1VQ8Z

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq8Z00
3OW2Z 1YJNZ 1VQLZ 1Q7Y2 1VQN1 1VQMZ 1VQ71 1YITZ 3CXCY 1M902 3CCR1 3CCM1 1K8A1 3CXCZ 1YJ91 3I551 1VQ9Z 2OTLZ 1VQ81 3CC21 1YIT1 1K732 1N8R1 2QA41 3CCRZ 1VQ61 1VQ91 1Q861 1QVFY 1NJI1 2OTL1 3CC71 3I55Z 1QVGY 1VQO1 3CMEZ 1VQ8Z 1YJWZ 3CC2Z 2QEXZ 1QVGZ 1KQSY 3CPWY 2QA4Z 1K9M1 1VQ6Z 1K8A2 3CPWZ 2OTJ1 1YI2Z 1VQP1 3CMA1 3CME1 1YJW1 1VQK1 3CC7Z 2QEX1 3CCQ1 1VQOZ 1M1K1 3CCLZ 1YI21 1KD11 1JJ2Y 1N8R2 1Q821 1Q811 1W2BY 1JJ2Z 1M1K2 2OTJZ 1QVFZ 1VQPZ 3CMAZ 1Q862 1VQKZ 1NJI2 3I561 1Q822 3CD61 3CCQZ 3CCS1 3G6EZ 3CCE1 3CCL1 1KQSZ 3CCVZ 1VQ4Z 1Q7Y1 1K9M2 3G6E1 3CC41 1YIJZ 3CCJ1 3I56Z 1S721 3CD6Z 3CCSZ 3CCEZ 3CCV1 3CCU1 1YHQ1 1VQ41 3G711 1VQ51 1KD12 1YIJ1 1W2BZ 1K731 1YJN1 3G4SZ 1VQL1 1KC81 1Q812 1VQM1 3CC4Z 3CCJZ 1S72Z 1VQNZ 1KC82 3CCUZ 1VQ7Z 1YHQZ 3CCMZ 3G4S1 3OW2Y 3G71Z 1VQ5Z 1M901 1YJ9Z
chains in the Genus database with same CATH superfamily
2DE6A 1YJNZ 1VQLZ 1Q7Y2 1VQN1 2JIPA 2JIRA 4E30A 1NP6A 1YITZ 3CXCY 2RT9A 3CCM1 3Q87A 1TWCI 3D6WA 4A3BI 3CXCZ 4NBBA 1YJ91 2IV2X 1RQFA 5C3EI 3MZLB 2E2HI 2AYDA 2WAQA 5C4JI 1VLAA 1Z03A 1N2FA 4NBFA 4XX2A 2GU2A 4MXUA 3K7AI 1SIWA 2E2II 3MONA 3RZDI 1NJI1 2VPZA 2J6AA 1QVGY 1QVGZ 4NBGA 1WIIA 2E2JI 2OOYB 1K9M1 3FQQA 3HOVI 1RO0A 5A2Qf 3GTOI 3CMA1 3CME1 2AKLA 1FDIA 2E9HA 3NFZA 3P5JB 1Z01A 4A3LI 1M1K1 2NVQI 4A3MI 4EWCA 2JA8I 1YI21 3S14I 4NB8A 1KRLA 1M1K2 1WCMI 4RVDA 4NOZA 3CMAZ 1Q862 2RPRA 3MZKB 3CCS1 2G2KA 2Q51A 2QKDA 3G6EZ 3CCL1 1Y1VI 4NH1C 4Y52I 2P3YA 1Y1WI 3CCVZ 3JAMf 2R93I 5FLXb 4A3FI 3S17I 3CC41 2OOXB 1ZH1A 3CCSZ 5LL6f 2F4OA 2W03A 1YHQ1 3D9XA 4MD9A 3S2DI 4Y7NI 1VQ51 1ZB9A 4BBSI 4NBHA 5D1PA 1YIJ1 1K731 3G4SZ 2R92I 3KIHA 3CC4Z 3GTPI 2IZ3A 4NBAA 3S1QI 4MD8A 1YHQZ 3H3VJ 1VQ5Z 3IF8A 1Z02A 1Y8CA 4E32A 4QTUA 5D1OB 2RBLA 4RVHA 1I6HI 3VTNA 3NH8A 3GTJI 4DK1A 2KPIA 2OTLZ 3CC21 1YIT1 3M4OI 1WJ2A 4MD7A 3S2HI 5FLMI 1QVFY 5C4XI 3U50C 1X3WA 1YJWZ 3CC2Z 1KQSY 3J7A4 1TWFI 4A3JI 3CPWY 3CPWZ 2OTJ1 2JIQA 4BBRI 3I07A 3CCQ1 3J81b 1Q16A 1R9TI 1KD11 3GTMS 2JR6A 2E7ZA 2GTHA 4NFRA 2VUGA 2VPWA 4NBEA 1Q811 2OTJZ 1WZNA 4A3CI 3S16I 