1VQ8Z

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq8Z00
1Q822 1YJ91 3CCQ1 1QVGZ 1YI21 3I56Z 2QA4Z 1K8A1 1N8R1 3CCL1 3CC2Z 1VQPZ 1VQ41 3CMA1 1M1K1 3CCRZ 1Q861 1JJ2Y 3CPWY 3G4SZ 1VQN1 1VQ6Z 1YIT1 1VQMZ 3CC21 1KC81 1YJN1 3CCVZ 1W2BY 1VQO1 1VQK1 1S72Z 3CCU1 3CCE1 3CCMZ 1KD11 1Q812 1QVGY 1K9M1 1YHQZ 1VQ5Z 1K732 1Q7Y2 3CD61 3CXCZ 3OW2Z 3CC71 1VQ7Z 3CME1 3I55Z 3G71Z 1NJI1 1K8A2 3I561 2QA41 1M1K2 1KQSZ 3CCSZ 1VQP1 2OTLZ 1Q862 1KC82 3CCR1 1VQ61 2QEXZ 3G4S1 1YIJZ 3CCS1 1VQM1 1VQ9Z 3G6EZ 3CXCY 3CCV1 3OW2Y 1KD12 1VQ8Z 1YJWZ 1M901 1K9M2 1S721 3CCM1 2OTJZ 1YHQ1 1VQ51 1N8R2 1YJ9Z 3CCQZ 3CPWZ 1VQ81 1KQSY 1NJI2 1QVFZ 1Q811 1YI2Z 1Q821 1VQ71 3CCLZ 3I551 3G711 1VQ4Z 3CMAZ 3CC4Z 1VQNZ 1YITZ 2OTL1 1YJNZ 1VQOZ 1VQKZ 3CC41 3CCJZ 3CCUZ 1VQLZ 3CCEZ 1M902 2QEX1 1YIJ1 1VQ91 3G6E1 1QVFY 1JJ2Z 3CD6Z 1YJW1 1W2BZ 3CCJ1 2OTJ1 3CC7Z 1VQL1 1K731 1Q7Y1 3CMEZ
chains in the Genus database with same CATH superfamily
4AYBA 4XX2A 2J6AA 2P3YA 2VF1A 1QVGZ 4NH1C 1I50I 2K3RA 2W03A 2E2HI 2KPIA 1YUAA 1FDOA 5A2Qb 3CMA1 4E33A 2HU9A 4RV9A 1X3ZA 3S2DI 3HOWI 4NBFA 4A3MI 3RZDI 3G4SZ 1YIT1 1VLAA 1USPB 3EERA 3CC21 1L1OC 1YJN1 1W2BY 4E2YA 1VQO1 1VQK1 1Z03A 3MONA 1KD11 4HGZA 1QVGY 2VUMI 1YHQZ 3HOUI 2Q4ZA 1Q7Y2 3NFZA 3VTNA 1YUKA 4HH4A 2JNYA 2PM9A 3CME1 1VQ7Z 1NJI1 2JA5I 3D6WA 3GTMI 5T6BA 2M6NA 2JA6I 1KQSZ 3Q87A 2QRCB 4NBDA 1ZB9A 4A3KI 3S1RI 3HOZI 4RVGA 1WJ2A 4NB8A 2NAPA 3IR7A 3J81b 3G4S1 2QEXZ 1YIJZ 5LL6f 4NBEA 3GTLI 3S17I 3G6EZ 3GTQI 3HOVI 1YHQ1 1TWHI 3KIFA 1TWCI 1KQSY 1TWFI 3BG0B 3I4MI 1ML8A 1NUIA 4MD9A 1Y1VS 4Y52I 1VQ71 5FLXb 3PO3I 4E2XA 4DGLA 5D1OA 1Y1WI 4RVDA 2I3CA 1WCMI 3I07A 2JIRA 3CC41 4BBRI 3CCEZ 2QEX1 1YIJ1 1DL6A 1K83I 3G6E1 4NB9A 1SFOI 4HGYA 2Y0SA 3CCJ1 3CC7Z 4A93I 2E7ZA 2V45A 1RO2A 3S16I 2QA4Z 1K8A1 3CC2Z 4DQYB 2R6MA 2YADA 1RNIA 1M1K1 4EWCA 3CCRZ 1R9TI 2QKDA 1Q861 3P5JB 5C3EI 2HF1A 3H0GI 2M48A 5IP7I 3CCE1 3CCMZ 2JR6A 2W04A 1I6HI 1K9M1 1P9NA 4E2WA 1K732 2V3VA 2RHBA 5CM2M 3CC71 1ZH1A 3I55Z 2EGTA 3H3VJ 1WW9A 3G71Z 2V8KA 4MXUA 2GU2A 2QA41 2DE5A 2B63I 4BBSI 3S1QI 4NFRA 3T4NB 4CL1A 3HOYI 1KC82 3CCR1 2OOYB 2V8IA 1X0TA 