2E9HA

Solution structure of the eif-5_eif-2b domain from human eukaryotic translation initiation factor 5
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
157
structure length
157
Chain Sequence
GSSGSSGMSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5
publication title Solution structure of the eIF-5_eIF-2B domain from human Eukaryotic translation initiation factor 5
rcsb
source organism Homo sapiens
total genus 20
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.350 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e9hA02
2G2KA 2E9HA
chains in the Genus database with same CATH superfamily
1Q811 1Y1VS 1Y1WI 2GTHA 1K731 4HGYA 1YI2Z 1Q822 2PMZA 1S7MA 5IT9f 5C44I 2JS4A 2V3VA 4E31A 1VQOZ 3GTKI 2OTJZ 3CXCZ 3EEDA 3M3YI 4E32A 1SFOI 1X3ZA 1Q16A 1VQK1 4XX2A 1P9NA 1ZH1A 1QVFZ 2RBLA 4TNUA 1Q862 1KRLA 4A3CI 2V8JA 5IP7I 1KQSY 2VPYA 1YJ91 3VMHA 5T64A 4AYBA 1VQKZ 4RVGA 1KC81 4MRIA 1WW9A 1VQ41 1YUAA 4NBGA 5FLXf 2V8KA 4E2ZA 1YJ9Z 1Z01A 4A3EI 4A3DI 1VQN1 2JMOA 2R92I 4RS4A 1W2BZ 2JIRA 1VQ4Z 1VQ61 4A3JI 4NOZA 1VQM1 5T6BA 3OW2Z 3NH8A 4HH4A 1YJN1 1AA6A 1VQNZ 5LL6f 3Q87A 3S16I 3NH4A 1I50I 3NDIA 2DE5A 1VQ6Z 3S1MI 1VQMZ 1Y8CA 3S15I 2K5RA 2JA5I 1PFTA 1DL6A 1YJNZ 3CPWZ 4NBHA 4DGLA 3D6WA 3HOVI 3BG0B 1Q7Y2 1K83I 3S1RI 3I07A 5C3EI 3HOYI 2WAQA 1JJ2Y 4A3FI 4E2WA 3S14I 2DE7A 3PO3I 2LFUA 1K8A1 2YU9I 2HF1A 3VTNA 2KI7B 1YHQ1 3I4MI 1M1K2 1L1OC 1Z03A 4Y52I 1QVGZ 2BJOA 2JR6A 2M6NA 3CC41 3CCQ1 2Q4ZA 5FLMI 1YHQZ 5FLXb 3K7AI 2RHBA 3HKZA 2QLVB 4MONA 2QEX1 3KIHA 3CC4Z 3CCQZ 1WCMI 2H85A 2OOXB 3NFZA 3JAMb 1YIJ1 5D1PA 5A2Qf 2KPIA 2JIMA 3RZOI 3GTMS 2O4HA 2QEXZ 3U50C 4QTTA 1M902 3IF8A 1YIJZ 3LUSA 3VMGA 2I3CA 4A3MI 1VQL1 2E2II 3FQQA 3CD61 4E2YA 3IR7A 2OTL1 2EGTA 3CCU1 4RVHA 3VB9A 2NVYI 2RIQA 1RO4A 1VQLZ 3CD6Z 1QVFY 2OTLZ 4BY1I 2E7ZA 1VQ81 3D2LA 1VQP1 3S1NI 3ESWA 4NBAA 3CCUZ 2RPRA 1VQ71 3QWUA 2NVTI 1Q812 1USPA 3GTJI 2R6MA 1VQ8Z 5IP9I 