI I;  3CC4 1;  4A3B I;  1N8R 2;  4NOZ A;  1VQ8 1;  2JMO A;  2R92 I;  1YUA A;  1QVG Y;  3BG0 B;  1VQL Z;  1Y8C A;  2RHB A;  2DE5 A;  2EGT A;  1VQP 1;  2IV2 X;  2Q51 A;  3J80 b;  3S1N I;  1P9N A;  2JA6 I;  3I56 1;  1KC8 2;  3NH8 A;  1WW9 A;  2QR1 B;  3S1Q I;  2HF1 A;  4MD9 A;  1Q81 2;  1WJ2 A;  1W2B Y;  1Q86 2;  3I55 Z;  1SFO I;  2VF1 A;  3CD6 1;  4HGZ A;  4BBR I;  2KI7 B;  3GTM I;  1K73 2;  2BJO A;  2M6N A;  1RO4 A;  3CC2 Z;  2P3Y A;  4RVG A;  3CPW Z;  2R7Z I;  1YJW 1;  2PM9 A;  1Q82 2;  3EER A;  2VPZ A;  2QKD A;  3G71 1;  3S16 I;  3S17 I;  1K8A 2;  1S72 1;  4NBC A;  1YUK A;  4NFR A;  1NUI A;  2JIO A;  3CCR 1;  2QRE B;  4A3J I;  2JUB A;  3HOY I;  3S14 I;  5LL6 f;  2OTJ Z;  2QA4 1;  1M90 1;  2W04 A;  1X3W A;  5T67 A;  1K83 I;  3VMI A;  4E30 A;  5IT9 f;  4MON A;  1YHQ Z;  1VQ8 Z;  1Q7Y 1;  3S2H I;  3NH4 A;  3H0G I;  4HH4 A;  1VQP Z;  1NJI 1;  3M3Y I;  5IP9 I;  3G4S Z;  2E2I I;  1WII A;  4E32 A;  3MON A;  1KRL A;  3I56 Z;  5C4X I;  1YJN 1;  3OW2 Y;  2ZAE B;  3BG1 B;  2O4H A;  2NVQ I;  3IX0 A;  2VPY A;  1M1K 1;  1QF8 A;  5IT9 b;  3I4N I;  2QRD B;  2AYD A;  3M4O I;  2G2K A;  3U50 C;  4A3L I;  4A3F I;  3CD6 Z;  4NBB A;  2V8I A;  1QYP A;  3F3F C;  1Z02 A;  2KPI A;  4NBF A;  1YI2 Z;  2J6A A;  2P28 A;  1KQS Z;  1TWF I;  3CC7 1;  4MXU A;  3LUS A;  5CM2 M;  1YJW Z;  1QVF Z;  2JIR A;  2NVY I;  2NVX I;  1VQ6 Z;  4DK1 A;  2WAQ A;  1JJ2 Z;  5C4J I;  2B63 I;  3G71 Z;  1USP B;  1LQL A;  4A93 I;  3HOX I;  4RV9 A;  3PO3 S;  2M48 A;  4S1T A;  3S1M I;  4E31 A;  5T64 A;  1S72 Z;  2V3V A;  3CCS 1;  3VMG A;  5A2Q f;  3CCR Z;  1Q7Y 2;  2OOY B;  1NJI 2;  1ZH1 A;  3CMA 1;  4QTT A;  2QA4 Z;  4MRI A;  3CCE 1;  3GTQ I;  2HU9 A;  1QVF Y;  2V8K A;  3HOV I;  2OZK A;  2W03 A;  1M1K 2;  3S1R I;  4RVF A;  2JA7 I;  4NH1 C;  5A2Q b;  4BBS I;  1TWA I;  3J7A 4;  1JWH C;  1ZB8 A;  1Y1V S;  1N2F A;  1X3Z A;  4Y52 I;  2GTH A;  4NBH A;  2YAD A;  1YJN Z;  4A3M I;  1KD1 1;  4RS4 A;  2JIP A;  3D6W A;  2LIY A;  3QWU A;  4XX2 A;  3VB9 A;  1VQK 1;  3HKZ A;  1I6H I;  3CCV Z;  4NB8 A;  1TWG I;  5C44 I;  3NDJ A;  2R6M A;  3GCF A;  3J81 f;  3ESW A;  2VPX A;  1VQ5 1;  3CC7 Z;  2V8J A;  3F3P C;  4AYB A;  4X6A I;  4A3D I;  4E33 A;  4TNU A;  3HOZ I;  2JIQ A;  3CCJ 1;  3CME 1;  2R93 I;  3CPW Y;  3CCS Z;  4Y7N I;  3GKQ A;  2OTL 1;  2E2J I;  3CC4 Z;  1VQ9 1;  3CCL 1;  4E2Y A;  1AA6 A;  4E2Z A;  4A3K I;  2JR6 A;  2V45 A;  3CCE Z;  1VQL 1;  1KD1 2;  1R9T I;  1RLY A;  4NBE A;  4A3C I;  1Z03 A;  1VQ7 1;  3GTJ I;  5IP7 I;  3G6E 1;  3MZK B;  