2E9HA

Solution structure of the eif-5_eif-2b domain from human eukaryotic translation initiation factor 5
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
157
structure length
157
Chain Sequence
GSSGSSGMSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 5
publication title Solution structure of the eIF-5_eIF-2B domain from human Eukaryotic translation initiation factor 5
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 20
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.350 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e9hA02
2E9HA 2G2KA
chains in the Genus database with same CATH superfamily
2B63I 5FLXb 2DE5A 2LIYA 1Q7Y1 4RVGA 3NDIA 4NBGA 3GTMS 1YJ9Z 3M3YI 3TDHB 4A3II 2F4MA 5FLXf 3J80f 2JIRA 2AKLA 4NOZA 1K8A1 1M1K1 2F4OA 3CPWY 1VLAA 3GKQA 3S15I 4CL1A 1K83I 2M6NA 2OTL1 3D9XA 3IX0A 4XX2A 3VMHA 4A3KI 4A3LI 1YHQZ 4BBSI 2OZKA 1S721 4HH4A 1K9M2 1W2BY 5A2Qb 1QXFA 2NVQI 2Q51A 2DE6A 1USPB 1VQ7Z 4NBAA 3CCQ1 1VQOZ 4RVHA 3VTNA 5C44I 5A2Qf 1NJI2 3EERA 1I6HI 2LFUA 5D1OA 3GTLI 3HOUI 2WAQA 3Q87A 1Z01A 1VQLZ 3G6E1 3PO3S 1QVFZ 5LL6f 3CMAZ 3KIHA 3GTQI 1WZNA 2PM9A 3NH5A 1Y8CA 1X3ZA 2H85A 1DL6A 2JA6I 3GTPI 3G4S1 3J81f 2NVXI 4A3FI 3S1NI 2JA8I 3F3PC 3CCR1 2O4HA 2RBLA 2JIOA 4AYBA 2OTLZ 1Y1VS 3CCV1 2IZ4A 1TWCI 4A3JI 1M902 2KI7B 2KPIA 1S72Z 5T6BA 3S1QI 3CXCZ 3K7AI 1WJ2A 1TWFI 3RZDI 1VQN1 4MD9A 5C4XI 1YUKA 3VMIA 1VQP1 4NBCA 1K731 4RVFA 1X3WA 1KC81 2HU9A 2E7ZA 2QEX1 4MD7A 5IP9I 4X6AI 1SIWA 2VPZA 3TE5B 3G6EZ 2E2JI 2JNYA 2YADA 1RLYA 2RT9A 3S16I 1RO2A 1Q16A 1RQFA 1QYPA 3G711 3HOYI 4DK1A 4E31A 2BJOA 4DQYB 4NB8A 2I3CA 3S2HI 4EWCA 3G4SZ 1ML8A 2QKDA 3OW2Y 3CCRZ 1VQ41 3GTMI 3CCVZ 3CCU1 2YU9I 1Q7Y2 2R6MA 1KQSZ 2ZAEB 1Q811 2V8IA 1QVGY 1L1OC 1M1K2 2QRCB 4NBHA 4NB9A 1VQ91 1VQPZ 1WIIA 2QLVB 1JJ2Z 1Z02A 1VQ51 2QREB 1VQK1 2QEXZ 3S2DI 4NFRA 2PK7A 1N2FA 2AYDA 5D1PA 4RS4A 2OTJ1 3CME1 4MD8A 2NAPA 2RHBA 5IT9b 2R7ZI 3G71Z 4A3CI 