5CM2M

Insights into molecular plasticity in protein complexes from trm9-trm112 trna modifying enzyme crystal structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
MKFLTSNFVQCASKQCVSSGNAFPLTFSALEMVQQEAEFDPEFLVSMLERIDWAALVKVANDLGNESLPDVKPEIDEPFAEGNQGLLQELHSLLIETCIVEGTMKCENCGHTYFIKNSIPNFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TRNA METHYLTRANSFERASE
publication title Insights into molecular plasticity in protein complexes from Trm9-Trm112 tRNA modifying enzyme crystal structure.
pubmed doi rcsb
source organism Yarrowia lipolytica clib122
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5cm2M00
2P3YA 2JA5I 1RLYA 3GTPI 1I50I 1TFIA 5C44I 4A93I 4MH4A 4NB8A 2R92I 3HOWI 3S16I 4A3LI 1TWFI 3ESWA 3PO3S 1I6HI 1K83I 4Y52I 3S15I 2B63I 1TWHI 2F4MA 3GTJI 2JA6I 1L1OC 4X6AI 1Y1VS 4BBRI 3GTMI 3GTOI 1ML8A 1ZB9A 4NBBA 3U50C 2NVXI 3HOVI 1TWGI 3HOYI 2HF1A 3GKQA 5C4JI 4A3DI 2JNYA 1NUIA 2JA8I 5CM2M 2AKLA 3GTLI 3RZOI 4A3CI 3GTGI 3S14I 5IP9I 3H3VJ 2KPIA 1WW9A 1RO4A 2F4OA 3I4MI 1USPB 1PFTA 3S1NI 4A3GI 4NBHA 4XX2A 4A3BI 2NVTI 2JA7I 3HOZI 4NBFA 1Y1WI 4A3KI 3HOUI 1Y1VI 3I07A 2R93I 3S17I 3FKII 2JS4A 4QTUA 3M3YI 1YUAA 2J6AA 5C4XI 4NBDA 3VB9A 3S1RI 4BXXI 1X3ZA 4BY7I 3S1QI 1SFOI 4BY1I 4NB9A 1R9TI 2DE7A 3RZDI 3I4NI 1VLAA 3PO3I 4A3II 4A3FI 2JR6A 3S2HI 3LUSA 4NBEA 5IP7I 3CQZI 3VMIA 4NOZA 3D6WA 5FLMI 4NBCA 2E2HI 2NVQI 2BJOA 2RBLA 1I3QI 2E2JI 4QTTA 3HOXI 2R7ZI 1QYPA 3PO2I 1WCMI 3VMGA 3VMHA 3Q87A 1LQLA 2DE5A 3EERA 1USPA 4A3EI 3GTKI 1TWCI 3S1MI 2DE6A 3GTQI 1X3WA 3H0GI 3S2DI 4A3JI 2PK7A 2NVYI 2VUMI 2K5RA 3K7AI 4A3MI 3GTMS 2YU9I 1N2FA 3M4OI 3GCFA 4NBAA 2E2II 4NBGA 4Y7NI 5C3EI 4BBSI 1TWAI 1ZB8A 1DL6A
chains in the Genus database with same CATH superfamily
4E2ZA 5IT9b 3D9XA 3CCR1 3S16I 2H85A 4A3LI 3PO3S 1VQK1 4E32A 1VQP1 1M901 2B63I 2F4MA 1L1OC 3GTMI 2GTIA 1ZB9A 3HOVI 4NBBA 3U50C 2I3CA 5AN9F 3CCS1 3JAMf 1VQ7Z 2P28A 1NUIA 2JA8I 2Q4ZA 3GTGI 1JWHC 3MONA 4CL1A 1USPB 1VQ9Z 3CC4Z 2ZAEB 2EGTA 3S1NI 1QXFA 4A3GI 4A3BI 1VQL1 2LIYA 1YJ9Z 3HOUI 1Y1VI 2JIRA 2VF1A 2VUGA 3M3YI 3G4SZ 3I551 3S1RI 4RVHA 3IFUA 3MZLB 3BG1B 4NB9A 1Q811 3RZDI 4A3FI 3S2HI 4E31A 3HKZA 2QA4Z 4NOZA 1KC81 2E2HI 3D2LA 2RPRA 2QKDA 3HOXI 5IT9f 4MONA 1VQOZ 1LQLA 2G2KA 2DE5A 2OOXB 