5CM2M

Insights into molecular plasticity in protein complexes from trm9-trm112 trna modifying enzyme crystal structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
MKFLTSNFVQCASKQCVSSGNAFPLTFSALEMVQQEAEFDPEFLVSMLERIDWAALVKVANDLGNESLPDVKPEIDEPFAEGNQGLLQELHSLLIETCIVEGTMKCENCGHTYFIKNSIPNFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA METHYLTRANSFERASE
publication title Insights into molecular plasticity in protein complexes from Trm9-Trm112 tRNA modifying enzyme crystal structure.
pubmed doi rcsb
source organism Yarrowia lipolytica clib122
molecule tags Transferase
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5cm2M00
2YU9I 2F4MA 1YUAA 3GCFA 3VMHA 3S17I 1QYPA 1ZB9A 4BBRI 4NBFA 3S16I 5IP9I 3HOUI 4NB8A 3M4OI 4A3DI 5FLMI 1TWAI 3I4NI 1NUIA 1X3ZA 1LQLA 3GTGI 2RBLA 1WW9A 4NBDA 2E2JI 1X3WA 2E2HI 3D6WA 4BXXI 1N2FA 4NBEA 1DL6A 1TWHI 4NBHA 3S1QI 3S15I 3GTMI 4A3MI 3H0GI 3RZOI 3S2DI 4A3GI 1RO4A 3HOXI 3I4MI 4A3CI 5C4JI 2NVTI 2JA7I 4A3BI 3PO3S 4A3FI 4X6AI 2K5RA 3EERA 1SFOI 1Y1VI 2E2II 2AKLA 4A3II 5CM2M 4BBSI 2B63I 4NBAA 3S1MI 1USPA 2NVXI 4NBBA 3ESWA 3S2HI 3VMIA 2J6AA 1ZB8A 1TWCI 4A3EI 1I6HI 2NVQI 3HOVI 1RLYA 5C3EI 3GKQA 2DE5A 2JNYA 3M3YI 2DE6A 1L1OC 1WCMI 4Y52I 3I07A 1TFIA 4A93I 1I3QI 3GTKI 3LUSA 2HF1A 5IP7I 2VUMI 1Y1WI 1ML8A 2P3YA 2BJOA 3VMGA 3HOWI 3CQZI 3S1NI 4XX2A 2JR6A 2DE7A 2NVYI 3GTLI 3PO3I 4QTTA 3GTOI 3HOYI 2PK7A 1R9TI 4BY7I 2JA6I 2F4OA 3S1RI 4NOZA 4BY1I 3PO2I 1K83I 2R7ZI 1PFTA 3HOZI 3RZDI 3K7AI 2R93I 3U50C 4MH4A 4A3JI 3Q87A 3GTMS 4NBCA 2JS4A 2KPIA 5C44I 2R92I 2JA8I 3GTJI 4Y7NI 1USPB 5C4XI 3S14I 1VLAA 3GTPI 3GTQI 4A3LI 3H3VJ 1TWGI 1I50I 1Y1VS 4A3KI 1TWFI 3FKII 2JA5I 4QTUA 4NBGA 4NB9A 3VB9A
chains in the Genus database with same CATH superfamily
2OOYB 3NH4A 2LFUA 3GCFA 1KQSZ 1K732 2E7ZA 5T67A 3S16I 1S7MA 3M4OI 2YADA 3G4S1 4RVDA 3F3FC 1Z03A 4MXUA 2JIQA 3NDIA 3CCUZ 1Q7Y2 4HGYA 3J80b 1YJN1 2RBLA 1WW9A 4NBDA 3NFZA 1VQ7Z 1VQPZ 2HU9A 4BXXI 3CCM1 1JJ2Y 1VQOZ 4NFRA 4E2YA 3CXCY 5D1PA 3GTMI 3CMA1 4MD7A 3I4MI 5T6BA 1YITZ 3D9XA 4HH4A 3G711 4X6AI 3EERA 4S1TA 4DGLA 2E2II 1M901 3IF8A 5CM2M 4BBSI 4NBAA 1USPA 3CC7Z 1ZH1A 1JWHC 3ESWA 1QVFZ 3IR7A 2ZAEB 1I6HI 3CC41 1RLYA 2JNYA 3M3YI 1Q822 1L1OC 2O53A 3I07A 1VQ41 4A93I 3MZLB 