1QYPA

Thermococcus celer rpb9, nmr, 25 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
GSHMEQDLKTLPTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of an archaeal zinc ribbon defines a general architectural motif in eukaryotic RNA polymerases.
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Transcription
molecule keywords RNA POLYMERASE II
total genus 4
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1997-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qypA00
4BY1I 3GTOI 3S1QI 4NBDA 4A3II 4A3KI 1X3WA 2R93I 4NBGA 4Y52I 1NUIA 3RZOI 2HF1A 2E2II 2F4MA 1I3QI 3S17I 2JA6I 3GTMI 1TWCI 4QTTA 1R9TI 4NB9A 3HOYI 1PFTA 2KPIA 3GCFA 3GTKI 1TWFI 3U50C 3Q87A 3VMIA 2JA8I 3HOUI 3HOVI 4A3BI 1Y1VS 2K5RA 4A3DI 4NBEA 1YUAA 2E2HI 4NB8A 5IP9I 3GTJI 2NVYI 3EERA 1TWHI 4MH4A 3PO2I 3HOWI 1RLYA 5C44I 1K83I 1RO4A 3S16I 2JNYA 3GTLI 3H3VJ 4A3FI 2PK7A 2E2JI 2JA7I 3I07A 3VMHA 1WW9A 2DE6A 4BXXI 2NVQI 1USPA 1N2FA 3M3YI 3M4OI 3S2HI 2B63I 3HOXI 3I4NI 4A3JI 1Y1VI 3RZDI 3D6WA 3PO3I 1LQLA 3GTGI 1ZB9A 1I6HI 3K7AI 5FLMI 5C4JI 4A3GI 3GTQI 1QYPA 1L1OC 2JS4A 3GTPI 1USPB 3H0GI 4X6AI 2J6AA 5IP7I 3S2DI 3S1RI 3ESWA 4XX2A 3I4MI 4Y7NI 4BBSI 2NVTI 4NBCA 2VUMI 2P3YA 4NBBA 1WCMI 1TWGI 5C3EI 3HOZI 3GKQA 2BJOA 1SFOI 4A3EI 4BBRI 2DE5A 3VB9A 4BY7I 1Y1WI 4NBFA 4NOZA 2DE7A 3LUSA 1ML8A 4NBHA 2R92I 1TWAI 4A3CI 1X3ZA 1ZB8A 3CQZI 4A3LI 1DL6A 4NBAA 3S15I 1TFIA 2RBLA 2R7ZI 3S1NI 3PO3S 1VLAA 2NVXI 4A3MI 3FKII 3GTMS 2F4OA 5CM2M 1I50I 2JA5I 3S14I 2JR6A 2YU9I 4A93I 3VMGA 4QTUA 3S1MI 5C4XI 2AKLA
chains in the Genus database with same CATH superfamily
1RO2A 4BY1I 2RT9A 1Y8CA 1X0TA 3TDHB 3CPWY 3MZLB 2G2KA 2E2II 2W03A 2QRDB 1ZH1A 2JIRA 4HH4A 2PM9A 4RVDA 3GTMI 1TWCI 3MONA 1Q7Y1 2KPIA 1K8A2 1VQ8Z 3CXCY 3VMIA 1KQSY 1M902 2JMOA 3HOUI 2OOXB 4A3BI 2K5RA 2V8KA 4A3DI 3J80f 5IP9I 2Q4ZA 2O53A 1VQPZ 1TWHI 4AYBA 3G71Z 1KD11 1RLYA 1RO4A 3S16I 2JIPA 1YUKA 2E2JI 2IZ3A 2QEXZ 1YJWZ 3D2LA 1VQMZ 1YJ91 