1VQ8Z

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq8Z00
1YIJ1 3CCRZ 3I561 1Q822 3CXCY 1YJW1 3G71Z 3CCE1 1YI2Z 1Q821 2OTJZ 3CME1 3G6EZ 1VQ6Z 1YITZ 1YJ9Z 1M1K2 1KQSY 3CMAZ 1QVGY 1VQMZ 1KQSZ 1QVGZ 2QA41 3CCM1 1M1K1 3I55Z 1Q7Y2 1Q862 1VQ41 3CC7Z 3CCS1 3CCL1 2QEX1 2OTLZ 1Q7Y1 1VQN1 1Q861 1VQKZ 1VQ8Z 1NJI2 3CCJZ 1K732 3OW2Y 3CD6Z 3CCQZ 3CXCZ 1VQ9Z 1NJI1 1K731 1YHQ1 3CC41 1S72Z 3G4SZ 1M902 3CCR1 3CC2Z 1VQ5Z 1KD12 1M901 3G711 1YI21 1VQ7Z 3CCU1 1KD11 2OTJ1 3G6E1 1VQ61 3CCV1 1YIT1 1YJ91 1YJNZ 1VQNZ 3CPWY 1YIJZ 3CMA1 1VQM1 3CPWZ 3OW2Z 3I56Z 1VQL1 1VQO1 1YJWZ 3I551 3CCEZ 1VQP1 1Q812 1JJ2Y 3CC71 3CMEZ 1Q811 2OTL1 1VQK1 1VQ81 3CCJ1 2QA4Z 3CD61 3CCMZ 3CCQ1 1N8R2 1KC82 1VQ91 1W2BY 1VQ4Z 1W2BZ 3CCSZ 3CCLZ 1N8R1 1KC81 2QEXZ 3CCUZ 1S721 1QVFY 3G4S1 3CCVZ 1QVFZ 1K9M2 3CC21 1VQ51 1VQLZ 1K8A2 1VQOZ 1K9M1 1JJ2Z 1VQ71 1VQPZ 1K8A1 1YHQZ 3CC4Z 1YJN1
chains in the Genus database with same CATH superfamily
2GTIA 2E2JI 3RZOI 1TWCI 3J81b 2F4MA 2Q4ZA 1Q822 2R7ZI 3CXCY 3J7A4 1QXFA 1RO4A 2K5RA 2I3CA 3I4NI 2DE7A 2AKLA 3S1QI 1YITZ 3S2DI 2Q51A 1KQSY 2OOYB 3HKZA 4E33A 3HOXI 3MZKB 1I50I 2JA8I 3VMIA 2HF1A 1Q862 4A3KI 3CC7Z 3CCS1 1S7MA 1Q7Y1 3NH4A 1Z02A 1NJI2 3VMGA 5D1OA 4A3BI 4DGLA 4RVFA 3CC41 5IP9I 4E2YA 1DL6A 3G4SZ 1X3WA 4HGYA 4DQYB 2VPWA 1KD12 3GTOI 2G2KA 2QKDA 3MONA 4A3JI 2JR6A 4TNUA 1USPB 1YIT1 3IFUA 3NFZA 3QWUA 1QF8A 1VQL1 3OW2Z 2NAPA 4A3CI 2VPXA 1Q812 3CC71 5C4JI 2E7ZA 1WZNA 1AA6A 2RPRA 2P3YA 2PM9A 3M3YI 4Y52I 4NBFA 1ZH1A 1Q16A 2JIQA 3CCMZ 4AYBA 1KC82 3ESWA 2IZ4A 1W2BZ 1TWHI 3CCLZ 3CCUZ 2R92I 3S16I 2V45A 3G4S1 1FDOA 1K8A2 1K9M1 3LUSA 2GU2A 3GTKI 3GTMS 1YHQZ 4HH4A 2RBLA 2RIQA 4MXUA 3G71Z 4CL1A 3GTJI 2JIMA 1VQ6Z 4A3MI 2Y0SA 2HU9A 4NOZA 1YJ9Z 1JWHC 2EGTA 3GCFA 4DK1A 1VQMZ 1KQSZ 4BBSI 4MRIA 2V3VA 3GTQI 3CCM1 1M1K1 3I55Z 3BG0B 4NBDA 3CCL1 1VQ8Z 1I6HI 3T4NB 3CCJZ 2E2II 5T64A 1YUKA 2KI7B 1TWGI 3CD6Z 2VUGA 2OZKA 1YJN1 1K731 3F3FC 3S1NI 4XX2A 1YHQ1 3U50C 3JAMf 1S72Z 3GTMI 1M902 3CC2Z 1VQ5Z 3NH5A 2K3RA 3G711 1RO0A 1VQ7Z 4A3DI 1I3QI 1VQ61 2JIPA 5IP7I 1YJ91 2RT9A 1VQNZ 3CPWY 1VQM1 2JUBA 4E2XA 3I551 1JJ2Y 4A3II 5FLXb 