3MZKB 1VQPZ 1RLYA 3F3PC 2QREB 1VQ7Z 2QRCB 2DE6A 4NBFA 2ZAEB 1NJI2 5T67A 3MZLB 4CL1A 3J81f 4A3KI 1SIWA 2VUMI 2IZ4A 2JA8I 5D1OA 3PO2I 2F4OA 3TDHB 4BXXI 1RO0A 3EERA 1Q7Y1 4Y7NI 5A2Qb 1TWHI 1WZNA 1N8R1 1NP6A 1TFIA 3CC71 4NBCA 3CME1 3J80f 1K9M1 2NVQI 5IT9b 1TWCI 2QR1B 1YJW1 3BG1B 4X6AI 1RQFA 1Z02A 3G6E1 2V8IA 3CCV1 3CC7Z 3CMA1 5C4JI 3CMEZ 4NH1C 2V45A 1YJWZ 4A3LI 4EWCA 3CCS1 3G6EZ 3CCVZ 2E2HI 3CMAZ 3H3VJ 2P28A 2K3RA 2G2KA 1I6HI 4NBBA 1KD12 3CCE1 3I4NI 1QVGY 2IV2X 4MD7A 2VF1A 3G4S1 2OOYB 4NBEA 3CCSZ 3G711 3GTMI 1Y1VI 4BBRI 1NUIA 3J7A4 2YADA 3CC21 1Q821 3CCEZ 1M901 3D9XA 3H0GI 2HU9A 3G4SZ 2R7ZI 2W04A 3NDJA 3G71Z 3GTGI 1K8A2 4A3BI 3J81b 3S2DI 3CC2Z 3IX0A 2AYDA 3I551 4BBSI 1FDOA 1ML8A 2VPXA 4E2XA 1Q861 3CXCY 2GTIA 3I55Z 2NVXI 2WB1A 3F3FC 4E33A 1R9TI 4S1TA 1FDIA 3J80b 2LIYA 3S1QI 4A3II 2QRDB 2R93I 1JWHC 1QXFA 2JA6I 3HOWI 4RVFA 1ZB9A 1VQ91 4E30A 1VQ51 3TE5B 3S2HI 5CM2M 3CQZI 3GCFA 1NJI1 1K732 1X0TA 3GTPI 1USPB 3CCJ1 4MD8A 1VQ9Z 1QYPA 4MXUA 1VQ5Z 2J6AA 1RNIA 2M48A 3S17I 1KQSZ 2E9HA 3P5JB 2JIQA 1W2BY 3CCJZ 1I3QI 3FQMA 3OW2Y 1YUKA 2VPZA 1ZB8A 3RZDI 1TWGI 3CCL1 3HOUI 5D1OB 2E2JI 1KC82 5AN9F 2JIOA 2B63I 3JAMf 3GTLI 4A93I 3CCM1 4MD9A 2JUBA 3CPWY 2F4MA 3CCLZ 3GTOI 2Q51A 3IFUA 3I561 2P3YA 2OZKA 2Y0SA 1TWFI 1WJ2A 2VPWA 3M4OI 4MH4A 1M1K1 2LEXA 4RVDA 5C4XI 3CCMZ 1RO2A 3MONA 2JNYA 3VMIA 2O53A 1KD11 1WIIA 1LQLA 2VUGA 3I56Z 1S721 3FKII 2W03A 4RV9A 1VLAA 4DK1A 2AKLA 1JJ2Z 1N8R2 4NBDA 3GKQA 1S72Z 2PM9A 1YIT1 1QF8A 3HOZI 2JA7I 2JIPA 2GU2A 1K9M2 2QA41 4NFRA 1YITZ 4A3GI 3CCR1 3PO3S 4DQYB 2QA4Z 4NB9A 3NH5A 2RT9A 2PK7A 3T4NB 3HOXI 3GTQI 1X3WA 3KIFA 4NB8A 4QTUA 3CCRZ 1YI21 2NAPA 4HGZA 2QKDA 2IZ3A 1N2FA 4BY7I 1TWAI 1VQO1 2OTJ1
chains in the Genus database with same CATH topology