4A3GI 1Q822 1YUAA 3CCM1 3HOZI 3NFZA 5IT9f 4E2ZA 2QA41 2PMZA 3S1RI 1I50I 1VQ4Z 3PO3I 3I551 2JIQA 3GCFA 2IV2X 3CCUZ 2JA5I 1K9M1 1N8R1 4E2WA 2VF1A 2K5RA 3MONA 2O53A 3IFUA 3VB9A 2EGTA 5IP7I 1VQ9Z 1TFIA 1Y1VI 3J7A4 1VQ5Z 1YIT1 4Y7NI 2JR6A 1VQKZ 3I07A 3HOWI 2V45A 3CCS1 4A3BI 2OTJZ 1KRLA 4MONA 2JA7I 1VQM1 4BY1I 5D1OB 1ZB9A 2NVTI 2V8JA 2E2II 3VMGA 4E32A 3H3VJ 1Q861 3M4OI 3CCMZ 4E30A 3CCL1 3CCQZ 1SFOI 2J6AA 3CD61 2QA4Z 1KC82 3I55Z 3FQQA 4E2YA 2VPXA 2VPWA 3CPWZ 3RZOI 2GTIA 2JIMA 3T4NB 4RV9A 3MZLB 2IZ3A 1RO4A 3I4NI 3BG0B 4BBRI 2OOXB 1QVFY 1WCMI 1W2BZ 1FDOA 4QTTA 1YITZ 2JUBA 2V3VA 1KD11 2M48A 3NH4A 3D2LA 1YJW1 2W03A 1YIJ1 4BY7I 3CC71 1NP6A 3CCSZ 1RNIA 5CM2M 4Y52I 2P3YA 2JIPA 1Q812 1VQMZ 3HOXI 5C3EI 3F3FC 1VQNZ 1K8A2 1TWAI 3I561 3CCLZ 1YI21 3CCE1 3QWUA 4A3MI 3CD6Z 5FLMI 2QRDB 2R93I 3CXCY 2P28A 1I3QI 3CC41 2VUGA 3CQZI 1USPA 4MH4A 2K3RA 3J80b 3KIFA 3CMA1 1TWHI 1NUIA 2QR1B 4QTUA 1Y1WI 3JAMb 1VQ61 4NBDA 3GTJI 1VQ81 4A3DI 1PFTA 3HOVI 3JAMf 3PO2I 5AN9F 4NH1C 4NBEA 2JS4A 3NH8A 1TWGI 1YJWZ 1YIJZ 2Q4ZA 3CC7Z 1N8R2 3S17I 3NDJA 1YJN1 1P9NA 1Q821 2NVYI 1QF8A 3I56Z 3GTKI 2RPRA 1YI2Z 1WW9A 2LEXA 3CCEZ 1NJI1 1KQSY 1ZB8A 2GU2A 3GTGI 4DGLA 1RO0A 2Y0SA 3CC4Z 3CC21 4MRIA 3EEDA 2VUMI 1JJ2Y 1AA6A 3OW2Z 4HGYA 3BG1B 3CCJ1 3CMEZ 3J81b 2V8KA 1VQ6Z 1VQ8Z 1Q862 3FQMA 2DE7A 4NBBA 3I4MI 1K732 1QVGZ 5T67A 4A3EI 3S14I 4A93I 4BXXI 5T64A 3IF8A 1M901 2WB1A 3U50C 1X0TA 3ESWA 1LQLA 1YJ91 2E2HI 3FKII 4S1TA 3HKZA 2R92I 1YJNZ 1R9TI 3MZKB 2JMOA 2HF1A 3LUSA 4TNUA 3GTOI 1KD12 3P5JB 2RIQA 1FDIA 2OOYB 3CC2Z 3S1MI 1YHQ1 1ZH1A 3D6WA 4E2XA 4NBFA 4E33A 1Z03A 3IR7A 1S7MA 2G2KA 3CCJZ 1JWHC 4MXUA 1VQ71 2GTHA 1VQO1 4RVDA 2W04A 2VPYA 3H0GI 4HGZA 1VQL1 5C4JI 2E9HA
chains in the Genus database with same CATH topology