3CD61 3EEDA 2GTHA 4E30A 1VQ61 2P3YA 5AN9F 3VMGA 1M1K1 2V45A 2JR6A 4RV9A 2NVYI 2QLVB 1YJNZ 5IT9f 3GTOI 2NAPA 4HGZA 3CCMZ 2JA6I 2IV2X 4NOZA 2R7ZI 2W04A 2O4HA 2IZ3A 2WB1A 2R93I 1WJ2A 2WAQA 4A3JI 3Q87A 2VPWA 5C44I 1VQ71 1VQP1 2JA8I 4TNUA 3G71Z 3GTJI 5C4XI 4A3LI 1TWGI 1Y1VS 2JA7I 1VQ81 4NBGA 2F4MA 2EGTA 3VMHA 1Q811 3S17I 2VUGA 3CC4Z 5IP9I 3CCE1 4NB8A 1RO2A 4A3DI 3IFUA 5FLMI 1TWAI 1KQSY 3CC71 1RO0A 2RIQA 2W03A 1NJI1 1X3WA 2E2HI 3D6WA 1N2FA 2M48A 2Q51A 1VQ6Z 4NBEA 2QEXZ 1DL6A 1X0TA 4A3GI 3HOXI 5C4JI 2LEXA 1NJI2 1Y1VI 1S72Z 3TDHB 4A3II 3J81b 2QRCB 3QWUA 4NBBA 1YHQ1 2GTIA 4E32A 4A3EI 5C3EI 3GKQA 1QVGZ 2DE6A 1VQ8Z 2K3RA 3CC21 1QVFY 2OTJZ 1I3QI 2OZKA 3GTKI 3LUSA 2HF1A 5IP7I 3CCEZ 2VUMI 2V8IA 1VQK1 2BJOA 4RVGA 1RQFA 1NP6A 1VQ91 2V3VA 3GTLI 2JUBA 2PK7A 4E31A 3CMEZ 1KC81 2JIOA 2KI7B 3S1RI 1SIWA 3NDJA 1YJ9Z 1KD11 1PFTA 3HOZI 1VQ51 1M902 3U50C 1YJWZ 1JJ2Z 1W2BY 3CCL1 2PMZA 3CCQ1 1USPB 1VLAA 3GTPI 2QEX1 1KC82 2GU2A 3H3VJ 3RZDI 1KD12 4A3MI 2YU9I 1YHQZ 1QF8A 1P9NA 1QYPA 1VQL1 4BBRI 3CCS1 2OTLZ 4NBFA 2VPYA 4RS4A 3CCJ1 3HOUI 1S721 1KRLA 1YIJZ 3I4NI 1M1K2 3CC2Z 1X3ZA 3NH8A 1YUKA 2VPZA 2QA41 1Q16A 5D1OB 1VQKZ 3MZKB 2OOXB 3BG0B 1VQ9Z 3RZOI 3S2DI 2IZ4A 1RO4A 2OTJ1 4A3BI 1VQNZ 4A3FI 3BG1B 1N8R1 1SFOI 3OW2Z 1VQ5Z 3CCRZ 1K9M1 2Q4ZA 3CCLZ 2QKDA 2NVXI 1VQMZ 2LIYA 3CME1 2PM9A 3CCQZ 3VMIA 2QREB 1Q812 2J6AA 1ZB8A 1YJ91 1TWCI 4E2ZA 2VF1A 4MRIA 5A2Qb 3J81f 1K8A1 1N8R2 1WCMI 1YJW1 4Y52I 1K731 2RHBA 1VQLZ 3CCSZ 4EWCA 3I561 3CCJZ 1QVGY 3FQQA 2V8JA 1ML8A 3JAMb 3KIHA 3CPWZ 2Y0SA 3CQZI 3G6E1 4RVHA 2OTL1 3HOYI 2QA4Z 1R9TI 1AA6A 2JIRA 5LL6f 4BY1I 3PO2I 4AYBA 1K83I 1YIJ1 1Y8CA 2RPRA 3TE5B 3K7AI 3CCVZ 4MH4A 4NBCA 2JS4A 3I551 3FQMA 3S14I 3J7A4 1I50I 1TWFI 3FKII 3VTNA 4QTUA 2JA5I 4NB9A 2RT9A 2VPXA 1YUAA 4RVFA 2AYDA 1ZB9A 3KIFA 1VQN1 4MD8A 4MD9A 2G2KA 1RNIA 1Q821 4E33A 3CCR1 4E2XA 3CXCZ 1VQM1 1NUIA 5T64A 1LQLA 3GTGI 1WZNA 1YI21 3I56Z 2E2JI 4DK1A 2E9HA 1Z02A 1WIIA 1TWHI 4NBHA 3S1QI 3S15I 3H0GI 3G6EZ 4A3CI 3IX0A 3P5JB 2JIPA 2NVTI 3PO3S 2K5RA 2P28A 3MONA 2AKLA 3G4SZ 2B63I 2JMOA 3S1MI 2QRDB 5D1OA 2M6NA 3I55Z 3S2HI 1W2BZ 2QR1B 4NH1C 3OW2Y 2NVQI 3HOVI 2DE5A 4CL1A 2V8KA 3CCV1 1TFIA 4MONA 3CMAZ 3CCU1 1Z01A 5A2Qf 3HKZA 3T4NB 5IT9b 4DQYB 1Y1WI 1VQO1 3HOWI 5FLXf 3S1NI 4XX2A 2DE7A 1YI2Z 4QTTA 3PO3I 1YIT1 4BY7I 1Q861 3F3PC 2F4OA 3JAMf 2H85A 3CPWY 1FDIA 3D2LA 1QXFA 2JIMA 4E2WA 1K9M2 1VQ4Z 5FLXb 3GTMS 2R6MA 2KPIA 2R92I 1FDOA 4Y7NI 3CD6Z 3NH5A 1Q862 3GTQI 1Q7Y1 1K8A2 4A3KI 3J80f 2I3CA 3VB9A