1NJI2 1USPB 3CCQZ 1RO4A 1ML8A 5FLXf 3FQMA 2LIYA 1AA6A 2QLVB 1VQ4Z 1K9M2 4A93I 2NVYI 3G6E1 4MRIA 2DE7A 3H0GI 2V3VA 3CCV1 5IT9b 3CCU1 3GTGI 4E31A 2JA5I 1TFIA 2JUBA 2PMZA 3I4NI 2YU9I 4HGZA 5CM2M 2W04A 1KC81 1VQM1 3TDHB 2B63I 1ZB8A 2QR1B 1KC82 2V45A 4A3EI 4TNUA 3CCUZ 1VQ7Z 4X6AI 3G4S1 3OW2Y 2JIMA 3M3YI 3IFUA 1M901 3OW2Z 2LEXA 1VQMZ 5T6BA 2OZKA 1M902 3CCR1 1QYPA 1X3ZA 1K8A1 2RHBA 2H85A 3FKII 2JNYA 4BXXI 1RO2A 2NVTI 3EERA 4AYBA 3J80b 3I551 5AN9F 1VQ9Z 2JIOA 1VQ81 1K732 2M48A 1I50I 1N8R1 2QA41 3CCRZ 3T4NB 5IP7I 1USPA 2OTL1 2V8KA 3CC71 1Y1VS 3I55Z 4QTTA 1VQO1 1VQ8Z 2QREB 3S1MI 2F4MA 2QEXZ 1TWAI 3PO3I 4E2XA 2QA4Z 3J81f 2LFUA 3GCFA 1YJW1 1VQK1 3CC7Z 1VQOZ 3HOYI 3IR7A 3VMHA 3NH5A 4E2YA 1W2BY 4A3DI 1QVFZ 1VQKZ 2DE5A 3CD61 2VF1A 2NVXI 1KQSZ 2ZAEB 3F3FC 3QWUA 5IT9f 1Q7Y1 2PM9A 4HGYA 1SFOI 3CCJ1 2QRCB 3S1NI 1S721 3CD6Z 1NUIA 3HOWI 2K5RA 4A3KI 2M6NA 1DL6A 3HOZI 1VQ41 3G711 3VMGA 2PK7A 1KD12 2K3RA 3GKQA 1YUAA 3CQZI 3LUSA 4DQYB 1Q812 3BG1B 3CCJZ 5T64A 1K83I 4A3GI 1P9NA 1S72Z 2Y0SA 1VQNZ 1X0TA 1TWHI 3EEDA 4CL1A 1QXFA 3CCMZ 5D1OA 3G71Z 2O4HA 1YJ9Z 3KIFA 3IX0A 2JA6I 3J80f 1VQ71 1YUKA 5T67A 4E2ZA 1FDOA 3NH4A 3ESWA 3TE5B 3BG0B 1JWHC 3VB9A 4MONA 4NB9A 2JS4A 2BJOA 2R7ZI 1VQ61 5C44I 4DGLA 1VQ91 1Q861 2IZ4A 4BY1I 2V8IA 4RVFA 3CMEZ 4E2WA 4RS4A 4A3II 1I3QI 1QF8A 3VMIA 2EGTA 1VQ6Z 1K8A2 3NDIA 1YI2Z 1WW9A 1VQP1 1TWGI 4HH4A 2RIQA 2QEX1 2YADA 2KI7B 3S15I 4RVGA 5A2Qb 1L1OC 3F3PC 3CCLZ 1JJ2Y 1N8R2 1Q821 1JJ2Z 4E33A 2R6MA 3GTKI 1VQPZ 3GTQI 3I561 4BY7I 1Q822 3S1RI 2VPXA 4S1TA 3D2LA 5IP9I 3CCE1 3I4MI 2I3CA 2JMOA 2VPYA 1PFTA 1YIJZ 1RNIA 1RLYA 3I56Z 3CCEZ 1LQLA 3JAMb 2O53A 3HOUI 2NAPA 1S7MA 3PO2I 4NBCA 2GTIA 1W2BZ 1YJN1 3RZOI 1VQL1 3GTMI 3HOXI 2WB1A 2Q4ZA 4MH4A 2QRDB 2VUMI 4NBDA 3GTLI 2HF1A 4RV9A 2JA7I 2HU9A 3NDJA 2V8JA 2P28A 3PO3S 3HKZA
chains in the Genus database with same CATH topology