4S1TA 2OZKA 3CCS1 1YJWZ 2DE6A 2VPXA 3CCM1 2O4HA 5T64A 3HOXI 3J80b 2IZ3A 3CPWZ 1N2FA 1USPA 1QVFZ 1YI2Z 1KRLA 5T67A 4MH4A 3I551 4E2ZA 2PK7A 3ESWA 3G711 3CC4Z 3VMIA 3GCFA 2G2KA 4MD8A 1VQNZ 2Q51A 2NVQI 3VMHA 3J7A4 3GTKI 3RZOI 4E31A 3HKZA 2JUBA 3CCJZ 1TWAI 1M902 4MRIA 4BY1I 3GTJI 1QVFY 1QYPA 1JJ2Z 1YJW1 3M4OI 3J80f 2JIQA 3GTPI 1VQL1 4A3II 2RBLA 1TWGI 1Q7Y1 3S1NI 2VPZA 1Q822 2VPYA 4NOZA 1S7MA 2F4OA 2JA7I 1YI21 3S14I 3EEDA 3F3PC 2RIQA 1VQPZ 2AYDA 1X3WA 1JJ2Y 3KIHA 2WB1A 1VQN1 1VQ6Z 3NH4A 4A3DI 2WAQA 4A3LI 2ZAEB 1SIWA 2OOXB 1S72Z 1RO0A 2QLVB 2RT9A 4RS4A 2JIOA 1Q812 4NBHA 5IT9b 3GTMS 3F3FC 3NDJA 1TFIA 2BJOA 4A3CI 1Y8CA 4BXXI 3CCSZ 5C44I 3S1MI 1VQP1 2JIPA 4X6AI 3TE5B 4Y7NI 3VMGA 1VQ61 1VQ9Z 2QRDB 3MZLB 2AKLA 1KD12 3BG1B 1S721 2IV2X 3JAMb 5IT9f 3PO3S 4QTTA 3IX0A 4A3BI 2LEXA 2H85A 4E30A 3M3YI 1N8R2 1YJ9Z 3CCQZ 1VQ81 4A3JI 2V8JA 1ZB8A 1NJI2 1Q811 2P28A 3CCLZ 1Q16A 2LIYA 1VQ4Z 3LUSA 3D2LA 1Z01A 4MD7A 3S15I 4MONA 3D9XA 1Y1VI 3NDIA 1I3QI 2VPWA 3MZKB 1RO4A 3CCUZ 1VQLZ 3JAMf 1VQ91 2GTIA 2E2II 1AA6A 4E32A 3CD6Z 3GTGI 4DK1A 4NBGA 1QXFA 1LQLA 1K731 4RVHA 2QR1B 4BY7I 1YJ91 3CCQ1 3NH8A 2NVXI 2JS4A 3GKQA 3I56Z 1N8R1 3CCL1 1NP6A 1VQ41 2VUGA 4NBCA 2K5RA 3FQMA 2DE7A 3IF8A 5A2Qf 4A3EI 3CPWY 1Z02A 2NVTI 1VQMZ 1KC81 3CCVZ 3QWUA 2E2JI 3FQQA 3CCU1 3GTOI 1VQ5Z 1WZNA 1RLYA 3CD61 2F4MA 5D1OB 5D1PA 3U50C 2GTHA 3CXCZ 3K7AI 3OW2Z 3S2HI 1RQFA 5C4JI 4NBAA 1K8A2 4TNUA 3I561 1M1K2 5FLMI 2OTLZ 1Q862 2KI7B 1VQM1 3CXCY 3CCV1 3OW2Y 2R7ZI 3J81f 1VQ8Z 2IZ4A 1M901 1K9M2 2QREB 2OTJZ 1JWHC 1FDIA 3I4NI 4QTUA 2O53A 1QF8A 4NBBA 1VQ51 3CQZI 4RVFA 2RPRA 5AN9F 2JA8I 1Q821 4A3FI 3VB9A 3IFUA 5FLXf 3CMAZ 2R93I 2PMZA 4A3GI 3TDHB 1PFTA 5IP9I 1YITZ 2OTL1 1YJNZ 2E9HA 1VQOZ 1VQKZ 1WIIA 2LFUA 3PO2I 5C4XI 3FKII 2R92I 2JMOA 2JIMA 3NH5A 2NVYI 1W2BZ 2OTJ1 2YU9I 3CMEZ
chains in the Genus database with same CATH topology