chains in the Genus database with same CATH topology
2OOYB 3NH4A 2LFUA 3GCFA 1KQSZ 1K732 5T67A 3S16I 1S7MA 3M4OI 2YADA 3G4S1 4RVDA 3F3FC 1Z03A 4MXUA 3NDIA 3CCUZ 1Q7Y2 4HGYA 3J80b 1YJN1 2RBLA 1WW9A 4NBDA 3NFZA 1VQ7Z 1VQPZ 2HU9A 4BXXI 3CCM1 1JJ2Y 1VQOZ 4NFRA 4E2YA 3CXCY 5D1PA 3GTMI 3CMA1 4MD7A 3I4MI 5T6BA 1YITZ 3D9XA 4HH4A 3G711 4X6AI 3EERA 4S1TA 4DGLA 2E2II 1M901 3IF8A 5CM2M 4BBSI 4NBAA 1USPA 3CC7Z 1ZH1A 1JWHC 3ESWA 1QVFZ 2ZAEB 1I6HI 3CC41 1RLYA 2JNYA 3M3YI 1Q822 1L1OC 2O53A 3I07A 1VQ41 4A93I 3MZLB 3CD61 3EEDA 2GTHA 4E30A 1VQ61 2P3YA 5AN9F 3VMGA 1M1K1 2JR6A 4RV9A 2NVYI 2QLVB 1YJNZ 5IT9f 3GTOI 3CCMZ 4HGZA 2JA6I 4NOZA 2R7ZI 2W04A 2O4HA 2IZ3A 2WB1A 2R93I 2WAQA 4A3JI 3Q87A 5C44I 1VQ71 1VQP1 2JA8I 4TNUA 3G71Z 3GTJI 5C4XI 4A3LI 1TWGI 1Y1VS 2JA7I 1VQ81 4NBGA 2F4MA 2EGTA 3VMHA 1Q811 3S17I 2VUGA 3CC4Z 5IP9I 3CCE1 4NB8A 1RO2A 4A3DI 3IFUA 5FLMI 1TWAI 1KQSY 3CC71 1RO0A 2RIQA 2W03A 1NJI1 1X3WA 2E2HI 3D6WA 1N2FA 2M48A 2Q51A 1VQ6Z 4NBEA 2QEXZ 1DL6A 1X0TA 4A3GI 3HOXI 5C4JI 1NJI2 1Y1VI 1S72Z 3TDHB 4A3II 3J81b 2QRCB 3QWUA 4NBBA 1YHQ1 2GTIA 4E32A 4A3EI 5C3EI 3GKQA 1QVGZ 2DE6A 1VQ8Z 2K3RA 3CC21 1QVFY 2OTJZ 1I3QI 2OZKA 3GTKI 3LUSA 2HF1A 5IP7I 3CCEZ 2VUMI 2V8IA 1VQK1 2BJOA 4RVGA 1RQFA 1NP6A 1VQ91 3GTLI 2JUBA 2PK7A 4E31A 3CMEZ 1KC81 2KI7B 3S1RI 3NDJA 1YJ9Z 1KD11 1PFTA 3HOZI 1VQ51 1M902 3U50C 1YJWZ 1JJ2Z 1W2BY 3CCL1 2PMZA 3CCQ1 1USPB 1VLAA 3GTPI 2QEX1 1KC82 2GU2A 3H3VJ 3RZDI 1KD12 4A3MI 2YU9I 1YHQZ 1QF8A 1P9NA 1QYPA 1VQL1 4BBRI 3CCS1 2OTLZ 4NBFA 4RS4A 3CCJ1 3HOUI 1S721 1KRLA 1YIJZ 3I4NI 1M1K2 3CC2Z 1X3ZA 3NH8A 1YUKA 2QA41 5D1OB 1VQKZ 3MZKB 2OOXB 3BG0B 1VQ9Z 3RZOI 3S2DI 2IZ4A 1RO4A 2OTJ1 4A3BI 1VQNZ 4A3FI 3BG1B 1N8R1 1SFOI 3OW2Z 1VQ5Z 3CCRZ 1K9M1 2Q4ZA 3CCLZ 2QKDA 2NVXI 1VQMZ 2LIYA 3CME1 2PM9A 3CCQZ 3VMIA 2QREB 1Q812 2J6AA 1ZB8A 1YJ91 1TWCI 4E2ZA 2VF1A 4MRIA 5A2Qb 3J81f 1K8A1 1N8R2 1WCMI 1YJW1 4Y52I 1K731 2RHBA 1VQLZ 3CCSZ 4EWCA 3I561 3CCJZ 1QVGY 3FQQA 2V8JA 1ML8A 3JAMb 3KIHA 3CPWZ 2Y0SA 3CQZI 3G6E1 4RVHA 2OTL1 3HOYI 2QA4Z 