2DE6A 1YJNZ 1VQLZ 1Q7Y2 1VQN1 4E30A 1NP6A 1YITZ 3CXCY 2RT9A 3CCM1 3Q87A 1TWCI 3D6WA 4A3BI 3CXCZ 4NBBA 1YJ91 1RQFA 5C3EI 3MZLB 2E2HI 2WAQA 5C4JI 1VLAA 1Z03A 1N2FA 4NBFA 4XX2A 2GU2A 4MXUA 3K7AI 2E2II 3MONA 3RZDI 1NJI1 2J6AA 1QVGY 1QVGZ 4NBGA 1WIIA 2E2JI 2OOYB 1K9M1 3FQQA 3HOVI 1RO0A 5A2Qf 3GTOI 3CMA1 3CME1 2AKLA 2E9HA 3NFZA 3P5JB 1Z01A 4A3LI 1M1K1 2NVQI 4A3MI 4EWCA 2JA8I 1YI21 3S14I 4NB8A 1KRLA 1M1K2 1WCMI 4RVDA 4NOZA 3CMAZ 1Q862 2RPRA 3MZKB 3CCS1 2G2KA 2Q51A 2QKDA 3G6EZ 3CCL1 1Y1VI 4NH1C 4Y52I 2P3YA 1Y1WI 3CCVZ 3JAMf 2R93I 5FLXb 4A3FI 3S17I 3CC41 2OOXB 1ZH1A 3CCSZ 5LL6f 2F4OA 2W03A 1YHQ1 3D9XA 4MD9A 3S2DI 4Y7NI 1VQ51 1ZB9A 4BBSI 4NBHA 5D1PA 1YIJ1 1K731 3G4SZ 2R92I 3KIHA 3CC4Z 3GTPI 2IZ3A 4NBAA 3S1QI 4MD8A 1YHQZ 3H3VJ 1VQ5Z 3IF8A 1Z02A 4E32A 4QTUA 5D1OB 2RBLA 4RVHA 1I6HI 3VTNA 3NH8A 3GTJI 4DK1A 2KPIA 2OTLZ 3CC21 1YIT1 3M4OI 4MD7A 3S2HI 5FLMI 1QVFY 5C4XI 3U50C 1X3WA 1YJWZ 3CC2Z 1KQSY 3J7A4 1TWFI 4A3JI 3CPWY 3CPWZ 2OTJ1 4BBRI 3I07A 3CCQ1 3J81b 1R9TI 1KD11 3GTMS 2JR6A 2GTHA 4NFRA 2VUGA 4NBEA 1Q811 2OTJZ 4A3CI 3S16I 1NJI2 1USPB 3CCQZ 1RO4A 1ML8A 5FLXf 3FQMA 2LIYA 2QLVB 1VQ4Z 1K9M2 4A93I 2NVYI 3G6E1 4MRIA 2DE7A 3H0GI 3CCV1 5IT9b 3CCU1 3GTGI 4E31A 2JA5I 1TFIA 2JUBA 2PMZA 3I4NI 2YU9I 4HGZA 5CM2M 2W04A 1KC81 1VQM1 3TDHB 2B63I 1ZB8A 2QR1B 1KC82 4A3EI 4TNUA 3CCUZ 1VQ7Z 4X6AI 3G4S1 3OW2Y 3M3YI 3IFUA 1M901 3OW2Z 1VQMZ 5T6BA 2OZKA 1M902 3CCR1 1QYPA 1X3ZA 1K8A1 2RHBA 2H85A 3FKII 2JNYA 4BXXI 1RO2A 2NVTI 3EERA 4AYBA 3J80b 3I551 5AN9F 1VQ9Z 1VQ81 1K732 2M48A 1I50I 1N8R1 2QA41 3CCRZ 3T4NB 5IP7I 1USPA 2OTL1 2V8KA 3CC71 1Y1VS 3I55Z 4QTTA 1VQO1 1VQ8Z 2QREB 3S1MI 2F4MA 2QEXZ 1TWAI 3PO3I 4E2XA 2QA4Z 3J81f 2LFUA 3GCFA 1YJW1 1VQK1 3CC7Z 1VQOZ 3HOYI 3VMHA 3NH5A 4E2YA 1W2BY 4A3DI 1QVFZ 1VQKZ 2DE5A 3CD61 2VF1A 2NVXI 1KQSZ 2ZAEB 3F3FC 3QWUA 5IT9f 1Q7Y1 2PM9A 4HGYA 1SFOI 3CCJ1 2QRCB 3S1NI 1S721 3CD6Z 1NUIA 3HOWI 2K5RA 4A3KI 2M6NA 1DL6A 3HOZI 1VQ41 3G711 3VMGA 2PK7A 1KD12 2K3RA 3GKQA 1YUAA 3CQZI 3LUSA 4DQYB 1Q812 3BG1B 3CCJZ 5T64A 1K83I 4A3GI 1P9NA 1S72Z 2Y0SA 1VQNZ 1X0TA 1TWHI 3EEDA 4CL1A 3CCMZ 5D1OA 3G71Z 2O4HA 1YJ9Z 3KIFA 3IX0A 2JA6I 3J80f 1VQ71 1YUKA 5T67A 4E2ZA 3NH4A 3ESWA 3TE5B 3BG0B 1JWHC 3VB9A 4MONA 4NB9A 2JS4A 2BJOA 2R7ZI 1VQ61 5C44I 4DGLA 1VQ91 1Q861 2IZ4A 4BY1I 2V8IA 4RVFA 3CMEZ 4E2WA 4RS4A 4A3II 1I3QI 1QF8A 3VMIA 2EGTA 1VQ6Z 1K8A2 