1S721 3NDJA 3TE5B 1TWCI 3S1MI 5A2Qb 1N8R2 1Q861 1VQ81 4MD7A 1VQN1 2PK7A 2PM9A 1YUKA 2V8JA 2V3VA 4NH1C 5T6BA 1N2FA 1FDOA 1QVGZ 4Y7NI 1RQFA 2JIQA 2JIPA 1W2BY 1Q812 1JJ2Z 4BBSI 2JUBA 2QEXZ 2JA5I 1DL6A 2Q51A 4A93I 3NH4A 1KC82 4MD9A 2RHBA 4TNUA 1TWHI 3GTJI 3G6E1 4BBRI 1WZNA 2NVXI 1VQ4Z 1TWGI 3J81b 1Q7Y1 3CCMZ 3GKQA 2QR1B 2JNYA 1YI2Z 3P5JB 2AKLA 3RZOI 3CC2Z 4A3CI 1YJN1 5IP9I 1QVFY 3I4MI 2WB1A 1Q16A 4NBHA 3HOZI 4NBFA 2O53A 1VQO1 2PMZA 3BG0B 3CCLZ 3I07A 2OZKA 2R93I 3FKII 1K8A1 2JS4A 3F3PC 5A2Qf 3CCEZ 4QTUA 2JIOA 2O4HA 1YUAA 4DGLA 1AA6A 3J7A4 3G71Z 1VQMZ 4BY7I 4BY1I 1R9TI 2DE7A 3I4NI 1VQ6Z 1Q821 1QVGY 4MD8A 2GU2A 3CQZI 5IP7I 3VMIA 5FLMI 4NBCA 1YHQ1 2E2JI 1I3QI 3CC71 3CCUZ 4AYBA 1YITZ 1X0TA 3PO2I 4HGZA 3Q87A 3I561 2M48A 1M902 1KRLA 3GTKI 5T67A 1QF8A 3GTQI 2QREB 3F3FC 3H0GI 3S2DI 1YJW1 2VUMI 2WAQA 3CME1 3J81f 2K5RA 3GTMS 2YU9I 2IV2X 1Z01A 5LL6f 3CC21 2NAPA 1M1K1 1YIJZ 2OOYB 3MZKB 3IX0A 1TWAI 3T4NB 1RLYA 5T64A 3GTPI 1I50I 2V8IA 5C44I 4MH4A 2R92I 5D1OA 1TWFI 3ESWA 3CCL1 1K731 1K83I 4NFRA 4Y52I 4RVFA 4RVGA 3NH5A 1VQ71 3S15I 4RVDA 2JA6I 3FQQA 1Y1VS 2VPXA 1VQKZ 3G711 1VQM1 3CD6Z 1NP6A 1Z02A 5C4JI 4A3DI 2OTJZ 1VQ91 3CC41 2YADA 1RO0A 3FQMA 1YJ91 3GTLI 1RO2A 2KPIA 1WW9A 5FLXb 1RO4A 2F4OA 3EEDA 1PFTA 2VPZA 1Y8CA 1ZH1A 4MXUA 2NVTI 2HU9A 1YIT1 1Y1WI 3CMAZ 4A3KI 4EWCA 3CCQZ 3G4S1 3OW2Z 2KI7B 1Q862 2R6MA 1K732 2J6AA 4NBDA 4BXXI 1NJI1 4E2YA 1SFOI 2QA41 1KQSZ 1VLAA 3I55Z 4A3II 5D1OB 1YIJ1 2IZ3A 4NBEA 1K9M1 3D6WA 2NVQI 2BJOA 3CCJZ 2RBLA 4HGYA 2JIMA 4QTTA 2R7ZI 3J80b 3VMGA 3QWUA 3CXCZ 2VPWA 2QLVB 3EERA 4A3EI 4E2WA 2AYDA 3CCVZ 3CD61 4A3JI 2E7ZA 1Q7Y2 1S72Z 4E33A 2OTJ1 4S1TA 2LEXA 1VQ8Z 2Y0SA 2E2II 2QEX1 5D1PA 1JJ2Y 2OTLZ 1VQNZ 1NJI2 4NBGA 1VQ5Z 3IR7A 5C3EI 3NFZA 5FLXf 3TDHB 1ZB8A 2P3YA 1W2BZ 3CMA1 1K9M2 1TFIA 3CCQ1 4NB8A 3HOWI 1KD11 1SIWA 3OW2Y 1VQ41 1I6HI 2V8KA 1K8A2 3CCM1 1N8R1 2VPYA 4X6AI 2K3RA 1YI21 2QRCB 3GTOI 1ML8A 2W04A 1FDIA 3KIHA 4HH4A 3HOYI 2HF1A 3IF8A 3KIFA 2QRDB 3G6EZ 1KQSY 1Q822 5CM2M 3S14I 2GTHA 3H3VJ 1P9NA 3CPWZ 3CCJ1 4XX2A 1QVFZ 1WJ2A 2JA7I 3CCE1 1YJNZ 3CCRZ 3J80f 2V45A 3S17I 3CXCY 1KD12 1VQPZ 3CCV1 5C4XI 3VB9A 1VQ61 3JAMb 1Z03A 1X3ZA 3S1QI 3CCSZ 4DQYB 1RNIA 2OTL1 1VQ51 3PO3I 4MRIA 1M1K2 3CCU1 2JR6A 3LUSA 1WIIA 4DK1A 1VQLZ 3NH8A 1QYPA 3VTNA 1WCMI 4E30A 3VMHA 2RT9A 1USPA 1YHQZ 2DE6A 3CC7Z 1X3WA 3NDIA 2W03A 2NVYI 2E9HA 1S7MA 3I56Z 3K7AI 4A3MI 4RS4A 4E2XA 3M4OI 3GCFA 4NBAA 2M6NA 2JMOA 1YJWZ 2RIQA 3CMEZ 2IZ4A 2LFUA 4RV9A 3CPWY