1Q811 1Y1VS 1Y1WI 2GTHA 1K731 4HGYA 1YI2Z 1Q822 2PMZA 1S7MA 5IT9f 5C44I 2JS4A 4E31A 1VQOZ 3GTKI 2OTJZ 3CXCZ 3EEDA 3M3YI 4E32A 1SFOI 1X3ZA 1VQK1 4XX2A 1P9NA 1ZH1A 1QVFZ 2RBLA 4TNUA 1Q862 1KRLA 4A3CI 2V8JA 5IP7I 1KQSY 1YJ91 3VMHA 5T64A 4AYBA 1VQKZ 4RVGA 1KC81 4MRIA 1WW9A 1VQ41 1YUAA 4NBGA 5FLXf 2V8KA 4E2ZA 1YJ9Z 1Z01A 4A3EI 4A3DI 1VQN1 2JMOA 2R92I 4RS4A 1W2BZ 1VQ4Z 1VQ61 4A3JI 4NOZA 1VQM1 5T6BA 3OW2Z 3NH8A 4HH4A 1YJN1 1VQNZ 5LL6f 3Q87A 3S16I 3NH4A 1I50I 3NDIA 2DE5A 1VQ6Z 3S1MI 1VQMZ 3S15I 2K5RA 2JA5I 1PFTA 1DL6A 1YJNZ 3CPWZ 4NBHA 4DGLA 3D6WA 3HOVI 3BG0B 1Q7Y2 1K83I 3S1RI 3I07A 5C3EI 3HOYI 2WAQA 1JJ2Y 4A3FI 4E2WA 3S14I 2DE7A 3PO3I 2LFUA 1K8A1 2YU9I 2HF1A 3VTNA 2KI7B 1YHQ1 3I4MI 1M1K2 1L1OC 1Z03A 4Y52I 1QVGZ 2BJOA 2JR6A 2M6NA 3CC41 3CCQ1 2Q4ZA 5FLMI 1YHQZ 5FLXb 3K7AI 2RHBA 3HKZA 2QLVB 4MONA 2QEX1 3KIHA 3CC4Z 3CCQZ 1WCMI 2H85A 2OOXB 3NFZA 3JAMb 1YIJ1 5D1PA 5A2Qf 2KPIA 3RZOI 3GTMS 2O4HA 2QEXZ 3U50C 4QTTA 1M902 3IF8A 1YIJZ 3LUSA 3VMGA 2I3CA 4A3MI 1VQL1 2E2II 3FQQA 3CD61 4E2YA 2OTL1 2EGTA 3CCU1 4RVHA 3VB9A 2NVYI 2RIQA 1RO4A 1VQLZ 3CD6Z 1QVFY 2OTLZ 4BY1I 1VQ81 1VQP1 3S1NI 3ESWA 4NBAA 3CCUZ 2RPRA 1VQ71 3QWUA 2NVTI 1Q812 1USPA 3GTJI 2R6MA 1VQ8Z 5IP9I 3MZKB 1VQPZ 1RLYA 3F3PC 2QREB 1VQ7Z 2QRCB 2DE6A 4NBFA 2ZAEB 1NJI2 5T67A 3MZLB 4CL1A 3J81f 4A3KI 2VUMI 2IZ4A 2JA8I 5D1OA 3PO2I 2F4OA 3TDHB 4BXXI 1RO0A 3EERA 1Q7Y1 4Y7NI 5A2Qb 1TWHI 1N8R1 1NP6A 1TFIA 3CC71 4NBCA 3CME1 3J80f 1K9M1 2NVQI 5IT9b 1TWCI 2QR1B 1YJW1 3BG1B 4X6AI 1RQFA 1Z02A 3G6E1 2V8IA 3CCV1 3CC7Z 3CMA1 5C4JI 3CMEZ 4NH1C 1YJWZ 4A3LI 4EWCA 3CCS1 3G6EZ 3CCVZ 2E2HI 3CMAZ 3H3VJ 2P28A 2K3RA 2G2KA 1I6HI 4NBBA 1KD12 3CCE1 3I4NI 1QVGY 4MD7A 2VF1A 3G4S1 2OOYB 4NBEA 3CCSZ 3G711 3GTMI 1Y1VI 4BBRI 1NUIA 3J7A4 2YADA 3CC21 1Q821 3CCEZ 1M901 3D9XA 3H0GI 2HU9A 3G4SZ 2R7ZI 2W04A 3NDJA 3G71Z 3GTGI 1K8A2 4A3BI 3J81b 3S2DI 3CC2Z 3IX0A 3I551 4BBSI 1ML8A 4E2XA 1Q861 3CXCY 2GTIA 3I55Z 2NVXI 2WB1A 3F3FC 4E33A 1R9TI 4S1TA 3J80b 2LIYA 3S1QI 4A3II 2QRDB 2R93I 1JWHC 2JA6I 3HOWI 4RVFA 1ZB9A 1VQ91 4E30A 1VQ51 3TE5B 3S2HI 5CM2M 3CQZI 3GCFA 1NJI1 1K732 