2NVQI 3S1MI 4RV9A 3NH8A 3PO3S 1VQ81 3CCJ1 4BY7I 3CD61 1N8R2 1LQLA 2R93I 3F3PC 1VQ4Z 1NP6A 4NB9A 4BBRI 4BY1I 1S721 2BJOA 1QVFY 1TWAI 3CCVZ 5AN9F 2VUMI 5T67A 3CC21 3S15I 2V8KA 1VQ51 1WW9A 1VQOZ 1Y8CA 1VQ71 1VQPZ 2M48A 2OOXB 1ML8A 4MH4A 3H3VJ 3JAMb 3CCRZ 2WAQA 1WIIA 3H0GI 1Q821 3D9XA 3GTPI 3EERA 2LEXA 1RQFA 1RLYA 2IZ3A 3CMAZ 1QVGY 3PO3I 1WJ2A 2ZAEB 2JNYA 4E2WA 1Q7Y2 3VB9A 1VQ41 1NUIA 2DE5A 5IT9f 4RVHA 2OTLZ 1Q861 4A3LI 1VQKZ 5D1OB 3D6WA 2J6AA 3NDJA 3CQZI 3I4MI 2GTHA 3OW2Y 1PFTA 3IF8A 5FLXf 3CCQZ 3CXCZ 2VF1A 1VQ9Z 3HOVI 1NJI1 3HOYI 2JA6I 1Z01A 4NBAA 3KIFA 4MONA 4NH1C 3K7AI 3CCR1 5A2Qf 5LL6f 1N2FA 2JIOA 2W03A 4E31A 3J80f 3CCU1 1KD11 4QTTA 4Y7NI 3Q87A 2VPZA 1YIJZ 1USPA 3CMA1 2JA7I 1ZB9A 3CPWZ 3I56Z 2JMOA 1YJWZ 2DE6A 3CCEZ 1ZB8A 4EWCA 2WB1A 3S14I 2VPYA 3CMEZ 1Q811 2OTL1 3PO2I 3P5JB 3RZDI 1VQK1 1VLAA 1Y1WI 4NB8A 2QA4Z 3CCQ1 1VQ91 3I07A 1X3ZA 4E32A 3FQMA 4MD8A 3TDHB 4A3EI 3IR7A 2M6NA 1KC81 2QEXZ 4S1TA 2F4OA 5D1PA 5IT9b 1FDIA 4RVDA 2LFUA 4E2ZA 1QVFZ 1K9M2 3FKII 3EEDA 1VQLZ 2QLVB 4RVGA 1K8A1 1Y1VS 2JIRA 1WCMI 3VTNA 3S1RI 1SIWA 1Z03A 2LIYA 2KPIA 4MD9A 3TE5B 1YIJ1 2QREB 3S2HI 3I561 1YJW1 5A2Qb 3CCE1 1YI2Z 3GTLI 3MZLB 2OTJZ 3J80b 3G6EZ 3CME1 4QTUA 2QRDB 4A93I 1X0TA 2NVXI 1M1K2 1R9TI 4NBHA 4MD7A 1QVGZ 3GKQA 1KRLA 2QA41 4NBEA 2NVYI 2RHBA 3VMHA 1P9NA 2W04A 2QEX1 4A3GI 1VQN1 1SFOI 3NDIA 4A3FI 1K732 3HOZI 5C3EI 4NBCA 3M4OI 3IX0A 4RS4A 4BXXI 4X6AI 2O53A 3FQQA 1Y1VI 3J81f 2NVTI 2P28A 2PK7A 1M901 1L1OC 1YI21 2AYDA 2OTJ1 3G6E1 3HOWI 3CCV1 2V8IA 3HOUI 1YJNZ 4HGZA 5FLMI 3S17I 2IV2X 2YU9I 1VQO1 2QRCB 1VQP1 1QYPA 5C44I 1TWFI 3KIHA 2E9HA 3GTGI 2E2HI 2V8JA 1W2BY 2R6MA 1RO2A 2H85A 3CCSZ 1N8R1 1YUAA 1TFIA 1RNIA 1K83I 2B63I 2JS4A 2PMZA 4NBGA 4E30A 3BG1B 1JJ2Z 5CM2M 2YADA 3D2LA 3CC4Z 2O4HA 5T6BA 2QR1B 4NFRA 4NBBA 2JA5I 5C4XI
chains in the Genus database with same CATH topology