chains in the Genus database with same CATH topology
4E2ZA 5IT9b 3D9XA 3CCR1 3S16I 2H85A 4A3LI 3PO3S 1VQK1 4E32A 1VQP1 1M901 2B63I 2F4MA 1L1OC 3GTMI 2GTIA 1ZB9A 3HOVI 4NBBA 3U50C 2I3CA 5AN9F 3CCS1 3JAMf 1VQ7Z 2P28A 1NUIA 2JA8I 2Q4ZA 3GTGI 1JWHC 3MONA 4CL1A 1USPB 1VQ9Z 3CC4Z 2ZAEB 2EGTA 3S1NI 4A3GI 4A3BI 1VQL1 2LIYA 1YJ9Z 3HOUI 1Y1VI 2VF1A 2VUGA 3M3YI 3G4SZ 3I551 3S1RI 4RVHA 3IFUA 3MZLB 3BG1B 4NB9A 1Q811 3RZDI 4A3FI 3S2HI 4E31A 3HKZA 2QA4Z 4NOZA 1KC81 2E2HI 2RPRA 2QKDA 3HOXI 5IT9f 4MONA 1VQOZ 1LQLA 2G2KA 2DE5A 2OOXB 1S721 3NDJA 3TE5B 1TWCI 3S1MI 5A2Qb 1N8R2 1Q861 1VQ81 4MD7A 1VQN1 2PK7A 2PM9A 1YUKA 2V8JA 4NH1C 5T6BA 1N2FA 1QVGZ 4Y7NI 1RQFA 1W2BY 1Q812 1JJ2Z 4BBSI 2JUBA 2QEXZ 2JA5I 1DL6A 2Q51A 4A93I 3NH4A 1KC82 4MD9A 2RHBA 4TNUA 1TWHI 3GTJI 3G6E1 4BBRI 2NVXI 1VQ4Z 1TWGI 3J81b 1Q7Y1 3CCMZ 3GKQA 2QR1B 2JNYA 1YI2Z 3P5JB 2AKLA 3RZOI 3CC2Z 4A3CI 1YJN1 5IP9I 1QVFY 3I4MI 2WB1A 4NBHA 3HOZI 4NBFA 2O53A 1VQO1 2PMZA 3BG0B 3CCLZ 3I07A 2OZKA 2R93I 3FKII 1K8A1 2JS4A 3F3PC 5A2Qf 3CCEZ 4QTUA 2O4HA 1YUAA 4DGLA 3J7A4 3G71Z 1VQMZ 4BY7I 4BY1I 1R9TI 2DE7A 3I4NI 1VQ6Z 1Q821 1QVGY 4MD8A 2GU2A 3CQZI 5IP7I 3VMIA 5FLMI 4NBCA 1YHQ1 2E2JI 1I3QI 3CC71 3CCUZ 4AYBA 1YITZ 1X0TA 3PO2I 4HGZA 3Q87A 3I561 2M48A 1M902 1KRLA 3GTKI 5T67A 1QF8A 3GTQI 2QREB 3F3FC 3H0GI 3S2DI 1YJW1 2VUMI 2WAQA 3CME1 3J81f 2K5RA 3GTMS 2YU9I 1Z01A 5LL6f 3CC21 1M1K1 1YIJZ 2OOYB 3MZKB 3IX0A 1TWAI 3T4NB 1RLYA 5T64A 3GTPI 1I50I 2V8IA 5C44I 4MH4A 2R92I 5D1OA 1TWFI 3ESWA 3CCL1 1K731 1K83I 4NFRA 4Y52I 4RVFA 4RVGA 3NH5A 1VQ71 3S15I 4RVDA 2JA6I 3FQQA 1Y1VS 1VQKZ 3G711 1VQM1 3CD6Z 1NP6A 1Z02A 5C4JI 4A3DI 2OTJZ 1VQ91 3CC41 2YADA 1RO0A 3FQMA 1YJ91 3GTLI 1RO2A 2KPIA 1WW9A 5FLXb 1RO4A 2F4OA 3EEDA 1PFTA 1ZH1A 4MXUA 2NVTI 2HU9A 1YIT1 1Y1WI 3CMAZ 4A3KI 4EWCA 3CCQZ 3G4S1 3OW2Z 2KI7B 1Q862 2R6MA 1K732 2J6AA 4NBDA 4BXXI 1NJI1 4E2YA 1SFOI 2QA41 1KQSZ 1VLAA 3I55Z 4A3II 5D1OB 1YIJ1 2IZ3A 4NBEA 1K9M1 3D6WA 2NVQI 2BJOA 3CCJZ 2RBLA 4HGYA 4QTTA 2R7ZI 3J80b 3VMGA 3QWUA 3CXCZ 3EERA 4A3EI 2QLVB 4E2WA 