4AYBA 4XX2A 2J6AA 2P3YA 2VF1A 1QVGZ 4NH1C 1I50I 2K3RA 2W03A 2E2HI 2KPIA 1YUAA 5A2Qb 3CMA1 4E33A 2HU9A 4RV9A 1X3ZA 3S2DI 3HOWI 4NBFA 4A3MI 3RZDI 3G4SZ 1YIT1 1VLAA 1USPB 3EERA 3CC21 1L1OC 1YJN1 1W2BY 4E2YA 1VQO1 1VQK1 1Z03A 3MONA 1KD11 4HGZA 1QVGY 2VUMI 1YHQZ 3HOUI 2Q4ZA 1Q7Y2 3NFZA 3VTNA 1YUKA 4HH4A 2JNYA 2PM9A 3CME1 1VQ7Z 1NJI1 2JA5I 3D6WA 3GTMI 5T6BA 2M6NA 2JA6I 1KQSZ 3Q87A 2QRCB 4NBDA 1ZB9A 4A3KI 3S1RI 3HOZI 4RVGA 4NB8A 3J81b 2QEXZ 3G4S1 1YIJZ 5LL6f 4NBEA 3GTLI 3S17I 3G6EZ 3GTQI 3HOVI 1YHQ1 1TWHI 3KIFA 1TWCI 1KQSY 1TWFI 3BG0B 3I4MI 1ML8A 1NUIA 4MD9A 1Y1VS 4Y52I 1VQ71 5FLXb 3PO3I 4E2XA 4DGLA 5D1OA 1Y1WI 4RVDA 2I3CA 1WCMI 3I07A 3CC41 4BBRI 3CCEZ 2QEX1 1YIJ1 1DL6A 1K83I 3G6E1 4NB9A 1SFOI 4HGYA 2Y0SA 3CCJ1 3CC7Z 4A93I 1RO2A 3S16I 2QA4Z 1K8A1 3CC2Z 4DQYB 2R6MA 2YADA 1RNIA 1M1K1 4EWCA 3CCRZ 1R9TI 2QKDA 1Q861 3P5JB 5C3EI 2HF1A 3H0GI 2M48A 5IP7I 3CCE1 3CCMZ 2JR6A 2W04A 1I6HI 1K9M1 1P9NA 4E2WA 1K732 2RHBA 5CM2M 3CC71 1ZH1A 3I55Z 2EGTA 3H3VJ 1WW9A 3G71Z 2V8KA 4MXUA 2GU2A 2QA41 2DE5A 2B63I 4BBSI 3S1QI 4NFRA 3T4NB 4CL1A 3HOYI 1KC82 3CCR1 2OOYB 2V8IA 1X0TA 4S1TA 2OZKA 3CCS1 1YJWZ 2DE6A 3CCM1 2O4HA 5T64A 3HOXI 3J80b 2IZ3A 3CPWZ 1N2FA 1USPA 1QVFZ 1YI2Z 1KRLA 5T67A 4MH4A 3I551 4E2ZA 2PK7A 3ESWA 3G711 3CC4Z 3VMIA 3GCFA 2G2KA 4MD8A 1VQNZ 2Q51A 2NVQI 3VMHA 3J7A4 3GTKI 3RZOI 3HKZA 2JUBA 4E31A 3CCJZ 1TWAI 1M902 4MRIA 4BY1I 3GTJI 1QVFY 1QYPA 1JJ2Z 1YJW1 3M4OI 3J80f 3GTPI 1VQL1 4A3II 2RBLA 1TWGI 1Q7Y1 3S1NI 1Q822 4NOZA 1S7MA 2F4OA 2JA7I 1YI21 3S14I 3EEDA 3F3PC 2RIQA 1VQPZ 1X3WA 1JJ2Y 3KIHA 2WB1A 1VQN1 1VQ6Z 3NH4A 4A3DI 2WAQA 4A3LI 2ZAEB 2OOXB 1S72Z 1RO0A 2QLVB 2RT9A 4RS4A 1Q812 4NBHA 5IT9b 3GTMS 3F3FC 3NDJA 1TFIA 2BJOA 4A3CI 4BXXI 3CCSZ 5C44I 3S1MI 1VQP1 4X6AI 3TE5B 4Y7NI 3VMGA 1VQ61 1VQ9Z 2QRDB 3MZLB 2AKLA 1KD12 3BG1B 1S721 3JAMb 5IT9f 3PO3S 4QTTA 3IX0A 4A3BI 3M3YI 2H85A 4E30A 1N8R2 1YJ9Z 3CCQZ 1VQ81 4A3JI 2V8JA 1ZB8A 1NJI2 1Q811 2P28A 3CCLZ 2LIYA 1VQ4Z 3LUSA 1Z01A 4MD7A 3S15I 4MONA 3D9XA 1Y1VI 3NDIA 1I3QI 3MZKB 1RO4A 3CCUZ 1VQLZ 3JAMf 1VQ91 2GTIA 2E2II 4E32A 3CD6Z 3GTGI 4DK1A 4NBGA 1LQLA 1K731 4RVHA 2QR1B 4BY7I 1YJ91 3CCQ1 3NH8A 2NVXI 2JS4A 3GKQA 3I56Z 1N8R1 3CCL1 1NP6A 1VQ41 2VUGA 4NBCA 2K5RA 3FQMA 2DE7A 3IF8A 5A2Qf 4A3EI 3CPWY 1Z02A 2NVTI 1VQMZ 1KC81 3CCVZ 3QWUA 2E2JI 3FQQA 3CCU1 3GTOI 1VQ5Z 1RLYA 3CD61 2F4MA 5D1OB 5D1PA 3U50C 