1QVFZ 4EWCA 1USPA 3HOXI 3CCJZ 1LQLA 3CCLZ 3JAMf 1K731 3CCV1 2EGTA 2IV2X 1WIIA 2QR1B 1Z01A 3GTQI 3GTPI 1M901 1NJI1 3ESWA 1P9NA 4DGLA 3I4MI 4S1TA 1K9M2 1M1K1 4NBCA 2O4HA 4NBBA 1KC81 3TE5B 1WCMI 2GTIA 3I561 1VQ81 1SFOI 1YIT1 4NFRA 4NOZA 3D9XA 2R92I 1FDIA 2E9HA 2RBLA 3S1NI 5D1OA 1RNIA 3G4S1 1YI21 5T64A 2VPWA 2HU9A 4RVHA 5T6BA 3GTMS 1YJNZ 2F4OA 5CM2M 2JA5I 4A93I 5C4XI 3CC4Z 3NH8A 3S1QI 3CCM1 2JIOA 1X3WA 2R93I 1NUIA 1K732 1Q7Y2 3OW2Z 2HF1A 4NH1C 1Z02A 3S17I 2VPZA 3CCEZ 4QTTA 3CCUZ 3CCMZ 1VQ5Z 3GTKI 5T67A 3U50C 2VF1A 3T4NB 3HOVI 3IX0A 1Q862 3J80b 1YUAA 1QVGZ 1N8R2 2JIQA 4NB8A 4MXUA 4E30A 3GTJI 1JWHC 2VPYA 2E7ZA 3EERA 3CME1 3BG0B 1VQ51 3HOWI 5C44I 1K83I 5A2Qf 4A3FI 1Z03A 1VQP1 2LIYA 2DE6A 1YJ9Z 3J81f 2OOYB 3S2HI 3M4OI 1YHQ1 2B63I 3G6E1 3D6WA 3PO3I 3CD61 3QWUA 1ZB9A 3K7AI 5FLMI 5C4JI 4A3GI 3KIFA 1S72Z 2JS4A 1YHQZ 1YIJ1 5IP7I 4XX2A 5IT9b 2P3YA 3I551 2YADA 2BJOA 1VQ41 1VQ7Z 1YIJZ 2ZAEB 3LUSA 3CMEZ 5LL6f 1DL6A 1X3ZA 1ZB8A 4A3LI 1SIWA 1TFIA 3FQQA 1VLAA 1QF8A 1VQNZ 3FKII 2JIMA 4E32A 1I50I 2JR6A 2QRCB 1VQO1 3VMGA 3CCL1 4BBRI 2QA4Z 2Y0SA 4NBDA 4A3II 3G6EZ 3CCS1 4E2XA 4NBGA 4Y52I 3CCQZ 1VQ9Z 3CC21 1VQ61 3HKZA 2OTJ1 3RZOI 2K3RA 2QKDA 2F4MA 1I3QI 2KI7B 2JA6I 3NFZA 3NH4A 3OW2Y 1RQFA 1PFTA 2H85A 5IT9f 3CXCZ 1KQSZ 2JA8I 4HGZA 5AN9F 3CMAZ 3G4SZ 1YI2Z 3EEDA 1AA6A 2LFUA 2NVYI 3CC41 4MH4A 4RVGA 2RPRA 2JNYA 2AYDA 3H3VJ 2Q51A 2PK7A 2VPXA 2IZ4A 4RS4A 3G711 3I07A 1WW9A 3J81b 1Q811 4BXXI 2OTJZ 3F3PC 2WB1A 3CC2Z 1N2FA 1VQL1 3CCRZ 4MONA 3RZDI 1Y1VI 2M48A 2QREB 3GTGI 3J7A4 3JAMb 1I6HI 4TNUA 4E33A 3NH5A 1KRLA 1QYPA 2NAPA 1L1OC 1USPB 2VUGA 5FLXf 2J6AA 4Y7NI 2VUMI 2M6NA 1TWGI 3FQMA 4A3EI 1W2BY 2W04A 2DE5A 1S721 1NP6A 5FLXb 4DQYB 2DE7A 1QVFY 2R6MA 3P5JB 4NBHA 3CPWZ 2RHBA 2V8JA 3CQZI 1Q822 3VTNA 1WZNA 3CCJ1 4A3MI 4MD7A 4RVFA 1FDOA 3S14I 2OTLZ 1KD12 4QTUA 3CD6Z 3S1RI 5D1OB 3GTOI 4A3KI 2OZKA 3CCR1 2GU2A 1NJI2 2PMZA 3CCE1 3I55Z 1VQ91 1VQ6Z 4E2YA 3CCSZ 1JJ2Z 3BG1B 4MD8A 1VQKZ 