1X0TA 3GTPI 1USPB 3CCJ1 4MD8A 1VQ9Z 1QYPA 4MXUA 1VQ5Z 2J6AA 1RNIA 2M48A 3S17I 1KQSZ 2E9HA 3P5JB 1W2BY 3CCJZ 1I3QI 3FQMA 3OW2Y 1YUKA 1ZB8A 3RZDI 1TWGI 3CCL1 3HOUI 5D1OB 2E2JI 1KC82 5AN9F 2B63I 3JAMf 3GTLI 4A93I 3CCM1 4MD9A 2JUBA 3CPWY 2F4MA 3CCLZ 3GTOI 2Q51A 3IFUA 3I561 2P3YA 2OZKA 2Y0SA 1TWFI 3M4OI 4MH4A 1M1K1 4RVDA 5C4XI 3CCMZ 1RO2A 3MONA 2JNYA 3VMIA 2O53A 1KD11 1WIIA 1LQLA 2VUGA 3I56Z 1S721 3FKII 2W03A 4RV9A 1VLAA 4DK1A 2AKLA 1JJ2Z 1N8R2 4NBDA 3GKQA 1S72Z 2PM9A 1YIT1 1QF8A 3HOZI 2JA7I 2GU2A 1K9M2 2QA41 4NFRA 1YITZ 4A3GI 3CCR1 3PO3S 4DQYB 2QA4Z 4NB9A 3NH5A 2RT9A 2PK7A 3T4NB 3HOXI 3GTQI 1X3WA 3KIFA 4NB8A 4QTUA 3CCRZ 1YI21 4HGZA 2QKDA 2IZ3A 1N2FA 4BY7I 1TWAI 1VQO1 2OTJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2K A;  2E9H A; 
#chains in the Genus database with same CATH topology
 1Q81 1;  1Y1V S;  1Y1W I;  2GTH A;  1K73 1;  4HGY A;  1YI2 Z;  1Q82 2;  2PMZ A;  1S7M A;  5IT9 f;  5C44 I;  2JS4 A;  2V3V A;  4E31 A;  1VQO Z;  3GTK I;  2OTJ Z;  3CXC Z;  3EED A;  3M3Y I;  4E32 A;  1SFO I;  1X3Z A;  1Q16 A;  1VQK 1;  4XX2 A;  1P9N A;  1ZH1 A;  1QVF Z;  2RBL A;  4TNU A;  1Q86 2;  1KRL A;  4A3C I;  2V8J A;  5IP7 I;  1KQS Y;  2VPY A;  1YJ9 1;  3VMH A;  5T64 A;  4AYB A;  1VQK Z;  4RVG A;  1KC8 1;  4MRI A;  1WW9 A;  1VQ4 1;  1YUA A;  4NBG A;  5FLX f;  2V8K A;  4E2Z A;  1YJ9 Z;  1Z01 A;  4A3E I;  4A3D I;  1VQN 1;  2JMO A;  2R92 I;  4RS4 A;  1W2B Z;  2JIR A;  1VQ4 Z;  1VQ6 1;  4A3J I;  4NOZ A;  1VQM 1;  5T6B A;  3OW2 Z;  3NH8 A;  4HH4 A;  1YJN 1;  1AA6 A;  1VQN Z;  5LL6 f;  3Q87 A;  3S16 I;  3NH4 A;  1I50 I;  3NDI A;  2DE5 A;  1VQ6 Z;  3S1M I;  1VQM Z;  1Y8C A;  3S15 I;  2K5R A;  2JA5 I;  1PFT A;  1DL6 A;  1YJN Z;  3CPW Z;  4NBH A;  4DGL A;  3D6W A;  3HOV I;  3BG0 B;  1Q7Y 2;  1K83 I;  3S1R I;  3I07 A;  5C3E I;  3HOY I;  2WAQ A;  1JJ2 Y;  4A3F I;  4E2W A;  3S14 I;  2DE7 A;  3PO3 I;  2LFU A;  1K8A 1;  2YU9 I;  