2B63I 5FLXb 2DE5A 2LIYA 1Q7Y1 4RVGA 3NDIA 4NBGA 3GTMS 1YJ9Z 3M3YI 3TDHB 4A3II 2F4MA 5FLXf 3J80f 4NOZA 2AKLA 1K8A1 1M1K1 2F4OA 3CPWY 1VLAA 3GKQA 3S15I 4CL1A 1K83I 2M6NA 2OTL1 3D9XA 3IX0A 4XX2A 3VMHA 4A3KI 4A3LI 1YHQZ 4BBSI 2OZKA 1S721 4HH4A 1K9M2 1W2BY 5A2Qb 2NVQI 2Q51A 2DE6A 1USPB 1VQ7Z 4NBAA 3CCQ1 1VQOZ 4RVHA 3VTNA 5C44I 5A2Qf 1NJI2 3EERA 1I6HI 2LFUA 5D1OA 3GTLI 3HOUI 2WAQA 3Q87A 1Z01A 1VQLZ 3G6E1 3PO3S 1QVFZ 5LL6f 3CMAZ 3KIHA 3GTQI 2PM9A 3NH5A 1X3ZA 2H85A 1DL6A 2JA6I 3GTPI 3G4S1 3J81f 2NVXI 4A3FI 3S1NI 2JA8I 3F3PC 3CCR1 2O4HA 2RBLA 4AYBA 2OTLZ 1Y1VS 3CCV1 2IZ4A 1TWCI 4A3JI 1M902 2KI7B 2KPIA 1S72Z 5T6BA 3S1QI 3CXCZ 3K7AI 1TWFI 3RZDI 1VQN1 4MD9A 5C4XI 1YUKA 3VMIA 1VQP1 4NBCA 1K731 4RVFA 1X3WA 1KC81 2HU9A 2QEX1 4MD7A 5IP9I 4X6AI 3TE5B 2E2JI 3G6EZ 2JNYA 2YADA 1RLYA 2RT9A 3S16I 1RO2A 1RQFA 1QYPA 3G711 3HOYI 4DK1A 4E31A 2BJOA 4DQYB 4NB8A 2I3CA 3S2HI 4EWCA 3G4SZ 1ML8A 2QKDA 3OW2Y 3CCRZ 1VQ41 3GTMI 3CCVZ 3CCU1 2YU9I 1Q7Y2 2R6MA 1KQSZ 2ZAEB 1Q811 2V8IA 1QVGY 1L1OC 1M1K2 2QRCB 4NBHA 4NB9A 1VQ91 1VQPZ 1WIIA 2QLVB 1JJ2Z 1Z02A 1VQ51 2QREB 1VQK1 2QEXZ 3S2DI 4NFRA 2PK7A 1N2FA 5D1PA 4RS4A 2OTJ1 3CME1 4MD8A 2RHBA 5IT9b 2R7ZI 3G71Z 4A3CI 4A3GI 1Q822 1YUAA 3CCM1 3HOZI 3NFZA 5IT9f 4E2ZA 2QA41 2PMZA 3S1RI 1I50I 1VQ4Z 3PO3I 3I551 3GCFA 3CCUZ 2JA5I 1K9M1 1N8R1 4E2WA 2VF1A 2K5RA 3MONA 2O53A 3IFUA 3VB9A 2EGTA 5IP7I 1VQ9Z 1TFIA 1Y1VI 3J7A4 1VQ5Z 1YIT1 4Y7NI 2JR6A 1VQKZ 3I07A 3HOWI 3CCS1 4A3BI 2OTJZ 1KRLA 4MONA 2JA7I 1VQM1 4BY1I 5D1OB 1ZB9A 2NVTI 2V8JA 2E2II 3VMGA 4E32A 3H3VJ 1Q861 3M4OI 3CCMZ 4E30A 3CCL1 3CCQZ 1SFOI 2J6AA 3CD61 2QA4Z 1KC82 3I55Z 3FQQA 4E2YA 3CPWZ 3RZOI 2GTIA 3T4NB 4RV9A 3MZLB 2IZ3A 1RO4A 3I4NI 3BG0B 4BBRI 2OOXB 1QVFY 1WCMI 1W2BZ 1YITZ 4QTTA 2JUBA 1KD11 2M48A 3NH4A 1YJW1 2W03A 1YIJ1 4BY7I 3CC71 1NP6A 1RNIA 5CM2M 3CCSZ 4Y52I 2P3YA 1Q812 1VQMZ 3HOXI 5C3EI 3F3FC 1VQNZ 1K8A2 1TWAI 3I561 3CCLZ 1YI21 3CCE1 3QWUA 4A3MI 3CD6Z 5FLMI 2QRDB 2R93I 3CXCY 2P28A 1I3QI 3CC41 2VUGA 3CQZI 1USPA 4MH4A 2K3RA 3J80b 3KIFA 3CMA1 1TWHI 1NUIA 2QR1B 4QTUA 1Y1WI 3JAMb 1VQ61 4NBDA 3GTJI 1VQ81 