3NDIA 1YI2Z 1WW9A 1VQP1 1TWGI 4HH4A 2RIQA 2QEX1 2YADA 2KI7B 3S15I 4RVGA 5A2Qb 1L1OC 3F3PC 3CCLZ 1JJ2Y 1N8R2 1Q821 1JJ2Z 4E33A 2R6MA 3GTKI 1VQPZ 3GTQI 3I561 4BY7I 1Q822 3S1RI 5IP9I 4S1TA 3CCE1 3I4MI 2I3CA 2JMOA 1PFTA 1YIJZ 1RNIA 1RLYA 3I56Z 3CCEZ 1LQLA 3JAMb 2O53A 3HOUI 1S7MA 3PO2I 4NBCA 2GTIA 1W2BZ 1YJN1 3RZOI 1VQL1 3GTMI 3HOXI 2WB1A 2Q4ZA 4MH4A 2QRDB 2VUMI 4NBDA 3GTLI 2HF1A 4RV9A 2JA7I 2HU9A 3NDJA 2V8JA 2P28A 3PO3S 3HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Z;  1YJN Z;  1VQL Z;  1Q7Y 2;  1VQN 1;  1VQM Z;  1VQ7 1;  1YIT Z;  3CXC Y;  1M90 2;  3CCR 1;  3CCM 1;  1K8A 1;  3CXC Z;  1YJ9 1;  3I55 1;  1VQ9 Z;  2OTL Z;  1VQ8 1;  3CC2 1;  1YIT 1;  1K73 2;  1N8R 1;  2QA4 1;  3CCR Z;  1VQ6 1;  1VQ9 1;  1Q86 1;  1QVF Y;  1NJI 1;  2OTL 1;  3CC7 1;  3I55 Z;  1QVG Y;  1VQO 1;  3CME Z;  1VQ8 Z;  1YJW Z;  3CC2 Z;  2QEX Z;  1QVG Z;  1KQS Y;  3CPW Y;  2QA4 Z;  1K9M 1;  1VQ6 Z;  1K8A 2;  3CPW Z;  2OTJ 1;  1YI2 Z;  1VQP 1;  3CMA 1;  3CME 1;  1YJW 1;  1VQK 1;  3CC7 Z;  2QEX 1;  3CCQ 1;  1VQO Z;  1M1K 1;  3CCL Z;  1YI2 1;  1KD1 1;  1JJ2 Y;  1N8R 2;  1Q82 1;  1Q81 1;  1W2B Y;  1JJ2 Z;  1M1K 2;  2OTJ Z;  1QVF Z;  1VQP Z;  3CMA Z;  1Q86 2;  1VQK Z;  1NJI 2;  3I56 1;  1Q82 2;  3CD6 1;  3CCQ Z;  3CCS 1;  3G6E Z;  3CCE 1;  3CCL 1;  1KQS Z;  3CCV Z;  1VQ4 Z;  1Q7Y 1;  1K9M 2;  3G6E 1;  3CC4 1;  1YIJ Z;  3CCJ 1;  3I56 Z;  1S72 1;  3CD6 Z;  3CCS Z;  3CCE Z;  3CCV 1;  3CCU 1;  1YHQ 1;  1VQ4 1;  3G71 1;  1VQ5 1;  1KD1 2;  1YIJ 1;  1W2B Z;  1K73 1;  1YJN 1;  3G4S Z;  1VQL 1;  1KC8 1;  1Q81 2;  1VQM 1;  3CC4 Z;  3CCJ Z;  1S72 Z;  1VQN Z;  1KC8 2;  3CCU Z;  1VQ7 Z;  1YHQ Z;  3CCM Z;  3G4S 1;  3OW2 Y;  3G71 Z;  1VQ5 Z;  1M90 1;  1YJ9 Z; 
#chains in the Genus database with same CATH topology
 2DE6 A;  1YJN Z;  1VQL Z;  1Q7Y 2;  1VQN 1;  2JIP A;  2JIR A;  4E30 A;  1NP6 A;  1YIT Z;  3CXC Y;  2RT9 A;  3CCM 1;  3Q87 A;  1TWC I;  3D6W A;  4A3B I;  3CXC Z;  4NBB A;  1YJ9 1;  2IV2 X;  1RQF A;  5C3E I;  3MZL B;  2E2H I;  2AYD A;  2WAQ A;  5C4J I;  1VLA A;  1Z03 A;  1N2F A;  4NBF A;  4XX2 A;  2GU2 A;  4MXU A;  3K7A