2GTHA 3CXCZ 3K7AI 3OW2Z 3S2HI 1RQFA 5C4JI 4NBAA 1K8A2 4TNUA 3I561 1M1K2 5FLMI 2OTLZ 1Q862 2KI7B 1VQM1 3CXCY 3CCV1 3OW2Y 2R7ZI 3J81f 1VQ8Z 2IZ4A 1M901 1K9M2 2QREB 2OTJZ 1JWHC 3I4NI 4QTUA 2O53A 1QF8A 4NBBA 1VQ51 3CQZI 4RVFA 2RPRA 5AN9F 2JA8I 1Q821 4A3FI 3VB9A 3IFUA 5FLXf 3CMAZ 2R93I 2PMZA 4A3GI 3TDHB 1PFTA 5IP9I 1YITZ 2OTL1 1YJNZ 2E9HA 1VQOZ 1VQKZ 1WIIA 2LFUA 3PO2I 5C4XI 3FKII 2R92I 2JMOA 3NH5A 2NVYI 1W2BZ 2OTJ1 2YU9I 3CMEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 2;  1YJ9 1;  3CCQ 1;  1QVG Z;  1YI2 1;  3I56 Z;  2QA4 Z;  1K8A 1;  1N8R 1;  3CCL 1;  3CC2 Z;  1VQP Z;  1VQ4 1;  3CMA 1;  1M1K 1;  3CCR Z;  1Q86 1;  1JJ2 Y;  3CPW Y;  3G4S Z;  1VQN 1;  1VQ6 Z;  1YIT 1;  1VQM Z;  3CC2 1;  1KC8 1;  1YJN 1;  3CCV Z;  1W2B Y;  1VQO 1;  1VQK 1;  1S72 Z;  3CCU 1;  3CCE 1;  3CCM Z;  1KD1 1;  1Q81 2;  1QVG Y;  1K9M 1;  1YHQ Z;  1VQ5 Z;  1K73 2;  1Q7Y 2;  3CD6 1;  3CXC Z;  3OW2 Z;  3CC7 1;  1VQ7 Z;  3CME 1;  3I55 Z;  3G71 Z;  1NJI 1;  1K8A 2;  3I56 1;  2QA4 1;  1M1K 2;  1KQS Z;  3CCS Z;  1VQP 1;  2OTL Z;  1Q86 2;  1KC8 2;  3CCR 1;  1VQ6 1;  2QEX Z;  3G4S 1;  1YIJ Z;  3CCS 1;  1VQM 1;  1VQ9 Z;  3G6E Z;  3CXC Y;  3CCV 1;  3OW2 Y;  1KD1 2;  1VQ8 Z;  1YJW Z;  1M90 1;  1K9M 2;  1S72 1;  3CCM 1;  2OTJ Z;  1YHQ 1;  1VQ5 1;  1N8R 2;  1YJ9 Z;  3CCQ Z;  3CPW Z;  1VQ8 1;  1KQS Y;  1NJI 2;  1QVF Z;  1Q81 1;  1YI2 Z;  1Q82 1;  1VQ7 1;  3CCL Z;  3I55 1;  3G71 1;  1VQ4 Z;  3CMA Z;  3CC4 Z;  1VQN Z;  1YIT Z;  2OTL 1;  1YJN Z;  1VQO Z;  1VQK Z;  3CC4 1;  3CCJ Z;  3CCU Z;  1VQL Z;  3CCE Z;  1M90 2;  2QEX 1;  1YIJ 1;  1VQ9 1;  3G6E 1;  1QVF Y;  1JJ2 Z;  3CD6 Z;  1YJW 1;  1W2B Z;  3CCJ 1;  2OTJ 1;  3CC7 Z;  1VQL 1;  1K73 1;  1Q7Y 1;  3CME Z; 
#chains in the Genus database with same CATH topology
 4AYB A;  4XX2 A;  2J6A A;  2P3Y A;  2VF1 A;  1QVG Z;  4NH1 C;  1I50 I;  2K3R A;  2W03 A;  2E2H I;  2KPI A;  1YUA A;  1FDO A;  5A2Q b;  3CMA 1;  4E33 A;  2HU9 A;  4RV9 A;  1X3Z A;  3S2D I;  3HOW I;  4NBF A;  4A3M I;  3RZD I;  3G4S Z;  1YIT 1;  1VLA A;  1USP B;  3EER A;  3CC2 1;  1L1O C;  1YJN 1;  1W2B Y;  4E2Y A;  1VQO 