4A3DI 1PFTA 3HOVI 3JAMf 3PO2I 5AN9F 4NH1C 4NBEA 2JS4A 3NH8A 1TWGI 1YJWZ 1YIJZ 2Q4ZA 3CC7Z 1N8R2 3S17I 3NDJA 1YJN1 1P9NA 1Q821 2NVYI 1QF8A 3I56Z 3GTKI 2RPRA 1YI2Z 1WW9A 3CCEZ 1NJI1 1KQSY 1ZB8A 2GU2A 3GTGI 4DGLA 1RO0A 2Y0SA 3CC4Z 3CC21 4MRIA 3EEDA 2VUMI 1JJ2Y 3OW2Z 4HGYA 3BG1B 3CCJ1 3CMEZ 3J81b 2V8KA 1VQ6Z 1VQ8Z 1Q862 3FQMA 2DE7A 4NBBA 3I4MI 1K732 1QVGZ 5T67A 4A3EI 3S14I 4A93I 4BXXI 5T64A 3IF8A 1M901 2WB1A 3U50C 1X0TA 3ESWA 1LQLA 1YJ91 2E2HI 3FKII 4S1TA 3HKZA 2R92I 1YJNZ 1R9TI 3MZKB 2JMOA 2HF1A 3LUSA 4TNUA 3GTOI 1KD12 3P5JB 2RIQA 2OOYB 3CC2Z 3S1MI 1YHQ1 1ZH1A 3D6WA 4E2XA 4NBFA 4E33A 1Z03A 1S7MA 2G2KA 3CCJZ 1JWHC 4MXUA 1VQ71 2GTHA 1VQO1 4RVDA 2W04A 3H0GI 4HGZA 1VQL1 5C4JI 2E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9H A;  2G2K A; 
#chains in the Genus database with same CATH topology
 2B63 I;  5FLX b;  2DE5 A;  2LIY A;  1Q7Y 1;  4RVG A;  3NDI A;  4NBG A;  3GTM S;  1YJ9 Z;  3M3Y I;  3TDH B;  4A3I I;  2F4M A;  5FLX f;  3J80 f;  2JIR A;  2AKL A;  4NOZ A;  1K8A 1;  1M1K 1;  2F4O A;  3CPW Y;  1VLA A;  3GKQ A;  3S15 I;  4CL1 A;  1K83 I;  2M6N A;  2OTL 1;  3D9X A;  3IX0 A;  4XX2 A;  3VMH A;  4A3K I;  4A3L I;  1YHQ Z;  4BBS I;  2OZK A;  1S72 1;  4HH4 A;  1K9M 2;  1W2B Y;  5A2Q b;  1QXF A;  2NVQ I;  2Q51 A;  2DE6 A;  1USP B;  1VQ7 Z;  4NBA A;  3CCQ 1;  1VQO Z;  4RVH A;  3VTN A;  5C44 I;  5A2Q f;  1NJI 2;  3EER A;  1I6H I;  2LFU A;  5D1O A;  3GTL I;  3HOU I;  2WAQ A;  3Q87 A;  1Z01 A;  1VQL Z;  3G6E 1;  3PO3 S;  1QVF Z;  5LL6 f;  3CMA Z;  3KIH A;  3GTQ I;  1WZN A;  2PM9 A;  3NH5 A;  1Y8C A;  1X3Z A;  2H85 A;  1DL6 A;  2JA6 I;  3GTP I;  3G4S 1;  3J81 f;  2NVX I;  4A3F I;  3S1N I;  2JA8 I;  3F3P C;  3CCR 1;  2O4H A;  2RBL A;  2JIO A;  4AYB A;  2OTL Z;  1Y1V S;  3CCV 1;  2IZ4 A;  1TWC I;  4A3J I;  1M90 2;  2KI7 B;  2KPI A;  1S72 Z;  5T6B A;  3S1Q I;  3CXC Z;  3K7A I;  1WJ2 A;  1TWF I;  3RZD I;  1VQN 1;  4MD9 