I;  1SIW A;  2E2I I;  3MON A;  3RZD I;  1NJI 1;  2VPZ A;  2J6A A;  1QVG Y;  1QVG Z;  4NBG A;  1WII A;  2E2J I;  2OOY B;  1K9M 1;  3FQQ A;  3HOV I;  1RO0 A;  5A2Q f;  3GTO I;  3CMA 1;  3CME 1;  2AKL A;  1FDI A;  2E9H A;  3NFZ A;  3P5J B;  1Z01 A;  4A3L I;  1M1K 1;  2NVQ I;  4A3M I;  4EWC A;  2JA8 I;  1YI2 1;  3S14 I;  4NB8 A;  1KRL A;  1M1K 2;  1WCM I;  4RVD A;  4NOZ A;  3CMA Z;  1Q86 2;  2RPR A;  3MZK B;  3CCS 1;  2G2K A;  2Q51 A;  2QKD A;  3G6E Z;  3CCL 1;  1Y1V I;  4NH1 C;  4Y52 I;  2P3Y A;  1Y1W I;  3CCV Z;  3JAM f;  2R93 I;  5FLX b;  4A3F I;  3S17 I;  3CC4 1;  2OOX B;  1ZH1 A;  3CCS Z;  5LL6 f;  2F4O A;  2W03 A;  1YHQ 1;  3D9X A;  4MD9 A;  3S2D I;  4Y7N I;  1VQ5 1;  1ZB9 A;  4BBS I;  4NBH A;  5D1P A;  1YIJ 1;  1K73 1;  3G4S Z;  2R92 I;  3KIH A;  3CC4 Z;  3GTP I;  2IZ3 A;  4NBA A;  3S1Q I;  4MD8 A;  1YHQ Z;  3H3V J;  1VQ5 Z;  3IF8 A;  1Z02 A;  1Y8C A;  4E32 A;  4QTU A;  5D1O B;  2RBL A;  4RVH A;  1I6H I;  3VTN A;  3NH8 A;  3GTJ I;  4DK1 A;  2KPI A;  2OTL Z;  3CC2 1;  1YIT 1;  3M4O I;  1WJ2 A;  4MD7 A;  3S2H I;  5FLM I;  1QVF Y;  5C4X I;  3U50 C;  1X3W A;  1YJW Z;  3CC2 Z;  1KQS Y;  3J7A 4;  1TWF I;  4A3J I;  3CPW Y;  3CPW Z;  2OTJ 1;  2JIQ A;  4BBR I;  3I07 A;  3CCQ 1;  3J81 b;  1Q16 A;  1R9T I;  1KD1 1;  3GTM S;  2JR6 A;  2E7Z A;  2GTH A;  4NFR A;  2VUG A;  2VPW A;  4NBE A;  1Q81 1;  2OTJ Z;  1WZN A;  4A3C I;  3S16 I;  1NJI 2;  1USP B;  3CCQ Z;  1RO4 A;  1ML8 A;  5FLX f;  3FQM A;  2LIY A;  1AA6 A;  2QLV B;  1VQ4 Z;  1K9M 2;  4A93 I;  2NVY I;  3G6E 1;  4MRI A;  2DE7 A;  3H0G I;  2V3V A;  3CCV 1;  5IT9 b;  3CCU 1;  3GTG I;  4E31 A;  2JA5 I;  1TFI A;  2JUB A;  2PMZ A;  3I4N I;  2YU9 I;  4HGZ A;  5CM2 M;  2W04 A;  1KC8 1;  1VQM 1;  3TDH B;  2B63 I;  1ZB8 A;  2QR1 B;  1KC8 2;  2V45 A;  4A3E I;  4TNU A;  3CCU Z;  1VQ7 Z;  4X6A I;  3G4S 1;  3OW2 Y;  2JIM A;  3M3Y I;  3IFU A;  1M90 1;  3OW2 Z;  2LEX A;  1VQM Z;  5T6B A;  2OZK A;  1M90 2;  3CCR 1;  1QYP A;  1X3Z A;  1K8A 1;  2RHB A;  2H85 A;  3FKI I;  2JNY A;  4BXX I;  1RO2 A;  2NVT I;  3EER A;  4AYB A;  3J80 b;  3I55 1;  5AN9 F;  