4RVD A;  1ZB9 A;  2NVT I;  2OOX B;  2F4M A;  3CCQ 1;  4A3E I;  1VQN 1;  1WZN A;  3NH5 A;  3T4N B;  3I55 1;  3TDH B;  3GTO I;  2QLV B;  3CXC Z;  3CCU 1;  1VQK Z;  1YIT 1;  2RBL A;  3JAM f;  1Z01 A;  4NBG A;  2K3R A;  4EWC A;  2LFU A;  5AN9 F;  5T6B A;  2PMZ A;  1VQ5 Z;  4MD7 A;  1QVG Z;  3CCM 1;  3PO3 I;  2Q4Z A;  3IF8 A;  1K9M 1;  1L1O C;  4NB9 A;  3MZL B;  3CCJ Z;  1X0T A;  3JAM b;  1KQS Y;  3CME Z;  2GTI A;  2QRC B;  1YIJ 1;  2OTJ 1;  3GTG I;  1RO0 A;  3K7A I;  2JA5 I;  1JJ2 Y;  1VQ4 1;  3CCL Z;  1W2B Z;  2JIM A;  3D2L A;  2IZ4 A;  4MD8 A;  2F4O A;  4CL1 A;  3GTL I;  2RIQ A;  3NDI A;  2QEX 1;  1Y1V I;  5D1O B;  3G4S 1;  1VQ7 Z;  2E2H I;  3IR7 A;  1YJ9 1;  3I4M I;  3VTN A;  1RQF A;  2DE7 A;  3GTP I;  4DQY B; 
#chains in the Genus database with same CATH homology
 5FLM I;  2RT9 A;  2IZ3 A;  3H3V J;  2H85 A;  2K5R A;  2O53 A;  4E2X A;  3G6E Z;  2RPR A;  1VQM 1;  1TWH I;  2JA8 I;  4RVH A;  3GTM S;  4E2W A;  3CCQ Z;  2JS4 A;  1VQN Z;  1Y1W I;  2AKL A;  3GTK I;  3CCU Z;  3PO2 I;  1DL6 A;  5C3E I;  1YIT Z;  1YI2 1;  1K9M 2;  1VQO 1;  1TFI A;  3HOW I;  1VQ6 1;  2Y0S A;  3J81 b;  1NP6 A;  3CCM Z;  1I50 I;  4MH4 A;  1USP A;  1PFT A;  4DGL A;  3CMA Z;  3OW2 Z;  1I3Q I;  3IFU A;  1YIJ Z;  1RO2 A;  2I3C A;  2WB1 A;  1VQ4 Z;  3CQZ I;  2YU9 I;  3HOU I;  4QTU A;  4A3G I;  3RZD I;  1ML8 A;  4BXX I;  2DE6 A;  3KIH A;  3RZO I;  1N8R 1;  2QEX Z;  3P5J B;  5FLX f;  3S15 I;  1YJ9 Z;  1KC8 1;  4A3I I;  3CC2 1;  1VQM Z;  3FQQ A;  3EED A;  5D1O A;  3VMH A;  4HGY A;  5D1P A;  1Q81 1;  3CCV 1;  4NBD A;  5FLX b;  2VUM I;  1Q86 1;  2E9H A;  2PK7 A;  3TE5 B;  3Q87 A;  3NFZ A;  1K73 1;  1WCM I;  4BY7 I;  1TWC I;  1VQO Z;  3D9X A;  3KIF A;  1RNI A;  2VUG A;  2GU2 A;  3CXC Y;  1Q82 1;  4BY1 I;  3J80 f;  4NBA A;  1M90 2;  2OTL Z;  1S7M A;  3S2D I;  3I07 A;  1VQ9 Z;  2JNY A;  1K8A 1;  3FQM A;  1YHQ 1;  1VLA A;  3FKI I;  3CC4 1;  4A3B I;  1N8R 2;  4NOZ A;  1VQ8 1;  2JMO A;  2R92 I;  1YUA A;  1QVG Y;  3BG0 B;  1VQL Z;  2RHB A;  2DE5 A;  2EGT A;  1VQP 1;  2Q51 A;  3J80 b;  3S1N I;  1P9N A;  2JA6 I;  3I56 1;  1KC8 2;  3NH8 A;  1WW9 A;  2QR1 B;  3S1Q I;  2HF1 A;  4MD9 A;  1Q81 2;  1W2B Y;  1Q86 2;  3I55 Z;  1SFO I;  2VF1 A;  3CD6 1;  4HGZ A;  4BBR I;  2KI7 B;  3GTM I;  1K73 2;  2BJO A;  2M6N A;  1RO4 A;  3CC2 Z;  2P3Y A;  4RVG A;  3CPW Z;  2R7Z I;  1YJW 1;  2PM9 A;  1Q82 2;  3EER A;  2QKD A;  3G71 1;  3S16 I;  3S17 I;  1K8A 2;  1S72 1;  4NBC A;  1YUK A;  4NFR A;  1NUI A;  3CCR 1;  2QRE B;  4A3J I;  2JUB A;  3HOY