2GTIA 2E2JI 3RZOI 1TWCI 3J81b 2F4MA 2Q4ZA 1Q822 2R7ZI 3CXCY 3J7A4 1RO4A 2K5RA 2I3CA 3I4NI 2DE7A 2AKLA 3S1QI 1YITZ 3S2DI 2Q51A 1KQSY 2OOYB 3HKZA 4E33A 3HOXI 3MZKB 1I50I 2JA8I 3VMIA 2HF1A 1Q862 4A3KI 3CC7Z 3CCS1 1S7MA 1Q7Y1 3NH4A 1Z02A 1NJI2 3VMGA 5D1OA 4A3BI 4DGLA 4RVFA 3CC41 5IP9I 4E2YA 1DL6A 3G4SZ 1X3WA 4HGYA 4DQYB 1KD12 3GTOI 2G2KA 2QKDA 3MONA 4A3JI 2JR6A 4TNUA 1USPB 1YIT1 3IFUA 3NFZA 3QWUA 1QF8A 1VQL1 3OW2Z 4A3CI 1Q812 3CC71 5C4JI 2RPRA 2P3YA 2PM9A 3M3YI 4Y52I 4NBFA 1ZH1A 3CCMZ 4AYBA 1KC82 3ESWA 2IZ4A 1W2BZ 1TWHI 3CCLZ 3CCUZ 2R92I 3S16I 3G4S1 1K8A2 1K9M1 3LUSA 2GU2A 3GTKI 3GTMS 1YHQZ 4HH4A 2RBLA 2RIQA 4MXUA 3G71Z 4CL1A 3GTJI 1VQ6Z 4A3MI 2Y0SA 2HU9A 4NOZA 1YJ9Z 1JWHC 2EGTA 3GCFA 4DK1A 1VQMZ 1KQSZ 4BBSI 4MRIA 3GTQI 3CCM1 1M1K1 3I55Z 3BG0B 4NBDA 3CCL1 1VQ8Z 1I6HI 3T4NB 3CCJZ 2E2II 5T64A 1YUKA 2KI7B 1TWGI 3CD6Z 2VUGA 2OZKA 1YJN1 1K731 3F3FC 3S1NI 4XX2A 1YHQ1 3U50C 3JAMf 1S72Z 3GTMI 1M902 3CC2Z 1VQ5Z 3NH5A 2K3RA 3G711 1RO0A 1VQ7Z 4A3DI 1I3QI 1VQ61 5IP7I 1YJ91 2RT9A 1VQNZ 3CPWY 1VQM1 2JUBA 4E2XA 3I551 1JJ2Y 4A3II 5FLXb 2NVQI 3S1MI 4RV9A 3NH8A 3PO3S 1VQ81 3CCJ1 4BY7I 3CD61 1N8R2 1LQLA 2R93I 3F3PC 1VQ4Z 1NP6A 4NB9A 4BBRI 4BY1I 1S721 2BJOA 1QVFY 1TWAI 3CCVZ 5AN9F 2VUMI 5T67A 3CC21 3S15I 2V8KA 1VQ51 1WW9A 1VQOZ 1VQ71 1VQPZ 2M48A 2OOXB 1ML8A 4MH4A 3H3VJ 3JAMb 3CCRZ 2WAQA 1WIIA 3H0GI 1Q821 3D9XA 3GTPI 3EERA 1RQFA 1RLYA 2IZ3A 3CMAZ 1QVGY 3PO3I 2ZAEB 2JNYA 4E2WA 1Q7Y2 3VB9A 1VQ41 1NUIA 2DE5A 5IT9f 4RVHA 2OTLZ 1Q861 4A3LI 1VQKZ 5D1OB 3D6WA 2J6AA 3NDJA 3CQZI 3I4MI 2GTHA 3OW2Y 1PFTA 3IF8A 5FLXf 3CCQZ 3CXCZ 2VF1A 1VQ9Z 3HOVI 1NJI1 3HOYI 2JA6I 1Z01A 4NBAA 3KIFA 4MONA 4NH1C 3K7AI 3CCR1 5A2Qf 5LL6f 1N2FA 2W03A 4E31A 3J80f 3CCU1 1KD11 4QTTA 4Y7NI 3Q87A 1YIJZ 1USPA 3CMA1 2JA7I 1ZB9A 3CPWZ 3I56Z 2JMOA 1YJWZ 2DE6A 3CCEZ 1ZB8A 4EWCA 2WB1A 3S14I 3CMEZ 1Q811 2OTL1 3PO2I 3P5JB 3RZDI 1VQK1 1VLAA 1Y1WI 4NB8A 2QA4Z 3CCQ1 1VQ91 3I07A 1X3ZA 4E32A 3FQMA 4MD8A 3TDHB 4A3EI 2M6NA 1KC81 2QEXZ 4S1TA 2F4OA 5D1PA 5IT9b 4RVDA 2LFUA 4E2ZA 1QVFZ 1K9M2 3FKII 3EEDA 1VQLZ 2QLVB 4RVGA 1K8A1 1Y1VS 1WCMI 3VTNA 3S1RI 1Z03A 2LIYA 2KPIA 4MD9A 3TE5B 1YIJ1 2QREB 3S2HI 3I561 1YJW1 5A2Qb 3CCE1 1YI2Z 3GTLI 3MZLB 2OTJZ 3J80b 3G6EZ 3CME1 4QTUA 2QRDB 4A93I 1X0TA 2NVXI 1M1K2 1R9TI 4NBHA 4MD7A 1QVGZ 3GKQA 1KRLA 2QA41 4NBEA 2NVYI 2RHBA 3VMHA 1P9NA 2W04A 2QEX1 4A3GI 1VQN1 