1VQ9 Z;  2JIO A;  1VQ8 1;  1K73 2;  2M48 A;  1I50 I;  1N8R 1;  2QA4 1;  3CCR Z;  3T4N B;  5IP7 I;  1USP A;  2OTL 1;  2V8K A;  3CC7 1;  1Y1V S;  3I55 Z;  4QTT A;  1VQO 1;  1VQ8 Z;  2QRE B;  3S1M I;  2F4M A;  2QEX Z;  1TWA I;  3PO3 I;  4E2X A;  2QA4 Z;  3J81 f;  2LFU A;  3GCF A;  1YJW 1;  1VQK 1;  3CC7 Z;  1VQO Z;  3HOY I;  3IR7 A;  3VMH A;  3NH5 A;  4E2Y A;  1W2B Y;  4A3D I;  1QVF Z;  1VQK Z;  2DE5 A;  3CD6 1;  2VF1 A;  2NVX I;  1KQS Z;  2ZAE B;  3F3F C;  3QWU A;  5IT9 f;  1Q7Y 1;  2PM9 A;  4HGY A;  1SFO I;  3CCJ 1;  2QRC B;  3S1N I;  1S72 1;  3CD6 Z;  1NUI A;  3HOW I;  2K5R A;  4A3K I;  2M6N A;  1DL6 A;  3HOZ I;  1VQ4 1;  3G71 1;  3VMG A;  2PK7 A;  1KD1 2;  2K3R A;  3GKQ A;  1YUA A;  3CQZ I;  3LUS A;  4DQY B;  1Q81 2;  3BG1 B;  3CCJ Z;  5T64 A;  1K83 I;  4A3G I;  1P9N A;  1S72 Z;  2Y0S A;  1VQN Z;  1X0T A;  1TWH I;  3EED A;  4CL1 A;  1QXF A;  3CCM Z;  5D1O A;  3G71 Z;  2O4H A;  1YJ9 Z;  3KIF A;  3IX0 A;  2JA6 I;  3J80 f;  1VQ7 1;  1YUK A;  5T67 A;  4E2Z A;  1FDO A;  3NH4 A;  3ESW A;  3TE5 B;  3BG0 B;  1JWH C;  3VB9 A;  4MON A;  4NB9 A;  2JS4 A;  2BJO A;  2R7Z I;  1VQ6 1;  5C44 I;  4DGL A;  1VQ9 1;  1Q86 1;  2IZ4 A;  4BY1 I;  2V8I A;  4RVF A;  3CME Z;  4E2W A;  4RS4 A;  4A3I I;  1I3Q I;  1QF8 A;  3VMI A;  2EGT A;  1VQ6 Z;  1K8A 2;  3NDI A;  1YI2 Z;  1WW9 A;  1VQP 1;  1TWG I;  4HH4 A;  2RIQ A;  2QEX 1;  2YAD A;  2KI7 B;  3S15 I;  4RVG A;  5A2Q b;  1L1O C;  3F3P C;  3CCL Z;  1JJ2 Y;  1N8R 2;  1Q82 1;  1JJ2 Z;  4E33 A;  2R6M A;  3GTK I;  1VQP Z;  3GTQ I;  3I56 1;  4BY7 I;  1Q82 2;  3S1R I;  2VPX A;  4S1T A;  3D2L A;  5IP9 I;  3CCE 1;  3I4M I;  2I3C A;  2JMO A;  2VPY A;  1PFT A;  1YIJ Z;  1RNI A;  1RLY A;  3I56 Z;  3CCE Z;  1LQL A;  3JAM b;  2O53 A;  3HOU I;  2NAP A;  1S7M A;  3PO2 I;  4NBC A;  2GTI A;  1W2B Z;  1YJN 1;  3RZO I;  1VQL 1;  3GTM I;  3HOX I;  2WB1 A;  2Q4Z A;  4MH4 A;  2QRD B;  2VUM I;  4NBD A;  3GTL I;  2HF1 A;  4RV9 A;  2JA7 I;  2HU9 A;  3NDJ A;  2V8J A;  2P28 A;  3PO3 S;  3HKZ A; 
#chains in the Genus database with same CATH homology