1R9TI 5LL6f 4BY1I 3PO2I 4AYBA 1K83I 1YIJ1 2RPRA 3TE5B 3K7AI 3CCVZ 4MH4A 4NBCA 2JS4A 3I551 3FQMA 3S14I 3J7A4 1I50I 1TWFI 3FKII 3VTNA 4QTUA 2JA5I 4NB9A 2RT9A 1YUAA 4RVFA 1ZB9A 3KIFA 1VQN1 4MD8A 4MD9A 2G2KA 1RNIA 1Q821 4E33A 3CCR1 4E2XA 3CXCZ 1VQM1 1NUIA 5T64A 1LQLA 3GTGI 1YI21 3I56Z 2E2JI 4DK1A 2E9HA 1Z02A 1WIIA 1TWHI 4NBHA 3S1QI 3S15I 3H0GI 3G6EZ 4A3CI 3IX0A 3P5JB 2NVTI 3PO3S 2K5RA 2P28A 3MONA 2AKLA 3G4SZ 2B63I 2JMOA 3S1MI 2QRDB 5D1OA 2M6NA 3I55Z 3S2HI 1W2BZ 2QR1B 4NH1C 3OW2Y 2NVQI 3HOVI 2DE5A 4CL1A 2V8KA 3CCV1 1TFIA 4MONA 3CMAZ 3CCU1 1Z01A 5A2Qf 3HKZA 3T4NB 5IT9b 4DQYB 1Y1WI 1VQO1 3HOWI 5FLXf 3S1NI 4XX2A 2DE7A 1YI2Z 4QTTA 3PO3I 1YIT1 4BY7I 1Q861 3F3PC 2F4OA 3JAMf 2H85A 3CPWY 4E2WA 1K9M2 1VQ4Z 5FLXb 3GTMS 2R6MA 2KPIA 2R92I 4Y7NI 3CD6Z 3NH5A 1Q862 3GTQI 1Q7Y1 1K8A2 4A3KI 3J80f 2I3CA 3VB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 I;  2F4M A;  1YUA A;  3GCF A;  3VMH A;  3S17 I;  1QYP A;  1ZB9 A;  4BBR I;  4NBF A;  3S16 I;  5IP9 I;  3HOU I;  4NB8 A;  3M4O I;  4A3D I;  5FLM I;  1TWA I;  3I4N I;  1NUI A;  1X3Z A;  1LQL A;  3GTG I;  2RBL A;  1WW9 A;  4NBD A;  2E2J I;  1X3W A;  2E2H I;  3D6W A;  4BXX I;  1N2F A;  4NBE A;  1DL6 A;  1TWH I;  4NBH A;  3S1Q I;  3S15 I;  3GTM I;  4A3M I;  3H0G I;  3RZO I;  3S2D I;  4A3G I;  1RO4 A;  3HOX I;  3I4M I;  4A3C I;  5C4J I;  2NVT I;  2JA7 I;  4A3B I;  3PO3 S;  4A3F I;  4X6A I;  2K5R A;  3EER A;  1SFO I;  1Y1V I;  2E2I I;  2AKL A;  4A3I I;  5CM2 M;  4BBS I;  2B63 I;  4NBA A;  3S1M I;  1USP A;  2NVX I;  4NBB A;  3ESW A;  3S2H I;  3VMI A;  2J6A A;  1ZB8 A;  1TWC I;  4A3E I;  1I6H I;  2NVQ I;  3HOV I;  1RLY A;  5C3E I;  3GKQ A;  2DE5 A;  2JNY A;  3M3Y I;  2DE6 A;  1L1O C;  1WCM I;  4Y52 I;  3I07 A;  1TFI A;  4A93 I;  1I3Q I;  3GTK I;  3LUS A;  2HF1 A;  5IP7 I;  2VUM I;  1Y1W I;  1ML8 A;  2P3Y A;  2BJO A;  3VMG A;  3HOW I;  3CQZ I;  3S1N I;  4XX2 A;  2JR6 A;  2DE7 A;  2NVY I;  3GTL I;  3PO3 I;  4QTT A;  3GTO I;  3HOY I;  2PK7 A;  1R9T I;  4BY7 I;  2JA6 I;  2F4O A;  3S1R I;  4NOZ A;  4BY1 I;  3PO2 I;  1K83 I;  2R7Z I;  1PFT A;  3HOZ I;  3RZD I;  3K7A I;  2R93 I;  3U50 C;  4MH4 A;  4A3J I;  3Q87 A;  3GTM S;  4NBC A;  2JS4 A;  2KPI A;  5C44 I;  2R92 I;  2JA8 I;  3GTJ I;  4Y7N I;  1USP B;  5C4X I;  3S14 I;  1VLA A;  3GTP I;  3GTQ I;  4A3L I;  3H3V J;  1TWG I;  1I50 I;  1Y1V S;  4A3K I;  1TWF I;  3FKI I;  2JA5 I;  4QTU A;  4NBG A;  4NB9 A;  3VB9 A; 