A;  5C4X I;  1YUK A;  3VMI A;  1VQP 1;  4NBC A;  1K73 1;  4RVF A;  1X3W A;  1KC8 1;  2HU9 A;  2E7Z A;  2QEX 1;  4MD7 A;  5IP9 I;  4X6A I;  1SIW A;  2VPZ A;  3TE5 B;  3G6E Z;  2E2J I;  2JNY A;  2YAD A;  1RLY A;  2RT9 A;  3S16 I;  1RO2 A;  1Q16 A;  1RQF A;  1QYP A;  3G71 1;  3HOY I;  4DK1 A;  4E31 A;  2BJO A;  4DQY B;  4NB8 A;  2I3C A;  3S2H I;  4EWC A;  3G4S Z;  1ML8 A;  2QKD A;  3OW2 Y;  3CCR Z;  1VQ4 1;  3GTM I;  3CCV Z;  3CCU 1;  2YU9 I;  1Q7Y 2;  2R6M A;  1KQS Z;  2ZAE B;  1Q81 1;  2V8I A;  1QVG Y;  1L1O C;  1M1K 2;  2QRC B;  4NBH A;  4NB9 A;  1VQ9 1;  1VQP Z;  1WII A;  2QLV B;  1JJ2 Z;  1Z02 A;  1VQ5 1;  2QRE B;  1VQK 1;  2QEX Z;  3S2D I;  4NFR A;  2PK7 A;  1N2F A;  2AYD A;  5D1P A;  4RS4 A;  2OTJ 1;  3CME 1;  4MD8 A;  2NAP A;  2RHB A;  5IT9 b;  2R7Z I;  3G71 Z;  4A3C I;  4A3G I;  1Q82 2;  1YUA A;  3CCM 1;  3HOZ I;  3NFZ A;  5IT9 f;  4E2Z A;  2QA4 1;  2PMZ A;  3S1R I;  1I50 I;  1VQ4 Z;  3PO3 I;  3I55 1;  2JIQ A;  3GCF A;  2IV2 X;  3CCU Z;  2JA5 I;  1K9M 1;  1N8R 1;  4E2W A;  2VF1 A;  2K5R A;  3MON A;  2O53 A;  3IFU A;  3VB9 A;  2EGT A;  5IP7 I;  1VQ9 Z;  1TFI A;  1Y1V I;  3J7A 4;  1VQ5 Z;  1YIT 1;  4Y7N I;  2JR6 A;  1VQK Z;  3I07 A;  3HOW I;  2V45 A;  3CCS 1;  4A3B I;  2OTJ Z;  1KRL A;  4MON A;  2JA7 I;  1VQM 1;  4BY1 I;  5D1O B;  1ZB9 A;  2NVT I;  2V8J A;  2E2I I;  3VMG A;  4E32 A;  3H3V J;  1Q86 1;  3M4O I;  3CCM Z;  4E30 A;  3CCL 1;  3CCQ Z;  1SFO I;  2J6A A;  3CD6 1;  2QA4 Z;  1KC8 2;  3I55 Z;  3FQQ A;  4E2Y A;  2VPX A;  2VPW A;  3CPW Z;  3RZO I;  2GTI A;  2JIM A;  3T4N B;  4RV9 A;  3MZL B;  2IZ3 A;  1RO4 A;  3I4N I;  3BG0 B;  4BBR I;  2OOX B;  1QVF Y;  1WCM I;  1W2B Z;  1FDO A;  4QTT A;  1YIT Z;  2JUB A;  2V3V A;  1KD1 1;  2M48 A;  3NH4 A;  3D2L A;  1YJW 1;  2W03 A;  1YIJ 1;  4BY7 I;  3CC7 1;  1NP6 A;  3CCS Z;  1RNI A;  5CM2 M;  4Y52 I;  2P3Y A;  2JIP A;  1Q81 2;  1VQM Z;  3HOX I;  5C3E I;  3F3F