 2DE6 A;  1YJN Z;  1VQL Z;  1Q7Y 2;  1VQN 1;  4E30 A;  1NP6 A;  1YIT Z;  3CXC Y;  2RT9 A;  3CCM 1;  3Q87 A;  1TWC I;  3D6W A;  4A3B I;  3CXC Z;  4NBB A;  1YJ9 1;  1RQF A;  5C3E I;  3MZL B;  2E2H I;  2WAQ A;  5C4J I;  1VLA A;  1Z03 A;  1N2F A;  4NBF A;  4XX2 A;  2GU2 A;  4MXU A;  3K7A I;  2E2I I;  3MON A;  3RZD I;  1NJI 1;  2J6A A;  1QVG Y;  1QVG Z;  4NBG A;  1WII A;  2E2J I;  2OOY B;  1K9M 1;  3FQQ A;  3HOV I;  1RO0 A;  5A2Q f;  3GTO I;  3CMA 1;  3CME 1;  2AKL A;  2E9H A;  3NFZ A;  3P5J B;  1Z01 A;  4A3L I;  1M1K 1;  2NVQ I;  4A3M I;  4EWC A;  2JA8 I;  1YI2 1;  3S14 I;  4NB8 A;  1KRL A;  1M1K 2;  1WCM I;  4RVD A;  4NOZ A;  3CMA Z;  1Q86 2;  2RPR A;  3MZK B;  3CCS 1;  2G2K A;  2Q51 A;  2QKD A;  3G6E Z;  3CCL 1;  1Y1V I;  4NH1 C;  4Y52 I;  2P3Y A;  1Y1W I;  3CCV Z;  3JAM f;  2R93 I;  5FLX b;  4A3F I;  3S17 I;  3CC4 1;  2OOX B;  1ZH1 A;  3CCS Z;  5LL6 f;  2F4O A;  2W03 A;  1YHQ 1;  3D9X A;  4MD9 A;  3S2D I;  4Y7N I;  1VQ5 1;  1ZB9 A;  4BBS I;  4NBH A;  5D1P A;  1YIJ 1;  1K73 1;  3G4S Z;  2R92 I;  3KIH A;  3CC4 Z;  3GTP I;  2IZ3 A;  4NBA A;  3S1Q I;  4MD8 A;  1YHQ Z;  3H3V J;  1VQ5 Z;  3IF8 A;  1Z02 A;  4E32 A;  4QTU A;  5D1O B;  2RBL A;  4RVH A;  1I6H I;  3VTN A;  3NH8 A;  3GTJ I;  4DK1 A;  2KPI A;  2OTL Z;  3CC2 1;  1YIT 1;  3M4O I;  4MD7 A;  3S2H I;  5FLM I;  1QVF Y;  5C4X I;  3U50 C;  1X3W A;  1YJW Z;  3CC2 Z;  1KQS Y;  3J7A 4;  1TWF I;  4A3J I;  3CPW Y;  3CPW Z;  2OTJ 1;  4BBR I;  3I07 A;  3CCQ 1;  3J81 b;  1R9T I;  1KD1 1;  3GTM S;  2JR6 A;  2GTH A;  4NFR A;  2VUG A;  4NBE A;  1Q81 1;  2OTJ Z;  4A3C I;  3S16 I;  1NJI 2;  1USP B;  3CCQ Z;  1RO4 A;  1ML8 A;  5FLX f;  3FQM A;  2LIY A;  2QLV B;  1VQ4 Z;  1K9M 2;  4A93 I;  2NVY I;  3G6E 1;  4MRI A;  2DE7 A;  3H0G I;  3CCV 1;  5IT9 b;  3CCU 1;  3GTG I;  4E31 A;  2JA5 I;  1TFI A;  2JUB A;  2PMZ A;  3I4N I;  2YU9 I;  4HGZ A;  5CM2 M;  2W04 A;  1KC8 1;  1VQM 1;  3TDH B;  2B63 I;  1ZB8 A;  2QR1 B;  1KC8 2;  4A3E I;  4TNU A;  3CCU Z;  1VQ7 Z;  4X6A I;  3G4S 1;  3OW2 Y;  3M3Y I;  3IFU A;  1M90 1;  3OW2 Z;  1VQM Z;  5T6B A;  2OZK A;  1M90 2;  3CCR 1;  1QYP A;  1X3Z A;  1K8A 