1R9TI 3NDIA 4NB9A 1Q821 3HOYI 3KIHA 1N8R1 1RO0A 2V8IA 3GCFA 3IF8A 5D1PA 1TWFI 2JUBA 2P28A 4MD9A 3Q87A 4DK1A 4E2ZA 1YJN1 1Y1VS 2WAQA 4NBEA 2E2HI 1VQN1 4CL1A 3I56Z 1VQM1 3CC71 4HGYA 3PO2I 2QEX1 1QXFA 3NDJA 1KC82 3GTLI 1M1K2 2JA7I 1VQ71 3VMHA 2OTL1 2QLVB 3CCVZ 2NVQI 4E2WA 4MRIA 3M3YI 1K8A1 1S7MA 1WJ2A 3I4NI 4A3JI 1Q812 3MZKB 3IFUA 4RV9A 3IR7A 2V45A 1VQK1 3H0GI 4X6AI 3S2DI 1YITZ 2I3CA 1VQ4Z 4BBSI 2NVTI 2RIQA 1W2BZ 5C3EI 3HOZI 3GKQA 3CCQ1 3CMA1 5A2Qb 1JJ2Y 3VB9A 4BY7I 1Y1WI 3CCU1 1K9M1 1Q16A 4NBFA 1QVGY 1ML8A 1TWAI 4A3CI 3CC7Z 4E31A 4NBAA 2GTHA 3S15I 2R7ZI 3PO3S 2V3VA 1VQLZ 2NVXI 3F3FC 2QA41 2LEXA 1VQOZ 1YJW1 2YU9I 3S1MI 1Q861 2AKLA
chains in the Genus database with same CATH topology
1RO2A 4BY1I 2RT9A 1X0TA 3TDHB 3CPWY 3MZLB 2G2KA 2E2II 2W03A 2QRDB 1ZH1A 4HH4A 2PM9A 4RVDA 3GTMI 1TWCI 3MONA 1Q7Y1 2KPIA 1K8A2 1VQ8Z 3CXCY 3VMIA 1KQSY 1M902 2JMOA 3HOUI 2OOXB 4A3BI 2K5RA 2V8KA 4A3DI 3J80f 5IP9I 2Q4ZA 2O53A 1VQPZ 1TWHI 4AYBA 3G71Z 1KD11 1RLYA 1RO4A 3S16I 1YUKA 2E2JI 2IZ3A 2QEXZ 1YJWZ 1YJ91 1VQMZ 1QVFZ 4EWCA 1USPA 3HOXI 3CCJZ 1LQLA 3CCLZ 3JAMf 1K731 3CCV1 2EGTA 1WIIA 2QR1B 1Z01A 3GTQI 3GTPI 1M901 1NJI1 3ESWA 1P9NA 4DGLA 3I4MI 4S1TA 1K9M2 1M1K1 4NBCA 2O4HA 1KC81 4NBBA 3TE5B 1WCMI 2GTIA 3I561 1VQ81 1SFOI 1YIT1 4NFRA 4NOZA 3D9XA 2R92I 2E9HA 2RBLA 3S1NI 5D1OA 1RNIA 3G4S1 1YI21 5T64A 2HU9A 4RVHA 5T6BA 3GTMS 1YJNZ 2F4OA 5CM2M 2JA5I 4A93I 5C4XI 3CC4Z 3NH8A 3S1QI 3CCM1 1X3WA 2R93I 1NUIA 1K732 1Q7Y2 3OW2Z 2HF1A 4NH1C 1Z02A 3S17I 3CCEZ 4QTTA 3CCUZ 3CCMZ 1VQ5Z 3GTKI 5T67A 3U50C 2VF1A 3T4NB 3HOVI 3IX0A 1Q862 3J80b 1YUAA 1QVGZ 1N8R2 4NB8A 4MXUA 4E30A 3GTJI 1JWHC 3EERA 3CME1 3BG0B 1VQ51 3HOWI 5C44I 1K83I 5A2Qf 4A3FI 1Z03A 1VQP1 2LIYA 2DE6A 1YJ9Z 3J81f 2OOYB 3S2HI 3M4OI 1YHQ1 2B63I 3G6E1 3D6WA 3PO3I 3CD61 3QWUA 1ZB9A 3K7AI 5FLMI 5C4JI 4A3GI 3KIFA 1S72Z 2JS4A 1YHQZ 1YIJ1 5IP7I 4XX2A 5IT9b 2P3YA 3I551 2YADA 2BJOA 1VQ41 1VQ7Z 1YIJZ 2ZAEB 3LUSA 3CMEZ 5LL6f 1DL6A 1X3ZA 