C;  1VQN Z;  1K8A 2;  1TWA I;  3I56 1;  3CCL Z;  1YI2 1;  3CCE 1;  3QWU A;  4A3M I;  3CD6 Z;  5FLM I;  2QRD B;  2R93 I;  3CXC Y;  2P28 A;  1I3Q I;  3CC4 1;  2VUG A;  3CQZ I;  1USP A;  4MH4 A;  2K3R A;  3J80 b;  3KIF A;  3CMA 1;  1TWH I;  1NUI A;  2QR1 B;  4QTU A;  1Y1W I;  3JAM b;  1VQ6 1;  4NBD A;  3GTJ I;  1VQ8 1;  4A3D I;  1PFT A;  3HOV I;  3JAM f;  3PO2 I;  5AN9 F;  4NH1 C;  4NBE A;  2JS4 A;  3NH8 A;  1TWG I;  1YJW Z;  1YIJ Z;  2Q4Z A;  3CC7 Z;  1N8R 2;  3S17 I;  3NDJ A;  1YJN 1;  1P9N A;  1Q82 1;  2NVY I;  1QF8 A;  3I56 Z;  3GTK I;  2RPR A;  1YI2 Z;  1WW9 A;  2LEX A;  3CCE Z;  1NJI 1;  1KQS Y;  1ZB8 A;  2GU2 A;  3GTG I;  4DGL A;  1RO0 A;  2Y0S A;  3CC4 Z;  3CC2 1;  4MRI A;  3EED A;  2VUM I;  1JJ2 Y;  1AA6 A;  3OW2 Z;  4HGY A;  3BG1 B;  3CCJ 1;  3CME Z;  3J81 b;  2V8K A;  1VQ6 Z;  1VQ8 Z;  1Q86 2;  3FQM A;  2DE7 A;  4NBB A;  3I4M I;  1K73 2;  1QVG Z;  5T67 A;  4A3E I;  3S14 I;  4A93 I;  4BXX I;  5T64 A;  3IF8 A;  1M90 1;  2WB1 A;  3U50 C;  1X0T A;  3ESW A;  1LQL A;  1YJ9 1;  2E2H I;  3FKI I;  4S1T A;  3HKZ A;  2R92 I;  1YJN Z;  1R9T I;  3MZK B;  2JMO A;  2HF1 A;  3LUS A;  4TNU A;  3GTO I;  1KD1 2;  3P5J B;  2RIQ A;  1FDI A;  2OOY B;  3CC2 Z;  3S1M I;  1YHQ 1;  1ZH1 A;  3D6W A;  4E2X A;  4NBF A;  4E33 A;  1Z03 A;  3IR7 A;  1S7M A;  2G2K A;  3CCJ Z;  1JWH C;  4MXU A;  1VQ7 1;  2GTH A;  1VQO 1;  4RVD A;  2W04 A;  2VPY A;  3H0G I;  4HGZ A;  1VQL 1;  5C4J I;  2E9H A; 
#chains in the Genus database with same CATH homology
 2B63 I;  5FLX b;  2DE5 A;  2LIY A;  1Q7Y 1;  4RVG A;  3NDI A;  4NBG A;  3GTM S;  1YJ9 Z;  3M3Y I;  3TDH B;  4A3I I;  2F4M A;  5FLX f;  3J80 f;  4NOZ A;  2AKL A;  1K8A 1;  1M1K 1;  2F4O A;  3CPW Y;  1VLA A;  3GKQ A;  3S15 I;  4CL1 A;  1K83 I;  2M6N A;  2OTL 1;  3D9X A;  3IX0 A;  4XX2 A;  3VMH A;  4A3K I;  4A3L I;  1YHQ Z;  4BBS I;  2OZK A;  1S72 1;  4HH4 A;  1K9M 2;  1W2B Y;  5A2Q b;  2NVQ I;  2Q51 A;  2DE6 A;  1USP B;  1VQ7 Z;  4NBA A;  3CCQ 1;  1VQO Z;  4RVH A;  3VTN A;  5C44 I;  5A2Q f;  1NJI 2;  3EER A;  1I6H I;  2LFU A;  5D1O A;  3GTL I;  3HOU I;  2WAQ A;  3Q87 A;  1Z01 A;  1VQL Z;  3G6E 1;  3PO3 S;  1QVF Z;  5LL6 f;  3CMA Z;  3KIH A;  3GTQ I;  2PM9 A;  3NH5 A;  1X3Z A;  2H85 A;  1DL6 A;  2JA6 I;  3GTP I;  3G4S 1;  3J81 f;  2NVX I;  4A3F I;  3S1N I;  2JA8 I;  3F3P C;  3CCR 1;  2O4H A;  2RBL A;  4AYB A;  2OTL Z;  1Y1V S;  3CCV 1;  2IZ4 A;  1TWC I;  4A3J I;  1M90 2;  2KI7 B;  2KPI A;  1S72 Z;  5T6B A;  3S1Q I;  3CXC Z;  3K7A I;  1TWF I;  3RZD I;  1VQN 1;  4MD9 A;  5C4X I;  1YUK A;  3VMI A;  1VQP 1;  4NBC A;  1K73 1;  4RVF A;  1X3W A;  1KC8 1;  2HU9 A;  2QEX 1;  4MD7 A;  5IP9 I;  4X6A I;  3TE5 B;  2E2J I;  3G6E Z;  2JNY A;  2YAD A;  1RLY A;  2RT9 A;  3S16 I;  1RO2 A;  1RQF A;  1QYP A;  3G71 1;  3HOY I;  4DK1 A;  4E31 A;  2BJO A;  4DQY B;  4NB8 A;  2I3C A;  3S2H I;  4EWC A;  3G4S Z;  1ML8 A;  2QKD A;  3OW2 Y;  3CCR Z;  1VQ4 1;  3GTM I;  3CCV Z;  3CCU 1;  2YU9 I;  1Q7Y 2;  2R6M A;  1KQS Z;  2ZAE B;  1Q81 1;  2V8I A;  1QVG Y;  1L1O C;  1M1K 2;  2QRC B;  4NBH A;  4NB9 A;  1VQ9 1;  1VQP Z;  1WII A;  2QLV B;  1JJ2 Z;  1Z02 A;  1VQ5 1;  2QRE B;  1VQK 1;  2QEX Z;  3S2D I;  4NFR A;  2PK7 A;  1N2F A;  5D1P A;  4RS4 A;  2OTJ 1;  3CME 1;  4MD8 A;  2RHB A;  5IT9 b;  2R7Z I;  3G71 Z;  4A3C I;  4A3G I;  1Q82 2;  1YUA A;  3CCM 1;  3HOZ I;  3NFZ A;  5IT9 f;  4E2Z A;  2QA4 1;  2PMZ A;  3S1R I;  1I50 I;  1VQ4 Z;  3PO3 I;  3I55 1;  3GCF A;  3CCU Z;  2JA5 I;  1K9M 1;  1N8R 1;  4E2W A;  2VF1 A;  2K5R A;  3MON A;  2O53 A;  3IFU A;  3VB9 A;  2EGT A;  5IP7 I;  1VQ9 Z;  1TFI A;  1Y1V I;  3J7A 4;  1VQ5 Z;  1YIT 1;  4Y7N I;  2JR6 A;  1VQK Z;  3I07 A;  3HOW I;  3CCS 1;  4A3B I;  2OTJ Z;  1KRL A;  4MON A;  2JA7 I;  1VQM 1;  4BY1 I;  5D1O B;  1ZB9 A;  2NVT I;  2V8J A;  2E2I I;  3VMG A;  4E32 A;  3H3V J;  1Q86 1;  3M4O