#chains in the Genus database with same CATH topology
 2OOY B;  3NH4 A;  2LFU A;  3GCF A;  1KQS Z;  1K73 2;  2E7Z A;  5T67 A;  3S16 I;  1S7M A;  3M4O I;  2YAD A;  3G4S 1;  4RVD A;  3F3F C;  1Z03 A;  4MXU A;  2JIQ A;  3NDI A;  3CCU Z;  1Q7Y 2;  4HGY A;  3J80 b;  1YJN 1;  2RBL A;  1WW9 A;  4NBD A;  3NFZ A;  1VQ7 Z;  1VQP Z;  2HU9 A;  4BXX I;  3CCM 1;  1JJ2 Y;  1VQO Z;  4NFR A;  4E2Y A;  3CXC Y;  5D1P A;  3GTM I;  3CMA 1;  4MD7 A;  3I4M I;  5T6B A;  1YIT Z;  3D9X A;  4HH4 A;  3G71 1;  4X6A I;  3EER A;  4S1T A;  4DGL A;  2E2I I;  1M90 1;  3IF8 A;  5CM2 M;  4BBS I;  4NBA A;  1USP A;  3CC7 Z;  1ZH1 A;  1JWH C;  3ESW A;  1QVF Z;  3IR7 A;  2ZAE B;  1I6H I;  3CC4 1;  1RLY A;  2JNY A;  3M3Y I;  1Q82 2;  1L1O C;  2O53 A;  3I07 A;  1VQ4 1;  4A93 I;  3MZL B;  3CD6 1;  3EED A;  2GTH A;  4E30 A;  1VQ6 1;  2P3Y A;  5AN9 F;  3VMG A;  1M1K 1;  2V45 A;  2JR6 A;  4RV9 A;  2NVY I;  2QLV B;  1YJN Z;  5IT9 f;  3GTO I;  2NAP A;  4HGZ A;  3CCM Z;  2JA6 I;  2IV2 X;  4NOZ A;  2R7Z I;  2W04 A;  2O4H A;  2IZ3 A;  2WB1 A;  2R93 I;  1WJ2 A;  2WAQ A;  4A3J I;  3Q87 A;  2VPW A;  5C44 I;  1VQ7 1;  1VQP 1;  2JA8 I;  4TNU A;  3G71 Z;  3GTJ I;  5C4X I;  4A3L I;  1TWG I;  1Y1V S;  2JA7 I;  1VQ8 1;  4NBG A;  2F4M A;  2EGT A;  3VMH A;  1Q81 1;  3S17 I;  2VUG A;  3CC4 Z;  5IP9 I;  3CCE 1;  4NB8 A;  1RO2 A;  4A3D I;  3IFU A;  5FLM I;  1TWA I;  1KQS Y;  3CC7 1;  1RO0 A;  2RIQ A;  2W03 A;  1NJI 1;  1X3W A;  2E2H I;  3D6W A;  1N2F A;  2M48 A;  2Q51 A;  1VQ6 Z;  4NBE A;  2QEX Z;  1DL6 A;  1X0T A;  4A3G I;  3HOX I;  5C4J I;  2LEX A;  1NJI 2;  1Y1V I;  1S72 Z;  3TDH B;  4A3I I;  3J81 b;  2QRC B;  3QWU A;  4NBB A;  1YHQ 1;  2GTI A;  4E32 A;  4A3E I;  5C3E I;  3GKQ A;  1QVG Z;  2DE6 A;  1VQ8 Z;  2K3R A;  3CC2 1;  1QVF Y;  2OTJ Z;  1I3Q I;  2OZK A;  3GTK I;  3LUS A;  2HF1 A;  5IP7 I;  3CCE Z;  2VUM I;  2V8I A;  1VQK 1;  2BJO A;  4RVG A;  1RQF A;  1NP6 A;  1VQ9 1;  2V3V A;  3GTL I;  2JUB A;  2PK7 A;  4E31 A;  3CME Z;  1KC8 1;  2JIO A;  2KI7 B;  3S1R I;  1SIW A;  3NDJ A;  1YJ9 Z;  1KD1 1;  1PFT A;  3HOZ I;  1VQ5 1;  1M90 2;  3U50 C;  1YJW Z;  1JJ2 Z;  1W2B Y;  3CCL 1;  2PMZ A;  3CCQ 1;  1USP B;  1VLA A;  3GTP I;  2QEX 1;  1KC8 2;  2GU2 A;  3H3V J;  3RZD I;  1KD1 2;  4A3M I;  2YU9 I;  1YHQ Z;  1QF8 A;  1P9N A;  1QYP A;  1VQL 1;  4BBR I;  3CCS 1;  2OTL Z;  4NBF A;  2VPY A;  4RS4 A;  3CCJ 1;  3HOU I;  1S72 1;  1KRL A;  1YIJ Z;  3I4N I;  1M1K 2;  3CC2 Z;  1X3Z A;  3NH8 A;  1YUK A;  2VPZ A;  2QA4 1;  1Q16 A;  5D1O B;  1VQK Z;  3MZK B;  2OOX B;  3BG0 B;  1VQ9 Z;  3RZO I;  3S2D I;  2IZ4 A;  1RO4 A;  2OTJ 1;  4A3B I;  1VQN Z;  4A3F I;  3BG1 B;  1N8R 1;  1SFO I;  3OW2 Z;  1VQ5 Z;  3CCR Z;  1K9M 1;  2Q4Z A;  3CCL Z;  2QKD A;  2NVX I;  1VQM Z;  2LIY A;  3CME 1;  2PM9 A;  3CCQ Z;  3VMI A;  2QRE B;  1Q81 2;  2J6A A;  1ZB8 A;  1YJ9 1;  1TWC I;  4E2Z A;  2VF1 A;  4MRI A;  5A2Q b;  3J81 f;  1K8A 1;  1N8R 2;  1WCM I;  1YJW 1;  4Y52 I;  1K73 1;  2RHB A;  1VQL Z;  3CCS Z;  4EWC A;  3I56 1;  3CCJ Z;  1QVG Y;  3FQQ A;  2V8J A;  1ML8 A;  3JAM b;  3KIH A;  3CPW Z;  2Y0S A;  3CQZ I;  3G6E 1;  4RVH A;  2OTL 1;  3HOY I;  2QA4 Z;  1R9T I;  1AA6 A;  2JIR A;  5LL6 f;  4BY1 I;  3PO2 I;  4AYB A;  1K83 I;  1YIJ 1;  1Y8C A;  2RPR A;  3TE5 B;  3K7A I;  3CCV Z;  4MH4 A;  4NBC A;  2JS4 A;  3I55 1;  3FQM A;  3S14 I;  3J7A 4;  1I50 I;  1TWF I;  3FKI I;  3VTN A;  4QTU A;  2JA5 I;  4NB9 A;  2RT9 A;  2VPX A;  1YUA A;  4RVF A;  2AYD A;  1ZB9 A;  3KIF A;  1VQN 1;  4MD8 A;  4MD9 A;  2G2K A;  1RNI A;  1Q82 1;  4E33 A;  3CCR 1;  4E2X A;  3CXC Z;  1VQM 1;  1NUI A;  5T64 A;  1LQL A;  3GTG I;  1WZN A;  1YI2 1;  3I56 Z;  2E2J I;  4DK1 A;  2E9H A;  1Z02 A;  1WII A;  1TWH I;  4NBH A;  3S1Q I;  3S15 I;  3H0G I;  3G6E Z;  4A3C I;  3IX0 A;  3P5J B;  2JIP A;  2NVT I;  3PO3 S;  2K5R A;  2P28 A;  3MON A;  2AKL A;  3G4S Z;  2B63 I;  2JMO A;  3S1M I;  2QRD B;  5D1O A;  2M6N A;  3I55 Z;  3S2H I;  1W2B Z;  2QR1 B;  4NH1 C;  3OW2 Y;  2NVQ I;  3HOV I;  2DE5 A;  4CL1 A;  2V8K A;  3CCV 1;  1TFI A;  4MON A;  3CMA Z;  3CCU 1;  1Z01 A;  5A2Q f;  3HKZ A;  3T4N B;  5IT9 b;  4DQY B;  1Y1W I;  1VQO 1;  3HOW I;  5FLX f;  3S1N I;  4XX2 A;  2DE7 A;  1YI2 Z;  4QTT A;  3PO3 I;  1YIT 1;  4BY7 I;  1Q86 1;  3F3P C;  2F4O A;  3JAM f;  2H85 A;  3CPW Y;  1FDI A;  3D2L A;  1QXF A;  2JIM A;  4E2W A;  1K9M 2;  1VQ4 Z;  5FLX b;  3GTM S;  2R6M A;  2KPI A;  2R92 I;  1FDO A;  4Y7N I;  3CD6 Z;  3NH5 A;  1Q86 2;  3GTQ I;  1Q7Y 1;  1K8A 2;  4A3K I;  3J80 f;  2I3C A;  3VB9 A; 