1;  1VQK 1;  1Z03 A;  3MON A;  1KD1 1;  4HGZ A;  1QVG Y;  2VUM I;  1YHQ Z;  3HOU I;  2Q4Z A;  1Q7Y 2;  3NFZ A;  3VTN A;  1YUK A;  4HH4 A;  2JNY A;  2PM9 A;  3CME 1;  1VQ7 Z;  1NJI 1;  2JA5 I;  3D6W A;  3GTM I;  5T6B A;  2M6N A;  2JA6 I;  1KQS Z;  3Q87 A;  2QRC B;  4NBD A;  1ZB9 A;  4A3K I;  3S1R I;  3HOZ I;  4RVG A;  1WJ2 A;  4NB8 A;  2NAP A;  3IR7 A;  3J81 b;  3G4S 1;  2QEX Z;  1YIJ Z;  5LL6 f;  4NBE A;  3GTL I;  3S17 I;  3G6E Z;  3GTQ I;  3HOV I;  1YHQ 1;  1TWH I;  3KIF A;  1TWC I;  1KQS Y;  1TWF I;  3BG0 B;  3I4M I;  1ML8 A;  1NUI A;  4MD9 A;  1Y1V S;  4Y52 I;  1VQ7 1;  5FLX b;  3PO3 I;  4E2X A;  4DGL A;  5D1O A;  1Y1W I;  4RVD A;  2I3C A;  1WCM I;  3I07 A;  2JIR A;  3CC4 1;  4BBR I;  3CCE Z;  2QEX 1;  1YIJ 1;  1DL6 A;  1K83 I;  3G6E 1;  4NB9 A;  1SFO I;  4HGY A;  2Y0S A;  3CCJ 1;  3CC7 Z;  4A93 I;  2E7Z A;  2V45 A;  1RO2 A;  3S16 I;  2QA4 Z;  1K8A 1;  3CC2 Z;  4DQY B;  2R6M A;  2YAD A;  1RNI A;  1M1K 1;  4EWC A;  3CCR Z;  1R9T I;  2QKD A;  1Q86 1;  3P5J B;  5C3E I;  2HF1 A;  3H0G I;  2M48 A;  5IP7 I;  3CCE 1;  3CCM Z;  2JR6 A;  2W04 A;  1I6H I;  1K9M 1;  1P9N A;  4E2W A;  1K73 2;  2V3V A;  2RHB A;  5CM2 M;  3CC7 1;  1ZH1 A;  3I55 Z;  2EGT A;  3H3V J;  1WW9 A;  3G71 Z;  2V8K A;  4MXU A;  2GU2 A;  2QA4 1;  2DE5 A;  2B63 I;  4BBS I;  3S1Q I;  4NFR A;  3T4N B;  4CL1 A;  3HOY I;  1KC8 2;  3CCR 1;  2OOY B;  2V8I A;  1X0T A;  4S1T A;  2OZK A;  3CCS 1;  1YJW Z;  2DE6 A;  2VPX A;  3CCM 1;  2O4H A;  5T64 A;  3HOX I;  3J80 b;  2IZ3 A;  3CPW Z;  1N2F A;  1USP A;  1QVF Z;  1YI2 Z;  1KRL A;  5T67 A;  4MH4 A;  3I55 1;  4E2Z A;  2PK7 A;  3ESW A;  3G71 1;  3CC4 Z;  3VMI A;  3GCF A;  2G2K A;  4MD8 A;  1VQN Z;  2Q51 A;  2NVQ I;  3VMH A;  3J7A 4;  3GTK I;  3RZO I;  4E31 A;  3HKZ A;  2JUB A;  3CCJ Z;  1TWA I;  1M90 2;  4MRI A;  4BY1 I;  3GTJ I;  1QVF Y;  1QYP A;  1JJ2 Z;  1YJW 1;  3M4O I;  3J80 f;  2JIQ A;  3GTP I;  1VQL 1;  4A3I I;  2RBL A;  1TWG I;  1Q7Y 1;  3S1N I;  2VPZ A;  1Q82 2;  2VPY A;  4NOZ A;  1S7M A;  2F4O A;  2JA7 I;  1YI2 1;  3S14 I;  3EED A;  3F3P C;  2RIQ A;  1VQP Z;  2AYD A;  