3CCVZ 3CD61 4A3JI 1Q7Y2 1S72Z 4E33A 2OTJ1 4S1TA 1VQ8Z 2Y0SA 2E2II 2QEX1 5D1PA 1JJ2Y 2OTLZ 1VQNZ 1NJI2 4NBGA 1VQ5Z 5C3EI 3NFZA 5FLXf 3TDHB 1ZB8A 2P3YA 1W2BZ 3CMA1 1K9M2 1TFIA 3CCQ1 4NB8A 3HOWI 1KD11 3OW2Y 1VQ41 1I6HI 2V8KA 1K8A2 3CCM1 1N8R1 4X6AI 2K3RA 1YI21 2QRCB 3GTOI 1ML8A 2W04A 3KIHA 4HH4A 3HOYI 2HF1A 3IF8A 3KIFA 2QRDB 3G6EZ 1KQSY 1Q822 5CM2M 3S14I 2GTHA 3H3VJ 1P9NA 3CPWZ 3CCJ1 4XX2A 1QVFZ 2JA7I 3CCE1 1YJNZ 3CCRZ 3J80f 3S17I 3CXCY 1KD12 1VQPZ 3CCV1 5C4XI 3VB9A 1VQ61 3JAMb 1Z03A 1X3ZA 3S1QI 3CCSZ 4DQYB 1RNIA 2OTL1 1VQ51 3PO3I 4MRIA 1M1K2 3CCU1 2JR6A 3LUSA 1WIIA 4DK1A 1VQLZ 3NH8A 1QYPA 3VTNA 1WCMI 4E30A 3VMHA 2RT9A 1YHQZ 1USPA 2DE6A 3CC7Z 1X3WA 3NDIA 2W03A 2NVYI 2E9HA 1S7MA 3I56Z 3K7AI 4A3MI 4RS4A 4E2XA 3M4OI 3GCFA 4NBAA 2M6NA 2JMOA 1YJWZ 2RIQA 3CMEZ 2IZ4A 2LFUA 4RV9A 3CPWY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3Y A;  2JA5 I;  1RLY A;  3GTP I;  1I50 I;  1TFI A;  5C44 I;  4A93 I;  4MH4 A;  4NB8 A;  2R92 I;  3HOW I;  3S16 I;  4A3L I;  1TWF I;  3ESW A;  3PO3 S;  1I6H I;  1K83 I;  4Y52 I;  3S15 I;  2B63 I;  1TWH I;  2F4M A;  3GTJ I;  2JA6 I;  1L1O C;  4X6A I;  1Y1V S;  4BBR I;  3GTM I;  3GTO I;  1ML8 A;  1ZB9 A;  4NBB A;  3U50 C;  2NVX I;  3HOV I;  1TWG I;  3HOY I;  2HF1 A;  3GKQ A;  5C4J I;  4A3D I;  2JNY A;  1NUI A;  2JA8 I;  5CM2 M;  2AKL A;  3GTL I;  3RZO I;  4A3C I;  3GTG I;  3S14 I;  5IP9 I;  3H3V J;  2KPI A;  1WW9 A;  1RO4 A;  2F4O A;  3I4M I;  1USP B;  1PFT A;  3S1N I;  4A3G I;  4NBH A;  4XX2 A;  4A3B I;  2NVT I;  2JA7 I;  3HOZ I;  4NBF A;  1Y1W I;  4A3K I;  3HOU I;  1Y1V I;  3I07 A;  2R93 I;  3S17 I;  3FKI I;  2JS4 A;  4QTU A;  3M3Y I;  1YUA A;  2J6A A;  5C4X I;  4NBD A;  3VB9 A;  3S1R I;  4BXX I;  1X3Z A;  4BY7 I;  3S1Q I;  1SFO I;  4BY1 I;  4NB9 A;  1R9T I;  2DE7 A;  3RZD I;  3I4N I;  1VLA A;  3PO3 I;  4A3I I;  4A3F I;  2JR6 A;  3S2H I;  3LUS A;  4NBE A;  5IP7 I;  3CQZ I;  3VMI A;  4NOZ A;  3D6W A;  5FLM I;  4NBC A;  2E2H I;  2NVQ I;  2BJO A;  2RBL A;  1I3Q I;  2E2J I;  4QTT A;  3HOX I;  2R7Z I;  1QYP A;  3PO2 I;  1WCM I;  3VMG A;  3VMH A;  3Q87 A;  1LQL A;  2DE5 A;  3EER A;  1USP A;  4A3E I;  3GTK I;  1TWC I;  3S1M I;  2DE6 A;  3GTQ I;  1X3W A;  3H0G I;  3S2D I;  4A3J I;  2PK7 A;  2NVY I;  2VUM I;  2K5R A;  3K7A I;  4A3M I;  3GTM S;  2YU9 I;  1N2F A;  3M4O I;  3GCF A;  4NBA A;  2E2I I;  4NBG A;  4Y7N I;  5C3E I;  4BBS I;  1TWA I;  1ZB8 A;  1DL6 A; 