1SFOI 3NDIA 4A3FI 1K732 3HOZI 5C3EI 4NBCA 3M4OI 3IX0A 4RS4A 4BXXI 4X6AI 2O53A 3FQQA 1Y1VI 3J81f 2NVTI 2P28A 2PK7A 1M901 1L1OC 1YI21 2OTJ1 3G6E1 3HOWI 3CCV1 2V8IA 3HOUI 1YJNZ 4HGZA 5FLMI 3S17I 2YU9I 1VQO1 2QRCB 1VQP1 1QYPA 5C44I 1TWFI 3KIHA 2E9HA 3GTGI 2E2HI 2V8JA 1W2BY 2R6MA 1RO2A 2H85A 3CCSZ 1N8R1 1YUAA 1TFIA 1RNIA 1K83I 2B63I 2JS4A 2PMZA 4NBGA 4E30A 3BG1B 1JJ2Z 5CM2M 2YADA 3CC4Z 2O4HA 5T6BA 2QR1B 4NFRA 4NBBA 2JA5I 5C4XI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 1;  3CCR Z;  3I56 1;  1Q82 2;  3CXC Y;  1YJW 1;  3G71 Z;  3CCE 1;  1YI2 Z;  1Q82 1;  2OTJ Z;  3CME 1;  3G6E Z;  1VQ6 Z;  1YIT Z;  1YJ9 Z;  1M1K 2;  1KQS Y;  3CMA Z;  1QVG Y;  1VQM Z;  1KQS Z;  1QVG Z;  2QA4 1;  3CCM 1;  1M1K 1;  3I55 Z;  1Q7Y 2;  1Q86 2;  1VQ4 1;  3CC7 Z;  3CCS 1;  3CCL 1;  2QEX 1;  2OTL Z;  1Q7Y 1;  1VQN 1;  1Q86 1;  1VQK Z;  1VQ8 Z;  1NJI 2;  3CCJ Z;  1K73 2;  3OW2 Y;  3CD6 Z;  3CCQ Z;  3CXC Z;  1VQ9 Z;  1NJI 1;  1K73 1;  1YHQ 1;  3CC4 1;  1S72 Z;  3G4S Z;  1M90 2;  3CCR 1;  3CC2 Z;  1VQ5 Z;  1KD1 2;  1M90 1;  3G71 1;  1YI2 1;  1VQ7 Z;  3CCU 1;  1KD1 1;  2OTJ 1;  3G6E 1;  1VQ6 1;  3CCV 1;  1YIT 1;  1YJ9 1;  1YJN Z;  1VQN Z;  3CPW Y;  1YIJ Z;  3CMA 1;  1VQM 1;  3CPW Z;  3OW2 Z;  3I56 Z;  1VQL 1;  1VQO 1;  1YJW Z;  3I55 1;  3CCE Z;  1VQP 1;  1Q81 2;  1JJ2 Y;  3CC7 1;  3CME Z;  1Q81 1;  2OTL 1;  1VQK 1;  1VQ8 1;  3CCJ 1;  2QA4 Z;  3CD6 1;  3CCM Z;  3CCQ 1;  1N8R 2;  1KC8 2;  1VQ9 1;  1W2B Y;  1VQ4 Z;  1W2B Z;  3CCS Z;  3CCL Z;  1N8R 1;  1KC8 1;  2QEX Z;  3CCU Z;  1S72 1;  1QVF Y;  3G4S 1;  3CCV Z;  1QVF Z;  1K9M 2;  3CC2 1;  1VQ5 1;  1VQL Z;  1K8A 2;  1VQO Z;  1K9M 1;  1JJ2 Z;  1VQ7 1;  1VQP Z;  1K8A 1;  1YHQ Z;  3CC4 Z;  1YJN 1; 
#chains in the Genus database with same CATH topology
 2GTI A;  2E2J I;  3RZO I;  1TWC I;  3J81 b;  2F4M A;  2Q4Z A;  1Q82 2;  2R7Z I;  3CXC Y;  3J7A 4;  1QXF A;  1RO4 A;  2K5R A;  2I3C A;  3I4N I;  2DE7 A;  2AKL A;  3S1Q I;  1YIT Z;  3S2D I;  2Q51 A;  1KQS Y;  2OOY B;  3HKZ A;  4E33 A;  3HOX I;  3MZK B;  1I50 I;  2JA8 I;  3VMI A;  2HF1 A;  1Q86 2;  4A3K I;  3CC7 Z;  3CCS 