1X3W A;  1JJ2 Y;  3KIH A;  2WB1 A;  1VQN 1;  1VQ6 Z;  3NH4 A;  4A3D I;  2WAQ A;  4A3L I;  2ZAE B;  1SIW A;  2OOX B;  1S72 Z;  1RO0 A;  2QLV B;  2RT9 A;  4RS4 A;  2JIO A;  1Q81 2;  4NBH A;  5IT9 b;  3GTM S;  3F3F C;  3NDJ A;  1TFI A;  2BJO A;  4A3C I;  1Y8C A;  4BXX I;  3CCS Z;  5C44 I;  3S1M I;  1VQP 1;  2JIP A;  4X6A I;  3TE5 B;  4Y7N I;  3VMG A;  1VQ6 1;  1VQ9 Z;  2QRD B;  3MZL B;  2AKL A;  1KD1 2;  3BG1 B;  1S72 1;  2IV2 X;  3JAM b;  5IT9 f;  3PO3 S;  4QTT A;  3IX0 A;  4A3B I;  2LEX A;  2H85 A;  4E30 A;  3M3Y I;  1N8R 2;  1YJ9 Z;  3CCQ Z;  1VQ8 1;  4A3J I;  2V8J A;  1ZB8 A;  1NJI 2;  1Q81 1;  2P28 A;  3CCL Z;  1Q16 A;  2LIY A;  1VQ4 Z;  3LUS A;  3D2L A;  1Z01 A;  4MD7 A;  3S15 I;  4MON A;  3D9X A;  1Y1V I;  3NDI A;  1I3Q I;  2VPW A;  3MZK B;  1RO4 A;  3CCU Z;  1VQL Z;  3JAM f;  1VQ9 1;  2GTI A;  2E2I I;  1AA6 A;  4E32 A;  3CD6 Z;  3GTG I;  4DK1 A;  4NBG A;  1QXF A;  1LQL A;  1K73 1;  4RVH A;  2QR1 B;  4BY7 I;  1YJ9 1;  3CCQ 1;  3NH8 A;  2NVX I;  2JS4 A;  3GKQ A;  3I56 Z;  1N8R 1;  3CCL 1;  1NP6 A;  1VQ4 1;  2VUG A;  4NBC A;  2K5R A;  3FQM A;  2DE7 A;  3IF8 A;  5A2Q f;  4A3E I;  3CPW Y;  1Z02 A;  2NVT I;  1VQM Z;  1KC8 1;  3CCV Z;  3QWU A;  2E2J I;  3FQQ A;  3CCU 1;  3GTO I;  1VQ5 Z;  1WZN A;  1RLY A;  3CD6 1;  2F4M A;  5D1O B;  5D1P A;  3U50 C;  2GTH A;  3CXC Z;  3K7A I;  3OW2 Z;  3S2H I;  1RQF A;  5C4J I;  4NBA A;  1K8A 2;  4TNU A;  3I56 1;  1M1K 2;  5FLM I;  2OTL Z;  1Q86 2;  2KI7 B;  1VQM 1;  3CXC Y;  3CCV 1;  3OW2 Y;  2R7Z I;  3J81 f;  1VQ8 Z;  2IZ4 A;  1M90 1;  1K9M 2;  2QRE B;  2OTJ Z;  1JWH C;  1FDI A;  3I4N I;  4QTU A;  2O53 A;  1QF8 A;  4NBB A;  1VQ5 1;  3CQZ I;  4RVF A;  2RPR A;  5AN9 F;  2JA8 I;  1Q82 1;  4A3F I;  3VB9 A;  3IFU A;  5FLX f;  3CMA Z;  2R93 I;  2PMZ A;  4A3G I;  3TDH B;  1PFT A;  5IP9 I;  1YIT Z;  2OTL 1;  1YJN Z;  2E9H A;  1VQO Z;  1VQK Z;  1WII A;  2LFU A;  3PO2 I;  5C4X I;  3FKI I;  2R92 I;  2JMO A;  2JIM A;  3NH5 A;  2NVY I;  1W2B Z;  2OTJ 1;  2YU9 I;  3CME Z; 
#chains in the Genus database with same CATH homology