1ZB8A 4A3LI 1TFIA 3FQQA 1VLAA 1QF8A 1VQNZ 3FKII 4E32A 1I50I 2JR6A 2QRCB 1VQO1 3VMGA 3CCL1 4BBRI 2QA4Z 2Y0SA 4NBDA 4A3II 3G6EZ 3CCS1 4E2XA 4NBGA 4Y52I 3CCQZ 1VQ9Z 3CC21 1VQ61 3HKZA 2OTJ1 3RZOI 2K3RA 2QKDA 2F4MA 1I3QI 2KI7B 2JA6I 3NFZA 3NH4A 3OW2Y 1RQFA 1PFTA 2H85A 5IT9f 3CXCZ 1KQSZ 2JA8I 4HGZA 5AN9F 3CMAZ 3G4SZ 1YI2Z 3EEDA 2LFUA 2NVYI 3CC41 4MH4A 4RVGA 2RPRA 2JNYA 3H3VJ 2Q51A 2PK7A 2IZ4A 4RS4A 3G711 3I07A 1WW9A 3J81b 1Q811 4BXXI 2OTJZ 3F3PC 2WB1A 3CC2Z 1N2FA 1VQL1 3CCRZ 4MONA 3RZDI 1Y1VI 2M48A 2QREB 3GTGI 3J7A4 3JAMb 1I6HI 4TNUA 4E33A 3NH5A 1KRLA 1QYPA 1L1OC 1USPB 2VUGA 5FLXf 2J6AA 4Y7NI 2VUMI 2M6NA 1TWGI 3FQMA 4A3EI 1W2BY 2W04A 2DE5A 1S721 1NP6A 5FLXb 4DQYB 2DE7A 1QVFY 2R6MA 3P5JB 4NBHA 3CPWZ 2RHBA 2V8JA 3CQZI 1Q822 3VTNA 3CCJ1 4A3MI 4MD7A 4RVFA 3S14I 2OTLZ 1KD12 4QTUA 3CD6Z 3S1RI 5D1OB 3GTOI 4A3KI 2OZKA 3CCR1 2GU2A 1NJI2 2PMZA 3CCE1 3I55Z 1VQ91 1VQ6Z 4E2YA 3CCSZ 1JJ2Z 3BG1B 4MD8A 1VQKZ 1R9TI 3NDIA 4NB9A 1Q821 3HOYI 3KIHA 1N8R1 1RO0A 2V8IA 3GCFA 3IF8A 5D1PA 1TWFI 2JUBA 2P28A 4MD9A 3Q87A 4DK1A 4E2ZA 1YJN1 1Y1VS 2WAQA 4NBEA 2E2HI 1VQN1 4CL1A 3I56Z 1VQM1 3CC71 4HGYA 3PO2I 2QEX1 3NDJA 1KC82 3GTLI 1M1K2 2JA7I 1VQ71 3VMHA 2OTL1 2QLVB 3CCVZ 2NVQI 4E2WA 4MRIA 3M3YI 1K8A1 1S7MA 3I4NI 4A3JI 1Q812 3MZKB 3IFUA 4RV9A 1VQK1 3H0GI 4X6AI 3S2DI 1YITZ 2I3CA 1VQ4Z 4BBSI 2NVTI 2RIQA 1W2BZ 5C3EI 3HOZI 3GKQA 3CCQ1 3CMA1 5A2Qb 1JJ2Y 3VB9A 4BY7I 1Y1WI 3CCU1 1K9M1 4NBFA 1QVGY 1ML8A 1TWAI 4A3CI 3CC7Z 4E31A 4NBAA 2GTHA 3S15I 2R7ZI 3PO3S 1VQLZ 2NVXI 3F3FC 2QA41 1VQOZ 1YJW1 2YU9I 3S1MI 1Q861 2AKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 I;  3GTO I;  3S1Q I;  4NBD A;  4A3I I;  4A3K I;  1X3W A;  2R93 I;  4NBG A;  4Y52 I;  1NUI A;  3RZO I;  2HF1 A;  2E2I I;  2F4M A;  1I3Q I;  3S17 I;  2JA6 I;  3GTM I;  1TWC I;  4QTT A;  1R9T I;  4NB9 A;  3HOY I;  1PFT A;  2KPI A;  3GCF A;  3GTK I;  1TWF I;  3U50 C;  3Q87 A;  3VMI A;  2JA8 I;  3HOU I;  3HOV I;  4A3B I;  1Y1V