I;  3CCM Z;  4E30 A;  3CCL 1;  3CCQ Z;  1SFO I;  2J6A A;  3CD6 1;  2QA4 Z;  1KC8 2;  3I55 Z;  3FQQ A;  4E2Y A;  3CPW Z;  3RZO I;  2GTI A;  3T4N B;  4RV9 A;  3MZL B;  2IZ3 A;  1RO4 A;  3I4N I;  3BG0 B;  4BBR I;  2OOX B;  1QVF Y;  1WCM I;  1W2B Z;  1YIT Z;  4QTT A;  2JUB A;  1KD1 1;  2M48 A;  3NH4 A;  1YJW 1;  2W03 A;  1YIJ 1;  4BY7 I;  3CC7 1;  1NP6 A;  1RNI A;  5CM2 M;  3CCS Z;  4Y52 I;  2P3Y A;  1Q81 2;  1VQM Z;  3HOX I;  5C3E I;  3F3F C;  1VQN Z;  1K8A 2;  1TWA I;  3I56 1;  3CCL Z;  1YI2 1;  3CCE 1;  3QWU A;  4A3M I;  3CD6 Z;  5FLM I;  2QRD B;  2R93 I;  3CXC Y;  2P28 A;  1I3Q I;  3CC4 1;  2VUG A;  3CQZ I;  1USP A;  4MH4 A;  2K3R A;  3J80 b;  3KIF A;  3CMA 1;  1TWH I;  1NUI A;  2QR1 B;  4QTU A;  1Y1W I;  3JAM b;  1VQ6 1;  4NBD A;  3GTJ I;  1VQ8 1;  4A3D I;  1PFT A;  3HOV I;  3JAM f;  3PO2 I;  5AN9 F;  4NH1 C;  4NBE A;  2JS4 A;  3NH8 A;  1TWG I;  1YJW Z;  1YIJ Z;  2Q4Z A;  3CC7 Z;  1N8R 2;  3S17 I;  3NDJ A;  1YJN 1;  1P9N A;  1Q82 1;  2NVY I;  1QF8 A;  3I56 Z;  3GTK I;  2RPR A;  1YI2 Z;  1WW9 A;  3CCE Z;  1NJI 1;  1KQS Y;  1ZB8 A;  2GU2 A;  3GTG I;  4DGL A;  1RO0 A;  2Y0S A;  3CC4 Z;  3CC2 1;  4MRI A;  3EED A;  2VUM I;  1JJ2 Y;  3OW2 Z;  4HGY A;  3BG1 B;  3CCJ 1;  3CME Z;  3J81 b;  2V8K A;  1VQ6 Z;  1VQ8 Z;  1Q86 2;  3FQM A;  2DE7 A;  4NBB A;  3I4M I;  1K73 2;  1QVG Z;  5T67 A;  4A3E I;  3S14 I;  4A93 I;  4BXX I;  5T64 A;  3IF8 A;  1M90 1;  2WB1 A;  3U50 C;  1X0T A;  3ESW A;  1LQL A;  1YJ9 1;  2E2H I;  3FKI I;  4S1T A;  3HKZ A;  2R92 I;  1YJN Z;  1R9T I;  3MZK B;  2JMO A;  2HF1 A;  3LUS A;  4TNU A;  3GTO I;  1KD1 2;  3P5J B;  2RIQ A;  2OOY B;  3CC2 Z;  3S1M I;  1YHQ 1;  1ZH1 A;  3D6W A;  4E2X A;  4NBF A;  4E33 A;  1Z03 A;  1S7M A;  2G2K A;  3CCJ Z;  1JWH C;  4MXU A;  1VQ7 1;  2GTH A;  1VQO 1;  4RVD A;  2W04 A;  3H0G I;  4HGZ A;  1VQL 1;  5C4J I;  2E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...