 4AYB A;  4XX2 A;  2J6A A;  2P3Y A;  2VF1 A;  1QVG Z;  4NH1 C;  1I50 I;  2K3R A;  2W03 A;  2E2H I;  2KPI A;  1YUA A;  5A2Q b;  3CMA 1;  4E33 A;  2HU9 A;  4RV9 A;  1X3Z A;  3S2D I;  3HOW I;  4NBF A;  4A3M I;  3RZD I;  3G4S Z;  1YIT 1;  1VLA A;  1USP B;  3EER A;  3CC2 1;  1L1O C;  1YJN 1;  1W2B Y;  4E2Y A;  1VQO 1;  1VQK 1;  1Z03 A;  3MON A;  1KD1 1;  4HGZ A;  1QVG Y;  2VUM I;  1YHQ Z;  3HOU I;  2Q4Z A;  1Q7Y 2;  3NFZ A;  3VTN A;  1YUK A;  4HH4 A;  2JNY A;  2PM9 A;  3CME 1;  1VQ7 Z;  1NJI 1;  2JA5 I;  3D6W A;  3GTM I;  5T6B A;  2M6N A;  2JA6 I;  1KQS Z;  3Q87 A;  2QRC B;  4NBD A;  1ZB9 A;  4A3K I;  3S1R I;  3HOZ I;  4RVG A;  4NB8 A;  3J81 b;  2QEX Z;  3G4S 1;  1YIJ Z;  5LL6 f;  4NBE A;  3GTL I;  3S17 I;  3G6E Z;  3GTQ I;  3HOV I;  1YHQ 1;  1TWH I;  3KIF A;  1TWC I;  1KQS Y;  1TWF I;  3BG0 B;  3I4M I;  1ML8 A;  1NUI A;  4MD9 A;  1Y1V S;  4Y52 I;  1VQ7 1;  5FLX b;  3PO3 I;  4E2X A;  4DGL A;  5D1O A;  1Y1W I;  4RVD A;  2I3C A;  1WCM I;  3I07 A;  3CC4 1;  4BBR I;  3CCE Z;  2QEX 1;  1YIJ 1;  1DL6 A;  1K83 I;  3G6E 1;  4NB9 A;  1SFO I;  4HGY A;  2Y0S A;  3CCJ 1;  3CC7 Z;  4A93 I;  1RO2 A;  3S16 I;  2QA4 Z;  1K8A 1;  3CC2 Z;  4DQY B;  2R6M A;  2YAD A;  1RNI A;  1M1K 1;  4EWC A;  3CCR Z;  1R9T I;  2QKD A;  1Q86 1;  3P5J B;  5C3E I;  2HF1 A;  3H0G I;  2M48 A;  5IP7 I;  3CCE 1;  3CCM Z;  2JR6 A;  2W04 A;  1I6H I;  1K9M 1;  1P9N A;  4E2W A;  1K73 2;  2RHB A;  5CM2 M;  3CC7 1;  1ZH1 A;  3I55 Z;  2EGT A;  3H3V J;  1WW9 A;  3G71 Z;  2V8K A;  4MXU A;  2GU2 A;  2QA4 1;  2DE5 A;  2B63 I;  4BBS I;  3S1Q I;  4NFR A;  3T4N B;  4CL1 A;  3HOY I;  1KC8 2;  3CCR 1;  2OOY B;  2V8I A;  1X0T A;  4S1T A;  2OZK A;  3CCS 1;  1YJW Z;  2DE6 A;  3CCM 1;  2O4H A;  5T64 A;  3HOX I;  3J80 b;  2IZ3 A;  3CPW Z;  1N2F A;  1USP A;  1QVF Z;  1YI2 Z;  1KRL A;  5T67 A;  4MH4 A;  3I55 1;  4E2Z A;  2PK7 A;  3ESW A;  3G71 1;  3CC4 Z;  3VMI A;  3GCF A;  2G2K A;  4MD8 A;  1VQN Z;  2Q51 A;  2NVQ I;  3VMH A;  3J7A 4;  3GTK I;  3RZO I;  3HKZ A;  2JUB A;  4E31 A;  3CCJ Z;  1TWA I;  1M90 2;  4MRI A;  4BY1 I;  3GTJ I;  1QVF Y;  1QYP A;  1JJ2 Z;  1YJW 1;  3M4O I;  3J80 f;  