#chains in the Genus database with same CATH topology
 4E2Z A;  5IT9 b;  3D9X A;  3CCR 1;  3S16 I;  2H85 A;  4A3L I;  3PO3 S;  1VQK 1;  4E32 A;  1VQP 1;  1M90 1;  2B63 I;  2F4M A;  1L1O C;  3GTM I;  2GTI A;  1ZB9 A;  3HOV I;  4NBB A;  3U50 C;  2I3C A;  5AN9 F;  3CCS 1;  3JAM f;  1VQ7 Z;  2P28 A;  1NUI A;  2JA8 I;  2Q4Z A;  3GTG I;  1JWH C;  3MON A;  4CL1 A;  1USP B;  1VQ9 Z;  3CC4 Z;  2ZAE B;  2EGT A;  3S1N I;  1QXF A;  4A3G I;  4A3B I;  1VQL 1;  2LIY A;  1YJ9 Z;  3HOU I;  1Y1V I;  2JIR A;  2VF1 A;  2VUG A;  3M3Y I;  3G4S Z;  3I55 1;  3S1R I;  4RVH A;  3IFU A;  3MZL B;  3BG1 B;  4NB9 A;  1Q81 1;  3RZD I;  4A3F I;  3S2H I;  4E31 A;  3HKZ A;  2QA4 Z;  4NOZ A;  1KC8 1;  2E2H I;  3D2L A;  2RPR A;  2QKD A;  3HOX I;  5IT9 f;  4MON A;  1VQO Z;  1LQL A;  2G2K A;  2DE5 A;  2OOX B;  1S72 1;  3NDJ A;  3TE5 B;  1TWC I;  3S1M I;  5A2Q b;  1N8R 2;  1Q86 1;  1VQ8 1;  4MD7 A;  1VQN 1;  2PK7 A;  2PM9 A;  1YUK A;  2V8J A;  2V3V A;  4NH1 C;  5T6B A;  1N2F A;  1FDO A;  1QVG Z;  4Y7N I;  1RQF A;  2JIQ A;  2JIP A;  1W2B Y;  1Q81 2;  1JJ2 Z;  4BBS I;  2JUB A;  2QEX Z;  2JA5 I;  1DL6 A;  2Q51 A;  4A93 I;  3NH4 A;  1KC8 2;  4MD9 A;  2RHB A;  4TNU A;  1TWH I;  3GTJ I;  3G6E 1;  4BBR I;  1WZN A;  2NVX I;  1VQ4 Z;  1TWG I;  3J81 b;  1Q7Y 1;  3CCM Z;  3GKQ A;  2QR1 B;  2JNY A;  1YI2 Z;  3P5J B;  2AKL A;  3RZO I;  3CC2 Z;  4A3C I;  1YJN 1;  5IP9 I;  1QVF Y;  3I4M I;  2WB1 A;  1Q16 A;  4NBH A;  3HOZ I;  4NBF A;  2O53 A;  1VQO 1;  2PMZ A;  3BG0 B;  3CCL Z;  3I07 A;  2OZK A;  2R93 I;  3FKI I;  1K8A 1;  2JS4 A;  3F3P C;  5A2Q f;  3CCE Z;  4QTU A;  2JIO A;  2O4H A;  1YUA A;  4DGL A;  1AA6 A;  3J7A 4;  3G71 Z;  1VQM Z;  4BY7 I;  4BY1 I;  1R9T I;  2DE7 A;  3I4N I;  1VQ6 Z;  1Q82 1;  1QVG Y;  4MD8 A;  2GU2 A;  3CQZ I;  5IP7 I;  3VMI A;  5FLM I;  4NBC A;  1YHQ 1;  2E2J I;  1I3Q I;  3CC7 1;  3CCU Z;  4AYB A;  1YIT Z;  1X0T A;  3PO2 I;  4HGZ A;  3Q87 A;  3I56 1;  2M48 A;  1M90 2;  1KRL A;  3GTK I;  5T67 A;  1QF8 A;  3GTQ I;  2QRE B;  3F3F C;  3H0G I;  3S2D I;  1YJW 1;  2VUM I;  2WAQ A;  3CME 