#chains in the Genus database with same CATH homology
 2OOY B;  3NH4 A;  2LFU A;  3GCF A;  1KQS Z;  1K73 2;  5T67 A;  3S16 I;  1S7M A;  3M4O I;  2YAD A;  3G4S 1;  4RVD A;  3F3F C;  1Z03 A;  4MXU A;  3NDI A;  3CCU Z;  1Q7Y 2;  4HGY A;  3J80 b;  1YJN 1;  2RBL A;  1WW9 A;  4NBD A;  3NFZ A;  1VQ7 Z;  1VQP Z;  2HU9 A;  4BXX I;  3CCM 1;  1JJ2 Y;  1VQO Z;  4NFR A;  4E2Y A;  3CXC Y;  5D1P A;  3GTM I;  3CMA 1;  4MD7 A;  3I4M I;  5T6B A;  1YIT Z;  3D9X A;  4HH4 A;  3G71 1;  4X6A I;  3EER A;  4S1T A;  4DGL A;  2E2I I;  1M90 1;  3IF8 A;  5CM2 M;  4BBS I;  4NBA A;  1USP A;  3CC7 Z;  1ZH1 A;  1JWH C;  3ESW A;  1QVF Z;  2ZAE B;  1I6H I;  3CC4 1;  1RLY A;  2JNY A;  3M3Y I;  1Q82 2;  1L1O C;  2O53 A;  3I07 A;  1VQ4 1;  4A93 I;  3MZL B;  3CD6 1;  3EED A;  2GTH A;  4E30 A;  1VQ6 1;  2P3Y A;  5AN9 F;  3VMG A;  1M1K 1;  2JR6 A;  4RV9 A;  2NVY I;  2QLV B;  1YJN Z;  5IT9 f;  3GTO I;  3CCM Z;  4HGZ A;  2JA6 I;  4NOZ A;  2R7Z I;  2W04 A;  2O4H A;  2IZ3 A;  2WB1 A;  2R93 I;  2WAQ A;  4A3J I;  3Q87 A;  5C44 I;  1VQ7 1;  1VQP 1;  2JA8 I;  4TNU A;  3G71 Z;  3GTJ I;  5C4X I;  4A3L I;  1TWG I;  1Y1V S;  2JA7 I;  1VQ8 1;  4NBG A;  2F4M A;  2EGT A;  3VMH A;  1Q81 1;  3S17 I;  2VUG A;  3CC4 Z;  5IP9 I;  3CCE 1;  4NB8 A;  1RO2 A;  4A3D I;  3IFU A;  5FLM I;  1TWA I;  1KQS Y;  3CC7 1;  1RO0 A;  2RIQ A;  2W03 A;  1NJI 1;  1X3W A;  2E2H I;  3D6W A;  1N2F A;  2M48 A;  2Q51 A;  1VQ6 Z;  4NBE A;  2QEX Z;  1DL6 A;  1X0T A;  4A3G I;  3HOX I;  5C4J I;  1NJI 2;  1Y1V I;  1S72 Z;  3TDH B;  4A3I I;  3J81 b;  2QRC B;  3QWU A;  4NBB A;  1YHQ 1;  2GTI A;  4E32 A;  4A3E I;  5C3E I;  3GKQ A;  1QVG Z;  2DE6 A;  1VQ8 Z;  2K3R A;  3CC2 1;  1QVF Y;  2OTJ Z;  1I3Q I;  2OZK A;  3GTK I;  3LUS A;  2HF1 A;  5IP7 I;  3CCE Z;  2VUM I;  2V8I A;  1VQK 1;  2BJO A;  4RVG A;  1RQF A;  1NP6 A;  1VQ9 1;  3GTL I;  2JUB A;  2PK7 A;  4E31 A;  3CME Z;  1KC8 1;  2KI7 B;  3S1R I;  3NDJ A;  1YJ9 Z;  1KD1 1;  1PFT A;  3HOZ I;  1VQ5 1;  1M90 2;  3U50 C;  1YJW Z;  1JJ2 Z;  1W2B Y;  3CCL 1;  2PMZ A;  3CCQ 1;  1USP