1;  2RHB A;  2H85 A;  3FKI I;  2JNY A;  4BXX I;  1RO2 A;  2NVT I;  3EER A;  4AYB A;  3J80 b;  3I55 1;  5AN9 F;  1VQ9 Z;  1VQ8 1;  1K73 2;  2M48 A;  1I50 I;  1N8R 1;  2QA4 1;  3CCR Z;  3T4N B;  5IP7 I;  1USP A;  2OTL 1;  2V8K A;  3CC7 1;  1Y1V S;  3I55 Z;  4QTT A;  1VQO 1;  1VQ8 Z;  2QRE B;  3S1M I;  2F4M A;  2QEX Z;  1TWA I;  3PO3 I;  4E2X A;  2QA4 Z;  3J81 f;  2LFU A;  3GCF A;  1YJW 1;  1VQK 1;  3CC7 Z;  1VQO Z;  3HOY I;  3VMH A;  3NH5 A;  4E2Y A;  1W2B Y;  4A3D I;  1QVF Z;  1VQK Z;  2DE5 A;  3CD6 1;  2VF1 A;  2NVX I;  1KQS Z;  2ZAE B;  3F3F C;  3QWU A;  5IT9 f;  1Q7Y 1;  2PM9 A;  4HGY A;  1SFO I;  3CCJ 1;  2QRC B;  3S1N I;  1S72 1;  3CD6 Z;  1NUI A;  3HOW I;  2K5R A;  4A3K I;  2M6N A;  1DL6 A;  3HOZ I;  1VQ4 1;  3G71 1;  3VMG A;  2PK7 A;  1KD1 2;  2K3R A;  3GKQ A;  1YUA A;  3CQZ I;  3LUS A;  4DQY B;  1Q81 2;  3BG1 B;  3CCJ Z;  5T64 A;  1K83 I;  4A3G I;  1P9N A;  1S72 Z;  2Y0S A;  1VQN Z;  1X0T A;  1TWH I;  3EED A;  4CL1 A;  3CCM Z;  5D1O A;  3G71 Z;  2O4H A;  1YJ9 Z;  3KIF A;  3IX0 A;  2JA6 I;  3J80 f;  1VQ7 1;  1YUK A;  5T67 A;  4E2Z A;  3NH4 A;  3ESW A;  3TE5 B;  3BG0 B;  1JWH C;  3VB9 A;  4MON A;  4NB9 A;  2JS4 A;  2BJO A;  2R7Z I;  1VQ6 1;  5C44 I;  4DGL A;  1VQ9 1;  1Q86 1;  2IZ4 A;  4BY1 I;  2V8I A;  4RVF A;  3CME Z;  4E2W A;  4RS4 A;  4A3I I;  1I3Q I;  1QF8 A;  3VMI A;  2EGT A;  1VQ6 Z;  1K8A 2;  3NDI A;  1YI2 Z;  1WW9 A;  1VQP 1;  1TWG I;  4HH4 A;  2RIQ A;  2QEX 1;  2YAD A;  2KI7 B;  3S15 I;  4RVG A;  5A2Q b;  1L1O C;  3F3P C;  3CCL Z;  1JJ2 Y;  1N8R 2;  1Q82 1;  1JJ2 Z;  4E33 A;  2R6M A;  3GTK I;  1VQP Z;  3GTQ I;  3I56 1;  4BY7 I;  1Q82 2;  3S1R I;  5IP9 I;  4S1T A;  3CCE 1;  3I4M I;  2I3C A;  2JMO A;  1PFT A;  1YIJ Z;  1RNI A;  1RLY A;  3I56 Z;  3CCE Z;  1LQL A;  3JAM b;  2O53 A;  3HOU I;  1S7M A;  3PO2 I;  4NBC A;  2GTI A;  1W2B Z;  1YJN 1;  3RZO I;  1VQL 1;  3GTM I;  3HOX I;  2WB1 A;  2Q4Z A;  4MH4 A;  2QRD B;  2VUM I;  4NBD A;  3GTL I;  2HF1 A;  4RV9 A;  2JA7 I;  2HU9 A;  3NDJ A;  2V8J A;  2P28 A;  3PO3 S;  3HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...