I;  3S14 I;  5LL6 f;  2OTJ Z;  2QA4 1;  1M90 1;  2W04 A;  1X3W A;  5T67 A;  1K83 I;  3VMI A;  4E30 A;  5IT9 f;  4MON A;  1YHQ Z;  1VQ8 Z;  1Q7Y 1;  3S2H I;  3NH4 A;  3H0G I;  4HH4 A;  1VQP Z;  1NJI 1;  3M3Y I;  5IP9 I;  3G4S Z;  2E2I I;  1WII A;  4E32 A;  3MON A;  1KRL A;  3I56 Z;  5C4X I;  1YJN 1;  3OW2 Y;  2ZAE B;  3BG1 B;  2O4H A;  2NVQ I;  3IX0 A;  1M1K 1;  1QF8 A;  5IT9 b;  3I4N I;  2QRD B;  3M4O I;  2G2K A;  3U50 C;  4A3L I;  4A3F I;  3CD6 Z;  4NBB A;  2V8I A;  1QYP A;  3F3F C;  1Z02 A;  2KPI A;  4NBF A;  1YI2 Z;  2J6A A;  2P28 A;  1KQS Z;  1TWF I;  3CC7 1;  4MXU A;  3LUS A;  5CM2 M;  1YJW Z;  1QVF Z;  2NVY I;  2NVX I;  1VQ6 Z;  4DK1 A;  2WAQ A;  1JJ2 Z;  5C4J I;  2B63 I;  3G71 Z;  1USP B;  1LQL A;  4A93 I;  3HOX I;  4RV9 A;  3PO3 S;  2M48 A;  4S1T A;  3S1M I;  4E31 A;  5T64 A;  1S72 Z;  3CCS 1;  3VMG A;  5A2Q f;  3CCR Z;  1Q7Y 2;  2OOY B;  1NJI 2;  1ZH1 A;  3CMA 1;  4QTT A;  2QA4 Z;  4MRI A;  3CCE 1;  3GTQ I;  2HU9 A;  1QVF Y;  2V8K A;  3HOV I;  2OZK A;  2W03 A;  1M1K 2;  3S1R I;  4RVF A;  2JA7 I;  4NH1 C;  5A2Q b;  4BBS I;  1TWA I;  3J7A 4;  1JWH C;  1ZB8 A;  1Y1V S;  1N2F A;  1X3Z A;  4Y52 I;  2GTH A;  4NBH A;  2YAD A;  1YJN Z;  4A3M I;  1KD1 1;  4RS4 A;  3D6W A;  2LIY A;  3QWU A;  4XX2 A;  3VB9 A;  1VQK 1;  3HKZ A;  1I6H I;  3CCV Z;  4NB8 A;  1TWG I;  5C44 I;  3NDJ A;  2R6M A;  3GCF A;  3J81 f;  3ESW A;  1VQ5 1;  3CC7 Z;  2V8J A;  3F3P C;  4AYB A;  4X6A I;  4A3D I;  4E33 A;  4TNU A;  3HOZ I;  3CCJ 1;  3CME 1;  2R93 I;  3CPW Y;  3CCS Z;  4Y7N I;  3GKQ A;  2OTL 1;  2E2J I;  3CC4 Z;  1VQ9 1;  3CCL 1;  4E2Y A;  4E2Z A;  4A3K I;  2JR6 A;  3CCE Z;  1VQL 1;  1KD1 2;  1R9T I;  1RLY A;  4NBE A;  4A3C I;  1Z03 A;  1VQ7 1;  3GTJ I;  5IP7 I;  3G6E 1;  3MZK B;  4RVD A;  1ZB9 A;  2NVT I;  2OOX B;  2F4M A;  3CCQ 1;  4A3E I;  1VQN 1;  3NH5 A;  3T4N B;  3I55 1;  3TDH B;  3GTO I;  2QLV B;  3CXC Z;  3CCU 1;  1VQK Z;  1YIT 1;  2RBL A;  3JAM f;  1Z01 A;  4NBG A;  2K3R A;  4EWC A;  2LFU A;  5AN9 F;  5T6B A;  2PMZ A;  1VQ5 Z;  4MD7 A;  1QVG Z;  3CCM 1;  3PO3 I;  2Q4Z A;  3IF8 A;  1K9M 1;  1L1O C;  4NB9 A;  3MZL B;  3CCJ Z;  1X0T A;  3JAM b;  1KQS Y;  3CME Z;  2GTI A;  2QRC B;  1YIJ 1;  2OTJ 1;  3GTG I;  1RO0 A;  3K7A I;  2JA5 I;  1JJ2 Y;  1VQ4 1;  3CCL Z;  1W2B Z;  2IZ4 A;  4MD8 A;  2F4O A;  4CL1 A;  3GTL I;  2RIQ A;  3NDI A;  2QEX 1;  1Y1V I;  5D1O B;  3G4S 1;  1VQ7 Z;  2E2H I;  1YJ9 1;  3I4M I;  3VTN A;  1RQF A;  2DE7 A;  3GTP I;  4DQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...