B;  1VLA A;  3GTP I;  2QEX 1;  1KC8 2;  2GU2 A;  3H3V J;  3RZD I;  1KD1 2;  4A3M I;  2YU9 I;  1YHQ Z;  1QF8 A;  1P9N A;  1QYP A;  1VQL 1;  4BBR I;  3CCS 1;  2OTL Z;  4NBF A;  4RS4 A;  3CCJ 1;  3HOU I;  1S72 1;  1KRL A;  1YIJ Z;  3I4N I;  1M1K 2;  3CC2 Z;  1X3Z A;  3NH8 A;  1YUK A;  2QA4 1;  5D1O B;  1VQK Z;  3MZK B;  2OOX B;  3BG0 B;  1VQ9 Z;  3RZO I;  3S2D I;  2IZ4 A;  1RO4 A;  2OTJ 1;  4A3B I;  1VQN Z;  4A3F I;  3BG1 B;  1N8R 1;  1SFO I;  3OW2 Z;  1VQ5 Z;  3CCR Z;  1K9M 1;  2Q4Z A;  3CCL Z;  2QKD A;  2NVX I;  1VQM Z;  2LIY A;  3CME 1;  2PM9 A;  3CCQ Z;  3VMI A;  2QRE B;  1Q81 2;  2J6A A;  1ZB8 A;  1YJ9 1;  1TWC I;  4E2Z A;  2VF1 A;  4MRI A;  5A2Q b;  3J81 f;  1K8A 1;  1N8R 2;  1WCM I;  1YJW 1;  4Y52 I;  1K73 1;  2RHB A;  1VQL Z;  3CCS Z;  4EWC A;  3I56 1;  3CCJ Z;  1QVG Y;  3FQQ A;  2V8J A;  1ML8 A;  3JAM b;  3KIH A;  3CPW Z;  2Y0S A;  3CQZ I;  3G6E 1;  4RVH A;  2OTL 1;  3HOY I;  2QA4 Z;  1R9T I;  5LL6 f;  4BY1 I;  3PO2 I;  4AYB A;  1K83 I;  1YIJ 1;  2RPR A;  3TE5 B;  3K7A I;  3CCV Z;  4MH4 A;  4NBC A;  2JS4 A;  3I55 1;  3FQM A;  3S14 I;  3J7A 4;  1I50 I;  1TWF I;  3FKI I;  3VTN A;  4QTU A;  2JA5 I;  4NB9 A;  2RT9 A;  1YUA A;  4RVF A;  1ZB9 A;  3KIF A;  1VQN 1;  4MD8 A;  4MD9 A;  2G2K A;  1RNI A;  1Q82 1;  4E33 A;  3CCR 1;  4E2X A;  3CXC Z;  1VQM 1;  1NUI A;  5T64 A;  1LQL A;  3GTG I;  1YI2 1;  3I56 Z;  2E2J I;  4DK1 A;  2E9H A;  1Z02 A;  1WII A;  1TWH I;  4NBH A;  3S1Q I;  3S15 I;  3H0G I;  3G6E Z;  4A3C I;  3IX0 A;  3P5J B;  2NVT I;  3PO3 S;  2K5R A;  2P28 A;  3MON A;  2AKL A;  3G4S Z;  2B63 I;  2JMO A;  3S1M I;  2QRD B;  5D1O A;  2M6N A;  3I55 Z;  3S2H I;  1W2B Z;  2QR1 B;  4NH1 C;  3OW2 Y;  2NVQ I;  3HOV I;  2DE5 A;  4CL1 A;  2V8K A;  3CCV 1;  1TFI A;  4MON A;  3CMA Z;  3CCU 1;  1Z01 A;  5A2Q f;  3HKZ A;  3T4N B;  5IT9 b;  4DQY B;  1Y1W I;  1VQO 1;  3HOW I;  5FLX f;  3S1N I;  4XX2 A;  2DE7 A;  1YI2 Z;  4QTT A;  3PO3 I;  1YIT 1;  4BY7 I;  1Q86 1;  3F3P C;  2F4O A;  3JAM f;  2H85 A;  3CPW Y;  4E2W A;  1K9M 2;  1VQ4 Z;  5FLX b;  3GTM S;  2R6M A;  2KPI A;  2R92 I;  4Y7N I;  3CD6 Z;  3NH5 A;  1Q86 2;  3GTQ I;  1Q7Y 1;  1K8A 2;  4A3K I;  3J80 f;  2I3C A;  3VB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...