S;  2K5R A;  4A3D I;  4NBE A;  1YUA A;  2E2H I;  4NB8 A;  5IP9 I;  3GTJ I;  2NVY I;  3EER A;  1TWH I;  4MH4 A;  3PO2 I;  3HOW I;  1RLY A;  5C44 I;  1K83 I;  1RO4 A;  3S16 I;  2JNY A;  3GTL I;  3H3V J;  4A3F I;  2PK7 A;  2E2J I;  2JA7 I;  3I07 A;  3VMH A;  1WW9 A;  2DE6 A;  4BXX I;  2NVQ I;  1USP A;  1N2F A;  3M3Y I;  3M4O I;  3S2H I;  2B63 I;  3HOX I;  3I4N I;  4A3J I;  1Y1V I;  3RZD I;  3D6W A;  3PO3 I;  1LQL A;  3GTG I;  1ZB9 A;  1I6H I;  3K7A I;  5FLM I;  5C4J I;  4A3G I;  3GTQ I;  1QYP A;  1L1O C;  2JS4 A;  3GTP I;  1USP B;  3H0G I;  4X6A I;  2J6A A;  5IP7 I;  3S2D I;  3S1R I;  3ESW A;  4XX2 A;  3I4M I;  4Y7N I;  4BBS I;  2NVT I;  4NBC A;  2VUM I;  2P3Y A;  4NBB A;  1WCM I;  1TWG I;  5C3E I;  3HOZ I;  3GKQ A;  2BJO A;  1SFO I;  4A3E I;  4BBR I;  2DE5 A;  3VB9 A;  4BY7 I;  1Y1W I;  4NBF A;  4NOZ A;  2DE7 A;  3LUS A;  1ML8 A;  4NBH A;  2R92 I;  1TWA I;  4A3C I;  1X3Z A;  1ZB8 A;  3CQZ I;  4A3L I;  1DL6 A;  4NBA A;  3S15 I;  1TFI A;  2RBL A;  2R7Z I;  3S1N I;  3PO3 S;  1VLA A;  2NVX I;  4A3M I;  3FKI I;  3GTM S;  2F4O A;  5CM2 M;  1I50 I;  2JA5 I;  3S14 I;  2JR6 A;  2YU9 I;  4A93 I;  3VMG A;  4QTU A;  3S1M I;  5C4X I;  2AKL A; 
#chains in the Genus database with same CATH topology
 1RO2 A;  4BY1 I;  2RT9 A;  1Y8C A;  1X0T A;  3TDH B;  3CPW Y;  3MZL B;  2G2K A;  2E2I I;  2W03 A;  2QRD B;  1ZH1 A;  2JIR A;  4HH4 A;  2PM9 A;  4RVD A;  3GTM I;  1TWC I;  3MON A;  1Q7Y 1;  2KPI A;  1K8A 2;  1VQ8 Z;  3CXC Y;  3VMI A;  1KQS Y;  1M90 2;  2JMO A;  3HOU I;  2OOX B;  4A3B I;  2K5R A;  2V8K A;  4A3D I;  3J80 f;  5IP9 I;  2Q4Z A;  2O53 A;  1VQP Z;  1TWH I;  4AYB A;  3G71 Z;  1KD1 1;  1RLY A;  1RO4 A;  3S16 I;  2JIP A;  1YUK A;  2E2J I;  2IZ3 A;  2QEX Z;  1YJW Z;  3D2L A;  1VQM Z;  1YJ9 1;  1QVF Z;  4EWC A;  1USP A;  3HOX I;  3CCJ Z;  1LQL A;  3CCL Z;  3JAM f;  1K73 1;  3CCV 1;  2EGT A;  2IV2 X;  1WII A;  2QR1 B;  1Z01 A;  3GTQ I;  3GTP I;  1M90 1;  