1;  1S7M A;  1Q7Y 1;  3NH4 A;  1Z02 A;  1NJI 2;  3VMG A;  5D1O A;  4A3B I;  4DGL A;  4RVF A;  3CC4 1;  5IP9 I;  4E2Y A;  1DL6 A;  3G4S Z;  1X3W A;  4HGY A;  4DQY B;  2VPW A;  1KD1 2;  3GTO I;  2G2K A;  2QKD A;  3MON A;  4A3J I;  2JR6 A;  4TNU A;  1USP B;  1YIT 1;  3IFU A;  3NFZ A;  3QWU A;  1QF8 A;  1VQL 1;  3OW2 Z;  2NAP A;  4A3C I;  2VPX A;  1Q81 2;  3CC7 1;  5C4J I;  2E7Z A;  1WZN A;  1AA6 A;  2RPR A;  2P3Y A;  2PM9 A;  3M3Y I;  4Y52 I;  4NBF A;  1ZH1 A;  1Q16 A;  2JIQ A;  3CCM Z;  4AYB A;  1KC8 2;  3ESW A;  2IZ4 A;  1W2B Z;  1TWH I;  3CCL Z;  3CCU Z;  2R92 I;  3S16 I;  2V45 A;  3G4S 1;  1FDO A;  1K8A 2;  1K9M 1;  3LUS A;  2GU2 A;  3GTK I;  3GTM S;  1YHQ Z;  4HH4 A;  2RBL A;  2RIQ A;  4MXU A;  3G71 Z;  4CL1 A;  3GTJ I;  2JIM A;  1VQ6 Z;  4A3M I;  2Y0S A;  2HU9 A;  4NOZ A;  1YJ9 Z;  1JWH C;  2EGT A;  3GCF A;  4DK1 A;  1VQM Z;  1KQS Z;  4BBS I;  4MRI A;  2V3V A;  3GTQ I;  3CCM 1;  1M1K 1;  3I55 Z;  3BG0 B;  4NBD A;  3CCL 1;  1VQ8 Z;  1I6H I;  3T4N B;  3CCJ Z;  2E2I I;  5T64 A;  1YUK A;  2KI7 B;  1TWG I;  3CD6 Z;  2VUG A;  2OZK A;  1YJN 1;  1K73 1;  3F3F C;  3S1N I;  4XX2 A;  1YHQ 1;  3U50 C;  3JAM f;  1S72 Z;  3GTM I;  1M90 2;  3CC2 Z;  1VQ5 Z;  3NH5 A;  2K3R A;  3G71 1;  1RO0 A;  1VQ7 Z;  4A3D I;  1I3Q I;  1VQ6 1;  2JIP A;  5IP7 I;  1YJ9 1;  2RT9 A;  1VQN Z;  3CPW Y;  1VQM 1;  2JUB A;  4E2X A;  3I55 1;  1JJ2 Y;  4A3I I;  5FLX b;  2NVQ I;  3S1M I;  4RV9 A;  3NH8 A;  3PO3 S;  1VQ8 1;  3CCJ 1;  4BY7 I;  3CD6 1;  1N8R 2;  1LQL A;  2R93 I;  3F3P C;  1VQ4 Z;  1NP6 A;  4NB9 A;  4BBR I;  4BY1 I;  1S72 1;  2BJO A;  1QVF Y;  1TWA I;  3CCV Z;  5AN9 F;  2VUM I;  5T67 A;  3CC2 1;  3S15 I;  2V8K A;  1VQ5 1;  1WW9 A;  1VQO Z;  1Y8C A;  1VQ7 1;  1VQP Z;  2M48 A;  2OOX B;  1ML8 A;  4MH4 A;  3H3V J;  3JAM b;  3CCR Z;  2WAQ A;  1WII A;  3H0G I;  1Q82 1;  3D9X A;  3GTP I;  3EER A;  2LEX A;  1RQF A;  1RLY A;  2IZ3 A;  3CMA Z;  1QVG Y;  3PO3 I;  1WJ2 A;  2ZAE B;  2JNY A;  4E2W A;  1Q7Y 2;  3VB9 A;  1VQ4 1;  1NUI A;  2DE5 A;  5IT9 f;  4RVH A;  2OTL Z;  1Q86 1;  4A3L I;  1VQK Z;  5D1O B;  3D6W A;  2J6A