2HF1 A;  3VTN A;  2KI7 B;  1YHQ 1;  3I4M I;  1M1K 2;  1L1O C;  1Z03 A;  4Y52 I;  1QVG Z;  2BJO A;  2JR6 A;  2M6N A;  3CC4 1;  3CCQ 1;  2Q4Z A;  5FLM I;  1YHQ Z;  5FLX b;  3K7A I;  2RHB A;  3HKZ A;  2QLV B;  4MON A;  2QEX 1;  3KIH A;  3CC4 Z;  3CCQ Z;  1WCM I;  2H85 A;  2OOX B;  3NFZ A;  3JAM b;  1YIJ 1;  5D1P A;  5A2Q f;  2KPI A;  2JIM A;  3RZO I;  3GTM S;  2O4H A;  2QEX Z;  3U50 C;  4QTT A;  1M90 2;  3IF8 A;  1YIJ Z;  3LUS A;  3VMG A;  2I3C A;  4A3M I;  1VQL 1;  2E2I I;  3FQQ A;  3CD6 1;  4E2Y A;  3IR7 A;  2OTL 1;  2EGT A;  3CCU 1;  4RVH A;  3VB9 A;  2NVY I;  2RIQ A;  1RO4 A;  1VQL Z;  3CD6 Z;  1QVF Y;  2OTL Z;  4BY1 I;  2E7Z A;  1VQ8 1;  3D2L A;  1VQP 1;  3S1N I;  3ESW A;  4NBA A;  3CCU Z;  2RPR A;  1VQ7 1;  3QWU A;  2NVT I;  1Q81 2;  1USP A;  3GTJ I;  2R6M A;  1VQ8 Z;  5IP9 I;  3MZK B;  1VQP Z;  1RLY A;  3F3P C;  2QRE B;  1VQ7 Z;  2QRC B;  2DE6 A;  4NBF A;  2ZAE B;  1NJI 2;  5T67 A;  3MZL B;  4CL1 A;  3J81 f;  4A3K I;  1SIW A;  2VUM I;  2IZ4 A;  2JA8 I;  5D1O A;  3PO2 I;  2F4O A;  3TDH B;  4BXX I;  1RO0 A;  3EER A;  1Q7Y 1;  4Y7N I;  5A2Q b;  1TWH I;  1WZN A;  1N8R 1;  1NP6 A;  1TFI A;  3CC7 1;  4NBC A;  3CME 1;  3J80 f;  1K9M 1;  2NVQ I;  5IT9 b;  1TWC I;  2QR1 B;  1YJW 1;  3BG1 B;  4X6A I;  1RQF A;  1Z02 A;  3G6E 1;  2V8I A;  3CCV 1;  3CC7 Z;  3CMA 1;  5C4J I;  3CME Z;  4NH1 C;  2V45 A;  1YJW Z;  4A3L I;  4EWC A;  3CCS 1;  3G6E Z;  3CCV Z;  2E2H I;  3CMA Z;  3H3V J;  2P28 A;  2K3R A;  2G2K A;  1I6H I;  4NBB A;  1KD1 2;  3CCE 1;  3I4N I;  1QVG Y;  2IV2 X;  4MD7 A;  2VF1 A;  3G4S 1;  2OOY B;  4NBE A;  3CCS Z;  3G71 1;  3GTM I;  1Y1V I;  4BBR I;  1NUI A;  3J7A 4;  2YAD A;  3CC2 1;  1Q82 1;  3CCE Z;  1M90 1;  3D9X A;  3H0G I;  2HU9 A;  3G4S Z;  2R7Z I;  2W04 A;  3NDJ A;  3G71 Z;  3GTG I;  1K8A 2;  4A3B I;  3J81 b;  3S2D I;  3CC2 Z;  3IX0 A;  2AYD A;  3I55 1;  4BBS I;  1FDO A;  1ML8 A;  2VPX A;  4E2X A;  