1NJI 1;  3ESW A;  1P9N A;  4DGL A;  3I4M I;  4S1T A;  1K9M 2;  1M1K 1;  4NBC A;  2O4H A;  4NBB A;  1KC8 1;  3TE5 B;  1WCM I;  2GTI A;  3I56 1;  1VQ8 1;  1SFO I;  1YIT 1;  4NFR A;  4NOZ A;  3D9X A;  2R92 I;  1FDI A;  2E9H A;  2RBL A;  3S1N I;  5D1O A;  1RNI A;  3G4S 1;  1YI2 1;  5T64 A;  2VPW A;  2HU9 A;  4RVH A;  5T6B A;  3GTM S;  1YJN Z;  2F4O A;  5CM2 M;  2JA5 I;  4A93 I;  5C4X I;  3CC4 Z;  3NH8 A;  3S1Q I;  3CCM 1;  2JIO A;  1X3W A;  2R93 I;  1NUI A;  1K73 2;  1Q7Y 2;  3OW2 Z;  2HF1 A;  4NH1 C;  1Z02 A;  3S17 I;  2VPZ A;  3CCE Z;  4QTT A;  3CCU Z;  3CCM Z;  1VQ5 Z;  3GTK I;  5T67 A;  3U50 C;  2VF1 A;  3T4N B;  3HOV I;  3IX0 A;  1Q86 2;  3J80 b;  1YUA A;  1QVG Z;  1N8R 2;  2JIQ A;  4NB8 A;  4MXU A;  4E30 A;  3GTJ I;  1JWH C;  2VPY A;  2E7Z A;  3EER A;  3CME 1;  3BG0 B;  1VQ5 1;  3HOW I;  5C44 I;  1K83 I;  5A2Q f;  4A3F I;  1Z03 A;  1VQP 1;  2LIY A;  2DE6 A;  1YJ9 Z;  3J81 f;  2OOY B;  3S2H I;  3M4O I;  1YHQ 1;  2B63 I;  3G6E 1;  3D6W A;  3PO3 I;  3CD6 1;  3QWU A;  1ZB9 A;  3K7A I;  5FLM I;  5C4J I;  4A3G I;  3KIF A;  1S72 Z;  2JS4 A;  1YHQ Z;  1YIJ 1;  5IP7 I;  4XX2 A;  5IT9 b;  2P3Y A;  3I55 1;  2YAD A;  2BJO A;  1VQ4 1;  1VQ7 Z;  1YIJ Z;  2ZAE B;  3LUS A;  3CME Z;  5LL6 f;  1DL6 A;  1X3Z A;  1ZB8 A;  4A3L I;  1SIW A;  1TFI A;  3FQQ A;  1VLA A;  1QF8 A;  1VQN Z;  3FKI I;  2JIM A;  4E32 A;  1I50 I;  2JR6 A;  2QRC B;  1VQO 1;  3VMG A;  3CCL 1;  4BBR I;  2QA4 Z;  2Y0S A;  4NBD A;  4A3I I;  3G6E Z;  3CCS 1;  4E2X A;  4NBG A;  4Y52 I;  3CCQ Z;  1VQ9 Z;  3CC2 1;  1VQ6 1;  3HKZ A;  2OTJ 1;  3RZO I;  2K3R A;  2QKD A;  2F4M A;  1I3Q I;  2KI7 B;  2JA6 I;  3NFZ A;  3NH4 A;  3OW2 Y;  1RQF A;  1PFT A;  2H85 A;  5IT9 f;  3CXC Z;  1KQS Z;  2JA8 I;  4HGZ A;  5AN9 F;  3CMA Z;  3G4S Z;  1YI2 Z;  3EED A;  1AA6 A;  2LFU A;  2NVY I;  3CC4 1;  4MH4 A;  4RVG A;  2RPR A;  2JNY A;  2AYD A;  3H3V J;  2Q51 A;  2PK7 A;  2VPX A;  2IZ4 A;  4RS4 A;  3G71 1;  3I07 