1;  3J81 f;  2K5R A;  3GTM S;  2YU9 I;  2IV2 X;  1Z01 A;  5LL6 f;  3CC2 1;  2NAP A;  1M1K 1;  1YIJ Z;  2OOY B;  3MZK B;  3IX0 A;  1TWA I;  3T4N B;  1RLY A;  5T64 A;  3GTP I;  1I50 I;  2V8I A;  5C44 I;  4MH4 A;  2R92 I;  5D1O A;  1TWF I;  3ESW A;  3CCL 1;  1K73 1;  1K83 I;  4NFR A;  4Y52 I;  4RVF A;  4RVG A;  3NH5 A;  1VQ7 1;  3S15 I;  4RVD A;  2JA6 I;  3FQQ A;  1Y1V S;  2VPX A;  1VQK Z;  3G71 1;  1VQM 1;  3CD6 Z;  1NP6 A;  1Z02 A;  5C4J I;  4A3D I;  2OTJ Z;  1VQ9 1;  3CC4 1;  2YAD A;  1RO0 A;  3FQM A;  1YJ9 1;  3GTL I;  1RO2 A;  2KPI A;  1WW9 A;  5FLX b;  1RO4 A;  2F4O A;  3EED A;  1PFT A;  2VPZ A;  1Y8C A;  1ZH1 A;  4MXU A;  2NVT I;  2HU9 A;  1YIT 1;  1Y1W I;  3CMA Z;  4A3K I;  4EWC A;  3CCQ Z;  3G4S 1;  3OW2 Z;  2KI7 B;  1Q86 2;  2R6M A;  1K73 2;  2J6A A;  4NBD A;  4BXX I;  1NJI 1;  4E2Y A;  1SFO I;  2QA4 1;  1KQS Z;  1VLA A;  3I55 Z;  4A3I I;  5D1O B;  1YIJ 1;  2IZ3 A;  4NBE A;  1K9M 1;  3D6W A;  2NVQ I;  2BJO A;  3CCJ Z;  2RBL A;  4HGY A;  2JIM A;  4QTT A;  2R7Z I;  3J80 b;  3VMG A;  3QWU A;  3CXC Z;  2VPW A;  2QLV B;  3EER A;  4A3E I;  4E2W A;  2AYD A;  3CCV Z;  3CD6 1;  4A3J I;  2E7Z A;  1Q7Y 2;  1S72 Z;  4E33 A;  2OTJ 1;  4S1T A;  2LEX A;  1VQ8 Z;  2Y0S A;  2E2I I;  2QEX 1;  5D1P A;  1JJ2 Y;  2OTL Z;  1VQN Z;  1NJI 2;  4NBG A;  1VQ5 Z;  3IR7 A;  5C3E I;  3NFZ A;  5FLX f;  3TDH B;  1ZB8 A;  2P3Y A;  1W2B Z;  3CMA 1;  1K9M 2;  1TFI A;  3CCQ 1;  4NB8 A;  3HOW I;  1KD1 1;  1SIW A;  3OW2 Y;  1VQ4 1;  1I6H I;  2V8K A;  1K8A 2;  3CCM 1;  1N8R 1;  2VPY A;  4X6A I;  2K3R A;  1YI2 1;  2QRC B;  3GTO I;  1ML8 A;  2W04 A;  1FDI A;  3KIH A;  4HH4 A;  3HOY I;  2HF1 A;  3IF8 A;  3KIF A;  2QRD B;  3G6E Z;  1KQS Y;  1Q82 2;  5CM2 M;  3S14 I;  2GTH A;  3H3V J;  1P9N A;  3CPW Z;  3CCJ 1;  4XX2 A;  1QVF Z;  1WJ2 A;  2JA7 I;  3CCE 1;  1YJN Z;  3CCR Z;  3J80 f;  2V45 A;  3S17 I;  3CXC Y;  1KD1 2;  1VQP Z;  3CCV 1;  5C4X I;  3VB9 A;  1VQ6 1;  3JAM b;  1Z03 A;  1X3Z A;  3S1Q I;  3CCS Z;  4DQY B;  1RNI A;  2OTL 1;  1VQ5 1;  3PO3 I;  4MRI A;  1M1K 2;  3CCU 1;  2JR6 A;  3LUS A;  1WII A;  4DK1 A;  1VQL Z;  3NH8 A;  1QYP A;  3VTN A;  1WCM I;  4E30 A;  3VMH A;  2RT9 A;  1USP A;  1YHQ Z;  2DE6 A;  3CC7 Z;  1X3W A;  3NDI A;  2W03 A;  2NVY I;  2E9H A;  1S7M A;  3I56 Z;  3K7A I;  4A3M I;  4RS4 A;  4E2X A;  3M4O I;  3GCF A;  4NBA A;  2M6N A;  2JMO A;  1YJW Z;  2RIQ A;  3CME Z;  2IZ4 A;  2LFU A;  4RV9 A;  3CPW Y; 