1Q86 1;  3CXC Y;  2GTI A;  3I55 Z;  2NVX I;  2WB1 A;  3F3F C;  4E33 A;  1R9T I;  4S1T A;  1FDI A;  3J80 b;  2LIY A;  3S1Q I;  4A3I I;  2QRD B;  2R93 I;  1JWH C;  1QXF A;  2JA6 I;  3HOW I;  4RVF A;  1ZB9 A;  1VQ9 1;  4E30 A;  1VQ5 1;  3TE5 B;  3S2H I;  5CM2 M;  3CQZ I;  3GCF A;  1NJI 1;  1K73 2;  1X0T A;  3GTP I;  1USP B;  3CCJ 1;  4MD8 A;  1VQ9 Z;  1QYP A;  4MXU A;  1VQ5 Z;  2J6A A;  1RNI A;  2M48 A;  3S17 I;  1KQS Z;  2E9H A;  3P5J B;  2JIQ A;  1W2B Y;  3CCJ Z;  1I3Q I;  3FQM A;  3OW2 Y;  1YUK A;  2VPZ A;  1ZB8 A;  3RZD I;  1TWG I;  3CCL 1;  3HOU I;  5D1O B;  2E2J I;  1KC8 2;  5AN9 F;  2JIO A;  2B63 I;  3JAM f;  3GTL I;  4A93 I;  3CCM 1;  4MD9 A;  2JUB A;  3CPW Y;  2F4M A;  3CCL Z;  3GTO I;  2Q51 A;  3IFU A;  3I56 1;  2P3Y A;  2OZK A;  2Y0S A;  1TWF I;  1WJ2 A;  2VPW A;  3M4O I;  4MH4 A;  1M1K 1;  2LEX A;  4RVD A;  5C4X I;  3CCM Z;  1RO2 A;  3MON A;  2JNY A;  3VMI A;  2O53 A;  1KD1 1;  1WII A;  1LQL A;  2VUG A;  3I56 Z;  1S72 1;  3FKI I;  2W03 A;  4RV9 A;  1VLA A;  4DK1 A;  2AKL A;  1JJ2 Z;  1N8R 2;  4NBD A;  3GKQ A;  1S72 Z;  2PM9 A;  1YIT 1;  1QF8 A;  3HOZ I;  2JA7 I;  2JIP A;  2GU2 A;  1K9M 2;  2QA4 1;  4NFR A;  1YIT Z;  4A3G I;  3CCR 1;  3PO3 S;  4DQY B;  2QA4 Z;  4NB9 A;  3NH5 A;  2RT9 A;  2PK7 A;  3T4N B;  3HOX I;  3GTQ I;  1X3W A;  3KIF A;  4NB8 A;  4QTU A;  3CCR Z;  1YI2 1;  2NAP A;  4HGZ A;  2QKD A;  2IZ3 A;  1N2F A;  4BY7 I;  1TWA I;  1VQO 1;  2OTJ 1; 
#chains in the Genus database with same CATH homology
 1Q81 1;  1Y1V S;  1Y1W I;  2GTH A;  1K73 1;  4HGY A;  1YI2 Z;  1Q82 2;  2PMZ A;  1S7M A;  5IT9 f;  5C44 I;  2JS4 A;  4E31 A;  1VQO Z;  3GTK I;  2OTJ Z;  3CXC Z;  3EED A;  3M3Y I;  4E32 A;  1SFO I;  1X3Z A;  1VQK 1;  4XX2 A;  1P9N A;  1ZH1 A;  1QVF Z;  2RBL A;  4TNU A;  1Q86 2;  1KRL A;  4A3C I;  2V8J A;  5IP7 I;  1KQS Y;  1YJ9 1;  3VMH A;  5T64 A;  4AYB A;  1VQK Z;  4RVG A;  1KC8 1;  4MRI