3GTP I;  1VQL 1;  4A3I I;  2RBL A;  1TWG I;  1Q7Y 1;  3S1N I;  1Q82 2;  4NOZ A;  1S7M A;  2F4O A;  2JA7 I;  1YI2 1;  3S14 I;  3EED A;  3F3P C;  2RIQ A;  1VQP Z;  1X3W A;  1JJ2 Y;  3KIH A;  2WB1 A;  1VQN 1;  1VQ6 Z;  3NH4 A;  4A3D I;  2WAQ A;  4A3L I;  2ZAE B;  2OOX B;  1S72 Z;  1RO0 A;  2QLV B;  2RT9 A;  4RS4 A;  1Q81 2;  4NBH A;  5IT9 b;  3GTM S;  3F3F C;  3NDJ A;  1TFI A;  2BJO A;  4A3C I;  4BXX I;  3CCS Z;  5C44 I;  3S1M I;  1VQP 1;  4X6A I;  3TE5 B;  4Y7N I;  3VMG A;  1VQ6 1;  1VQ9 Z;  2QRD B;  3MZL B;  2AKL A;  1KD1 2;  3BG1 B;  1S72 1;  3JAM b;  5IT9 f;  3PO3 S;  4QTT A;  3IX0 A;  4A3B I;  3M3Y I;  2H85 A;  4E30 A;  1N8R 2;  1YJ9 Z;  3CCQ Z;  1VQ8 1;  4A3J I;  2V8J A;  1ZB8 A;  1NJI 2;  1Q81 1;  2P28 A;  3CCL Z;  2LIY A;  1VQ4 Z;  3LUS A;  1Z01 A;  4MD7 A;  3S15 I;  4MON A;  3D9X A;  1Y1V I;  3NDI A;  1I3Q I;  3MZK B;  1RO4 A;  3CCU Z;  1VQL Z;  3JAM f;  1VQ9 1;  2GTI A;  2E2I I;  4E32 A;  3CD6 Z;  3GTG I;  4DK1 A;  4NBG A;  1LQL A;  1K73 1;  4RVH A;  2QR1 B;  4BY7 I;  1YJ9 1;  3CCQ 1;  3NH8 A;  2NVX I;  2JS4 A;  3GKQ A;  3I56 Z;  1N8R 1;  3CCL 1;  1NP6 A;  1VQ4 1;  2VUG A;  4NBC A;  2K5R A;  3FQM A;  2DE7 A;  3IF8 A;  5A2Q f;  4A3E I;  3CPW Y;  1Z02 A;  2NVT I;  1VQM Z;  1KC8 1;  3CCV Z;  3QWU A;  2E2J I;  3FQQ A;  3CCU 1;  3GTO I;  1VQ5 Z;  1RLY A;  3CD6 1;  2F4M A;  5D1O B;  5D1P A;  3U50 C;  2GTH A;  3CXC Z;  3K7A I;  3OW2 Z;  3S2H I;  1RQF A;  5C4J I;  4NBA A;  1K8A 2;  4TNU A;  3I56 1;  1M1K 2;  5FLM I;  2OTL Z;  1Q86 2;  2KI7 B;  1VQM 1;  3CXC Y;  3CCV 1;  3OW2 Y;  2R7Z I;  3J81 f;  1VQ8 Z;  2IZ4 A;  1M90 1;  1K9M 2;  2QRE B;  2OTJ Z;  1JWH C;  3I4N I;  4QTU A;  2O53 A;  1QF8 A;  4NBB A;  1VQ5 1;  3CQZ I;  4RVF A;  2RPR A;  5AN9 F;  2JA8 I;  1Q82 1;  4A3F I;  3VB9 A;  3IFU A;  5FLX f;  3CMA Z;  2R93 I;  2PMZ A;  4A3G I;  3TDH B;  1PFT A;  5IP9 I;  1YIT Z;  2OTL 1;  1YJN Z;  2E9H A;  1VQO Z;  1VQK Z;  1WII A;  2LFU A;  3PO2 I;  5C4X I;  3FKI I;  2R92 I;  2JMO A;  3NH5 A;  2NVY I;  1W2B Z;  2OTJ 1;  2YU9 I;  3CME Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...