#chains in the Genus database with same CATH homology
 4E2Z A;  5IT9 b;  3D9X A;  3CCR 1;  3S16 I;  2H85 A;  4A3L I;  3PO3 S;  1VQK 1;  4E32 A;  1VQP 1;  1M90 1;  2B63 I;  2F4M A;  1L1O C;  3GTM I;  2GTI A;  1ZB9 A;  3HOV I;  4NBB A;  3U50 C;  2I3C A;  5AN9 F;  3CCS 1;  3JAM f;  1VQ7 Z;  2P28 A;  1NUI A;  2JA8 I;  2Q4Z A;  3GTG I;  1JWH C;  3MON A;  4CL1 A;  1USP B;  1VQ9 Z;  3CC4 Z;  2ZAE B;  2EGT A;  3S1N I;  4A3G I;  4A3B I;  1VQL 1;  2LIY A;  1YJ9 Z;  3HOU I;  1Y1V I;  2VF1 A;  2VUG A;  3M3Y I;  3G4S Z;  3I55 1;  3S1R I;  4RVH A;  3IFU A;  3MZL B;  3BG1 B;  4NB9 A;  1Q81 1;  3RZD I;  4A3F I;  3S2H I;  4E31 A;  3HKZ A;  2QA4 Z;  4NOZ A;  1KC8 1;  2E2H I;  2RPR A;  2QKD A;  3HOX I;  5IT9 f;  4MON A;  1VQO Z;  1LQL A;  2G2K A;  2DE5 A;  2OOX B;  1S72 1;  3NDJ A;  3TE5 B;  1TWC I;  3S1M I;  5A2Q b;  1N8R 2;  1Q86 1;  1VQ8 1;  4MD7 A;  1VQN 1;  2PK7 A;  2PM9 A;  1YUK A;  2V8J A;  4NH1 C;  5T6B A;  1N2F A;  1QVG Z;  4Y7N I;  1RQF A;  1W2B Y;  1Q81 2;  1JJ2 Z;  4BBS I;  2JUB A;  2QEX Z;  2JA5 I;  1DL6 A;  2Q51 A;  4A93 I;  3NH4 A;  1KC8 2;  4MD9 A;  2RHB A;  4TNU A;  1TWH I;  3GTJ I;  3G6E 1;  4BBR I;  2NVX I;  1VQ4 Z;  1TWG I;  3J81 b;  1Q7Y 1;  3CCM Z;  3GKQ A;  2QR1 B;  2JNY A;  1YI2 Z;  3P5J B;  2AKL A;  3RZO I;  3CC2 Z;  4A3C I;  1YJN 1;  5IP9 I;  1QVF Y;  3I4M I;  2WB1 A;  4NBH A;  3HOZ I;  4NBF A;  2O53 A;  1VQO 1;  2PMZ A;  3BG0 B;  3CCL Z;  3I07 A;  2OZK A;  2R93 I;  3FKI I;  1K8A 1;  2JS4 A;  3F3P C;  5A2Q f;  3CCE Z;  4QTU A;  2O4H A;  1YUA A;  4DGL A;  3J7A 4;  3G71 Z;  1VQM Z;  4BY7 I;  4BY1 I;  1R9T I;  2DE7 A;  3I4N I;  1VQ6 Z;  1Q82 1;  1QVG Y;  4MD8 A;  2GU2 A;  3CQZ I;  5IP7 I;  3VMI A;  5FLM I;  4NBC A;  1YHQ 1;  2E2J I;  1I3Q I;  3CC7 1;  3CCU Z;  4AYB A;  1YIT Z;  1X0T A;  3PO2 I;  4HGZ A;  3Q87 A;  3I56 1;  2M48 A;  1M90 2;  1KRL A;  3GTK I;  5T67 A;  1QF8 A;  3GTQ I;  2QRE B;  3F3F C;  3H0G I;  3S2D I;  1YJW 1;  2VUM I;  2WAQ A;  3CME 1;  3J81 f;  2K5R A;  3GTM S;  2YU9 I;  1Z01 A;  5LL6 f;  3CC2 1;  1M1K 1;  1YIJ Z;  