A;  1WW9 A;  1VQ4 1;  1YUA A;  4NBG A;  5FLX f;  2V8K A;  4E2Z A;  1YJ9 Z;  1Z01 A;  4A3E I;  4A3D I;  1VQN 1;  2JMO A;  2R92 I;  4RS4 A;  1W2B Z;  1VQ4 Z;  1VQ6 1;  4A3J I;  4NOZ A;  1VQM 1;  5T6B A;  3OW2 Z;  3NH8 A;  4HH4 A;  1YJN 1;  1VQN Z;  5LL6 f;  3Q87 A;  3S16 I;  3NH4 A;  1I50 I;  3NDI A;  2DE5 A;  1VQ6 Z;  3S1M I;  1VQM Z;  3S15 I;  2K5R A;  2JA5 I;  1PFT A;  1DL6 A;  1YJN Z;  3CPW Z;  4NBH A;  4DGL A;  3D6W A;  3HOV I;  3BG0 B;  1Q7Y 2;  1K83 I;  3S1R I;  3I07 A;  5C3E I;  3HOY I;  2WAQ A;  1JJ2 Y;  4A3F I;  4E2W A;  3S14 I;  2DE7 A;  3PO3 I;  2LFU A;  1K8A 1;  2YU9 I;  2HF1 A;  3VTN A;  2KI7 B;  1YHQ 1;  3I4M I;  1M1K 2;  1L1O C;  1Z03 A;  4Y52 I;  1QVG Z;  2BJO A;  2JR6 A;  2M6N A;  3CC4 1;  3CCQ 1;  2Q4Z A;  5FLM I;  1YHQ Z;  5FLX b;  3K7A I;  2RHB A;  3HKZ A;  2QLV B;  4MON A;  2QEX 1;  3KIH A;  3CC4 Z;  3CCQ Z;  1WCM I;  2H85 A;  2OOX B;  3NFZ A;  3JAM b;  1YIJ 1;  5D1P A;  5A2Q f;  2KPI A;  3RZO I;  3GTM S;  2O4H A;  2QEX Z;  3U50 C;  4QTT A;  1M90 2;  3IF8 A;  1YIJ Z;  3LUS A;  3VMG A;  2I3C A;  4A3M I;  1VQL 1;  2E2I I;  3FQQ A;  3CD6 1;  4E2Y A;  2OTL 1;  2EGT A;  3CCU 1;  4RVH A;  3VB9 A;  2NVY I;  2RIQ A;  1RO4 A;  1VQL Z;  3CD6 Z;  1QVF Y;  2OTL Z;  4BY1 I;  1VQ8 1;  1VQP 1;  3S1N I;  3ESW A;  4NBA A;  3CCU Z;  2RPR A;  1VQ7 1;  3QWU A;  2NVT I;  1Q81 2;  1USP A;  3GTJ I;  2R6M A;  1VQ8 Z;  5IP9 I;  3MZK B;  1VQP Z;  1RLY A;  3F3P C;  2QRE B;  1VQ7 Z;  2QRC B;  2DE6 A;  4NBF A;  2ZAE B;  1NJI 2;  5T67 A;  3MZL B;  4CL1 A;  3J81 f;  4A3K I;  2VUM I;  2IZ4 A;  2JA8 I;  5D1O A;  3PO2 I;  2F4O A;  3TDH B;  4BXX I;  1RO0 A;  3EER A;  1Q7Y 1;  4Y7N I;  5A2Q b;  1TWH I;  1N8R 1;  1NP6 A;  1TFI A;  3CC7 1;  4NBC A;  3CME 1;  3J80 f;  1K9M 1;  2NVQ I;  5IT9 b;  1TWC I;  2QR1 B;  1YJW 1;  3BG1 B;  4X6A I;  1RQF A;  1Z02 A;  3G6E 1;  2V8I A;  3CCV 1;  3CC7 Z;  3CMA 1;  5C4J I;  3CME Z;  4NH1 