A;  3NDJ A;  3CQZ I;  3I4M I;  2GTH A;  3OW2 Y;  1PFT A;  3IF8 A;  5FLX f;  3CCQ Z;  3CXC Z;  2VF1 A;  1VQ9 Z;  3HOV I;  1NJI 1;  3HOY I;  2JA6 I;  1Z01 A;  4NBA A;  3KIF A;  4MON A;  4NH1 C;  3K7A I;  3CCR 1;  5A2Q f;  5LL6 f;  1N2F A;  2JIO A;  2W03 A;  4E31 A;  3J80 f;  3CCU 1;  1KD1 1;  4QTT A;  4Y7N I;  3Q87 A;  2VPZ A;  1YIJ Z;  1USP A;  3CMA 1;  2JA7 I;  1ZB9 A;  3CPW Z;  3I56 Z;  2JMO A;  1YJW Z;  2DE6 A;  3CCE Z;  1ZB8 A;  4EWC A;  2WB1 A;  3S14 I;  2VPY A;  3CME Z;  1Q81 1;  2OTL 1;  3PO2 I;  3P5J B;  3RZD I;  1VQK 1;  1VLA A;  1Y1W I;  4NB8 A;  2QA4 Z;  3CCQ 1;  1VQ9 1;  3I07 A;  1X3Z A;  4E32 A;  3FQM A;  4MD8 A;  3TDH B;  4A3E I;  3IR7 A;  2M6N A;  1KC8 1;  2QEX Z;  4S1T A;  2F4O A;  5D1P A;  5IT9 b;  1FDI A;  4RVD A;  2LFU A;  4E2Z A;  1QVF Z;  1K9M 2;  3FKI I;  3EED A;  1VQL Z;  2QLV B;  4RVG A;  1K8A 1;  1Y1V S;  2JIR A;  1WCM I;  3VTN A;  3S1R I;  1SIW A;  1Z03 A;  2LIY A;  2KPI A;  4MD9 A;  3TE5 B;  1YIJ 1;  2QRE B;  3S2H I;  3I56 1;  1YJW 1;  5A2Q b;  3CCE 1;  1YI2 Z;  3GTL I;  3MZL B;  2OTJ Z;  3J80 b;  3G6E Z;  3CME 1;  4QTU A;  2QRD B;  4A93 I;  1X0T A;  2NVX I;  1M1K 2;  1R9T I;  4NBH A;  4MD7 A;  1QVG Z;  3GKQ A;  1KRL A;  2QA4 1;  4NBE A;  2NVY I;  2RHB A;  3VMH A;  1P9N A;  2W04 A;  2QEX 1;  4A3G I;  1VQN 1;  1SFO I;  3NDI A;  4A3F I;  1K73 2;  3HOZ I;  5C3E I;  4NBC A;  3M4O I;  3IX0 A;  4RS4 A;  4BXX I;  4X6A I;  2O53 A;  3FQQ A;  1Y1V I;  3J81 f;  2NVT I;  2P28 A;  2PK7 A;  1M90 1;  1L1O C;  1YI2 1;  2AYD A;  2OTJ 1;  3G6E 1;  3HOW I;  3CCV 1;  2V8I A;  3HOU I;  1YJN Z;  4HGZ A;  5FLM I;  3S17 I;  2IV2 X;  2YU9 I;  1VQO 1;  2QRC B;  1VQP 1;  1QYP A;  5C44 I;  1TWF I;  3KIH A;  2E9H A;  3GTG I;  2E2H I;  2V8J A;  1W2B Y;  2R6M A;  1RO2 A;  2H85 A;  3CCS Z;  1N8R 1;  1YUA A;  1TFI A;  1RNI A;  1K83 I;  2B63 I;  2JS4 A;  2PMZ A;  4NBG A;  4E30 A;  3BG1 B;  1JJ2 Z;  5CM2 M;  2YAD A;  3D2L A;  3CC4 Z;  2O4H A;  5T6B A;  2QR1 B;  4NFR A;  4NBB A;  2JA5 I;  5C4X I; 
#chains in the Genus database with same CATH homology