2OOY B;  3MZK B;  3IX0 A;  1TWA I;  3T4N B;  1RLY A;  5T64 A;  3GTP I;  1I50 I;  2V8I A;  5C44 I;  4MH4 A;  2R92 I;  5D1O A;  1TWF I;  3ESW A;  3CCL 1;  1K73 1;  1K83 I;  4NFR A;  4Y52 I;  4RVF A;  4RVG A;  3NH5 A;  1VQ7 1;  3S15 I;  4RVD A;  2JA6 I;  3FQQ A;  1Y1V S;  1VQK Z;  3G71 1;  1VQM 1;  3CD6 Z;  1NP6 A;  1Z02 A;  5C4J I;  4A3D I;  2OTJ Z;  1VQ9 1;  3CC4 1;  2YAD A;  1RO0 A;  3FQM A;  1YJ9 1;  3GTL I;  1RO2 A;  2KPI A;  1WW9 A;  5FLX b;  1RO4 A;  2F4O A;  3EED A;  1PFT A;  1ZH1 A;  4MXU A;  2NVT I;  2HU9 A;  1YIT 1;  1Y1W I;  3CMA Z;  4A3K I;  4EWC A;  3CCQ Z;  3G4S 1;  3OW2 Z;  2KI7 B;  1Q86 2;  2R6M A;  1K73 2;  2J6A A;  4NBD A;  4BXX I;  1NJI 1;  4E2Y A;  1SFO I;  2QA4 1;  1KQS Z;  1VLA A;  3I55 Z;  4A3I I;  5D1O B;  1YIJ 1;  2IZ3 A;  4NBE A;  1K9M 1;  3D6W A;  2NVQ I;  2BJO A;  3CCJ Z;  2RBL A;  4HGY A;  4QTT A;  2R7Z I;  3J80 b;  3VMG A;  3QWU A;  3CXC Z;  3EER A;  4A3E I;  2QLV B;  4E2W A;  3CCV Z;  3CD6 1;  4A3J I;  1Q7Y 2;  1S72 Z;  4E33 A;  2OTJ 1;  4S1T A;  1VQ8 Z;  2Y0S A;  2E2I I;  2QEX 1;  5D1P A;  1JJ2 Y;  2OTL Z;  1VQN Z;  1NJI 2;  4NBG A;  1VQ5 Z;  5C3E I;  3NFZ A;  5FLX f;  3TDH B;  1ZB8 A;  2P3Y A;  1W2B Z;  3CMA 1;  1K9M 2;  1TFI A;  3CCQ 1;  4NB8 A;  3HOW I;  1KD1 1;  3OW2 Y;  1VQ4 1;  1I6H I;  2V8K A;  1K8A 2;  3CCM 1;  1N8R 1;  4X6A I;  2K3R A;  1YI2 1;  2QRC B;  3GTO I;  1ML8 A;  2W04 A;  3KIH A;  4HH4 A;  3HOY I;  2HF1 A;  3IF8 A;  3KIF A;  2QRD B;  3G6E Z;  1KQS Y;  1Q82 2;  5CM2 M;  3S14 I;  2GTH A;  3H3V J;  1P9N A;  3CPW Z;  3CCJ 1;  4XX2 A;  1QVF Z;  2JA7 I;  3CCE 1;  1YJN Z;  3CCR Z;  3J80 f;  3S17 I;  3CXC Y;  1KD1 2;  1VQP Z;  3CCV 1;  5C4X I;  3VB9 A;  1VQ6 1;  3JAM b;  1Z03 A;  1X3Z A;  3S1Q I;  3CCS Z;  4DQY B;  1RNI A;  2OTL 1;  1VQ5 1;  3PO3 I;  4MRI A;  1M1K 2;  3CCU 1;  2JR6 A;  3LUS A;  1WII A;  4DK1 A;  1VQL Z;  3NH8 A;  1QYP A;  3VTN A;  1WCM I;  4E30 A;  3VMH A;  2RT9 A;  1YHQ Z;  1USP A;  2DE6 A;  3CC7 Z;  1X3W A;  3NDI A;  2W03 A;  2NVY I;  2E9H A;  1S7M A;  3I56 Z;  3K7A I;  4A3M I;  4RS4 A;  4E2X A;  3M4O I;  3GCF A;  4NBA A;  2M6N A;  2JMO A;  1YJW Z;  2RIQ A;  3CME Z;  2IZ4 A;  2LFU A;  4RV9 A;  3CPW Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...