C;  1YJW Z;  4A3L I;  4EWC A;  3CCS 1;  3G6E Z;  3CCV Z;  2E2H I;  3CMA Z;  3H3V J;  2P28 A;  2K3R A;  2G2K A;  1I6H I;  4NBB A;  1KD1 2;  3CCE 1;  3I4N I;  1QVG Y;  4MD7 A;  2VF1 A;  3G4S 1;  2OOY B;  4NBE A;  3CCS Z;  3G71 1;  3GTM I;  1Y1V I;  4BBR I;  1NUI A;  3J7A 4;  2YAD A;  3CC2 1;  1Q82 1;  3CCE Z;  1M90 1;  3D9X A;  3H0G I;  2HU9 A;  3G4S Z;  2R7Z I;  2W04 A;  3NDJ A;  3G71 Z;  3GTG I;  1K8A 2;  4A3B I;  3J81 b;  3S2D I;  3CC2 Z;  3IX0 A;  3I55 1;  4BBS I;  1ML8 A;  4E2X A;  1Q86 1;  3CXC Y;  2GTI A;  3I55 Z;  2NVX I;  2WB1 A;  3F3F C;  4E33 A;  1R9T I;  4S1T A;  3J80 b;  2LIY A;  3S1Q I;  4A3I I;  2QRD B;  2R93 I;  1JWH C;  2JA6 I;  3HOW I;  4RVF A;  1ZB9 A;  1VQ9 1;  4E30 A;  1VQ5 1;  3TE5 B;  3S2H I;  5CM2 M;  3CQZ I;  3GCF A;  1NJI 1;  1K73 2;  1X0T A;  3GTP I;  1USP B;  3CCJ 1;  4MD8 A;  1VQ9 Z;  1QYP A;  4MXU A;  1VQ5 Z;  2J6A A;  1RNI A;  2M48 A;  3S17 I;  1KQS Z;  2E9H A;  3P5J B;  1W2B Y;  3CCJ Z;  1I3Q I;  3FQM A;  3OW2 Y;  1YUK A;  1ZB8 A;  3RZD I;  1TWG I;  3CCL 1;  3HOU I;  5D1O B;  2E2J I;  1KC8 2;  5AN9 F;  2B63 I;  3JAM f;  3GTL I;  4A93 I;  3CCM 1;  4MD9 A;  2JUB A;  3CPW Y;  2F4M A;  3CCL Z;  3GTO I;  2Q51 A;  3IFU A;  3I56 1;  2P3Y A;  2OZK A;  2Y0S A;  1TWF I;  3M4O I;  4MH4 A;  1M1K 1;  4RVD A;  5C4X I;  3CCM Z;  1RO2 A;  3MON A;  2JNY A;  3VMI A;  2O53 A;  1KD1 1;  1WII A;  1LQL A;  2VUG A;  3I56 Z;  1S72 1;  3FKI I;  2W03 A;  4RV9 A;  1VLA A;  4DK1 A;  2AKL A;  1JJ2 Z;  1N8R 2;  4NBD A;  3GKQ A;  1S72 Z;  2PM9 A;  1YIT 1;  1QF8 A;  3HOZ I;  2JA7 I;  2GU2 A;  1K9M 2;  2QA4 1;  4NFR A;  1YIT Z;  4A3G I;  3CCR 1;  3PO3 S;  4DQY B;  2QA4 Z;  4NB9 A;  3NH5 A;  2RT9 A;  2PK7 A;  3T4N B;  3HOX I;  3GTQ I;  1X3W A;  3KIF A;  4NB8 A;  4QTU A;  3CCR Z;  1YI2 1;  4HGZ A;  2QKD A;  2IZ3 A;  1N2F A;  4BY7 I;  1TWA I;  1VQO 1;  2OTJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...