 2GTI A;  2E2J I;  3RZO I;  1TWC I;  3J81 b;  2F4M A;  2Q4Z A;  1Q82 2;  2R7Z I;  3CXC Y;  3J7A 4;  1RO4 A;  2K5R A;  2I3C A;  3I4N I;  2DE7 A;  2AKL A;  3S1Q I;  1YIT Z;  3S2D I;  2Q51 A;  1KQS Y;  2OOY B;  3HKZ A;  4E33 A;  3HOX I;  3MZK B;  1I50 I;  2JA8 I;  3VMI A;  2HF1 A;  1Q86 2;  4A3K I;  3CC7 Z;  3CCS 1;  1S7M A;  1Q7Y 1;  3NH4 A;  1Z02 A;  1NJI 2;  3VMG A;  5D1O A;  4A3B I;  4DGL A;  4RVF A;  3CC4 1;  5IP9 I;  4E2Y A;  1DL6 A;  3G4S Z;  1X3W A;  4HGY A;  4DQY B;  1KD1 2;  3GTO I;  2G2K A;  2QKD A;  3MON A;  4A3J I;  2JR6 A;  4TNU A;  1USP B;  1YIT 1;  3IFU A;  3NFZ A;  3QWU A;  1QF8 A;  1VQL 1;  3OW2 Z;  4A3C I;  1Q81 2;  3CC7 1;  5C4J I;  2RPR A;  2P3Y A;  2PM9 A;  3M3Y I;  4Y52 I;  4NBF A;  1ZH1 A;  3CCM Z;  4AYB A;  1KC8 2;  3ESW A;  2IZ4 A;  1W2B Z;  1TWH I;  3CCL Z;  3CCU Z;  2R92 I;  3S16 I;  3G4S 1;  1K8A 2;  1K9M 1;  3LUS A;  2GU2 A;  3GTK I;  3GTM S;  1YHQ Z;  4HH4 A;  2RBL A;  2RIQ A;  4MXU A;  3G71 Z;  4CL1 A;  3GTJ I;  1VQ6 Z;  4A3M I;  2Y0S A;  2HU9 A;  4NOZ A;  1YJ9 Z;  1JWH C;  2EGT A;  3GCF A;  4DK1 A;  1VQM Z;  1KQS Z;  4BBS I;  4MRI A;  3GTQ I;  3CCM 1;  1M1K 1;  3I55 Z;  3BG0 B;  4NBD A;  3CCL 1;  1VQ8 Z;  1I6H I;  3T4N B;  3CCJ Z;  2E2I I;  5T64 A;  1YUK A;  2KI7 B;  1TWG I;  3CD6 Z;  2VUG A;  2OZK A;  1YJN 1;  1K73 1;  3F3F C;  3S1N I;  4XX2 A;  1YHQ 1;  3U50 C;  3JAM f;  1S72 Z;  3GTM I;  1M90 2;  3CC2 Z;  1VQ5 Z;  3NH5 A;  2K3R A;  3G71 1;  1RO0 A;  1VQ7 Z;  4A3D I;  1I3Q I;  1VQ6 1;  5IP7 I;  1YJ9 1;  2RT9 A;  1VQN Z;  3CPW Y;  1VQM 1;  2JUB A;  4E2X A;  3I55 1;  1JJ2 Y;  4A3I I;  5FLX b;  2NVQ I;  3S1M I;  4RV9 A;  3NH8 A;  3PO3 S;  1VQ8 1;  3CCJ 1;  4BY7 I;  3CD6 1;  1N8R 2;  1LQL A;  2R93 I;  3F3P C;  1VQ4 Z;  1NP6 A;  4NB9 A;  4BBR I;  4BY1 I;  1S72 1;  2BJO A;  1QVF Y;  1TWA I;  3CCV Z;  5AN9 F;  2VUM I;  5T67 A;  3CC2 1;  3S15 I;  2V8K A;  1VQ5 1;  1WW9 A;  1VQO Z;  1VQ7 1;  1VQP Z;  2M48 A;  2OOX B;  1ML8 A;  4MH4 A;  3H3V J;  3JAM b;  3CCR Z;  2WAQ A;  1WII A;  3H0G I;  1Q82 1;  3D9X A;  3GTP I;  3EER A;  1RQF A;  1RLY A;  2IZ3 A;  3CMA Z;  1QVG Y;  3PO3 I;  2ZAE B;  2JNY A;  4E2W A;  1Q7Y 2;  3VB9 A;  1VQ4 1;  1NUI A;  2DE5 A;  5IT9 f;  4RVH A;  2OTL Z;  1Q86 1;  4A3L I;  1VQK Z;  5D1O B;  3D6W A;  2J6A A;  3NDJ A;  3CQZ I;  3I4M I;  2GTH A;  3OW2 Y;  1PFT A;  3IF8 A;  5FLX f;  3CCQ Z;  3CXC Z;  2VF1 A;  1VQ9 Z;  3HOV I;  1NJI 1;  3HOY I;  2JA6 I;  1Z01 A;  4NBA A;  3KIF A;  4MON A;  4NH1 C;  3K7A I;  3CCR 1;  5A2Q f;  5LL6 f;  1N2F A;  2W03 A;  4E31 A;  3J80 f;  3CCU 1;  1KD1 1;  4QTT A;  4Y7N I;  3Q87 A;  1YIJ Z;  1USP A;  3CMA 1;  2JA7 I;  1ZB9 A;  3CPW Z;  3I56 Z;  2JMO A;  1YJW Z;  2DE6 A;  3CCE Z;  1ZB8 A;  4EWC A;  2WB1 A;  3S14 I;  3CME Z;  1Q81 1;  2OTL 1;  3PO2 I;  3P5J B;  3RZD I;  1VQK 1;  1VLA A;  1Y1W I;  4NB8 A;  2QA4 Z;  3CCQ 1;  1VQ9 1;  3I07 A;  1X3Z A;  4E32 A;  3FQM A;  4MD8 A;  3TDH B;  4A3E I;  2M6N A;  1KC8 1;  2QEX Z;  4S1T A;  2F4O A;  5D1P A;  5IT9 b;  4RVD A;  2LFU A;  4E2Z A;  1QVF Z;  1K9M 2;  3FKI I;  3EED A;  1VQL Z;  2QLV B;  4RVG A;  1K8A 1;  1Y1V S;  1WCM I;  3VTN A;  3S1R I;  1Z03 A;  2LIY A;  2KPI A;  4MD9 A;  3TE5 B;  1YIJ 1;  2QRE B;  3S2H I;  3I56 1;  1YJW 1;  5A2Q b;  3CCE 1;  1YI2 Z;  3GTL I;  3MZL B;  2OTJ Z;  3J80 b;  3G6E Z;  3CME 1;  4QTU A;  2QRD B;  4A93 I;  1X0T A;  2NVX I;  1M1K 2;  1R9T I;  4NBH A;  4MD7 A;  1QVG Z;  3GKQ A;  1KRL A;  2QA4 1;  4NBE A;  2NVY I;  2RHB A;  3VMH A;  1P9N A;  2W04 A;  2QEX 1;  4A3G I;  1VQN 1;  1SFO I;  3NDI A;  4A3F I;  1K73 2;  3HOZ I;  5C3E I;  4NBC A;  3M4O I;  3IX0 A;  4RS4 A;  4BXX I;  4X6A I;  2O53 A;  3FQQ A;  1Y1V I;  3J81 f;  2NVT I;  2P28 A;  2PK7 A;  1M90 1;  1L1O C;  1YI2 1;  2OTJ 1;  3G6E 1;  3HOW I;  3CCV 1;  2V8I A;  3HOU I;  1YJN Z;  4HGZ A;  5FLM I;  3S17 I;  2YU9 I;  1VQO 1;  2QRC B;  1VQP 1;  1QYP A;  5C44 I;  1TWF I;  3KIH A;  2E9H A;  3GTG I;  2E2H I;  2V8J A;  1W2B Y;  2R6M A;  1RO2 A;  2H85 A;  3CCS Z;  1N8R 1;  1YUA A;  1TFI A;  1RNI A;  1K83 I;  2B63 I;  2JS4 A;  2PMZ A;  4NBG A;  4E30 A;  3BG1 B;  1JJ2 Z;  5CM2 M;  2YAD A;  3CC4 Z;  2O4H A;  5T6B A;  2QR1 B;  4NFR A;  4NBB A;  2JA5 I;  5C4X I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...