A;  1WW9 A;  3J81 b;  1Q81 1;  4BXX I;  2OTJ Z;  3F3P C;  2WB1 A;  3CC2 Z;  1N2F A;  1VQL 1;  3CCR Z;  4MON A;  3RZD I;  1Y1V I;  2M48 A;  2QRE B;  3GTG I;  3J7A 4;  3JAM b;  1I6H I;  4TNU A;  4E33 A;  3NH5 A;  1KRL A;  1QYP A;  2NAP A;  1L1O C;  1USP B;  2VUG A;  5FLX f;  2J6A A;  4Y7N I;  2VUM I;  2M6N A;  1TWG I;  3FQM A;  4A3E I;  1W2B Y;  2W04 A;  2DE5 A;  1S72 1;  1NP6 A;  5FLX b;  4DQY B;  2DE7 A;  1QVF Y;  2R6M A;  3P5J B;  4NBH A;  3CPW Z;  2RHB A;  2V8J A;  3CQZ I;  1Q82 2;  3VTN A;  1WZN A;  3CCJ 1;  4A3M I;  4MD7 A;  4RVF A;  1FDO A;  3S14 I;  2OTL Z;  1KD1 2;  4QTU A;  3CD6 Z;  3S1R I;  5D1O B;  3GTO I;  4A3K I;  2OZK A;  3CCR 1;  2GU2 A;  1NJI 2;  2PMZ A;  3CCE 1;  3I55 Z;  1VQ9 1;  1VQ6 Z;  4E2Y A;  3CCS Z;  1JJ2 Z;  3BG1 B;  4MD8 A;  1VQK Z;  1R9T I;  3NDI A;  4NB9 A;  1Q82 1;  3HOY I;  3KIH A;  1N8R 1;  1RO0 A;  2V8I A;  3GCF A;  3IF8 A;  5D1P A;  1TWF I;  2JUB A;  2P28 A;  4MD9 A;  3Q87 A;  4DK1 A;  4E2Z A;  1YJN 1;  1Y1V S;  2WAQ A;  4NBE A;  2E2H I;  1VQN 1;  4CL1 A;  3I56 Z;  1VQM 1;  3CC7 1;  4HGY A;  3PO2 I;  2QEX 1;  1QXF A;  3NDJ A;  1KC8 2;  3GTL I;  1M1K 2;  2JA7 I;  1VQ7 1;  3VMH A;  2OTL 1;  2QLV B;  3CCV Z;  2NVQ I;  4E2W A;  4MRI A;  3M3Y I;  1K8A 1;  1S7M A;  1WJ2 A;  3I4N I;  4A3J I;  1Q81 2;  3MZK B;  3IFU A;  4RV9 A;  3IR7 A;  2V45 A;  1VQK 1;  3H0G I;  4X6A I;  3S2D I;  1YIT Z;  2I3C A;  1VQ4 Z;  4BBS I;  2NVT I;  2RIQ A;  1W2B Z;  5C3E I;  3HOZ I;  3GKQ A;  3CCQ 1;  3CMA 1;  5A2Q b;  1JJ2 Y;  3VB9 A;  4BY7 I;  1Y1W I;  3CCU 1;  1K9M 1;  1Q16 A;  4NBF A;  1QVG Y;  1ML8 A;  1TWA I;  4A3C I;  3CC7 Z;  4E31 A;  4NBA A;  2GTH A;  3S15 I;  2R7Z I;  3PO3 S;  2V3V A;  1VQL Z;  2NVX I;  3F3F C;  2QA4 1;  2LEX A;  1VQO Z;  1YJW 1;  2YU9 I;  3S1M I;  1Q86 1;  2AKL A; 
#chains in the Genus database with same CATH homology
 1RO2 A;  4BY1 I;  2RT9 A;  1X0T A;  3TDH B;  3CPW Y;  3MZL B;  2G2K A;  2E2I I;  2W03 A;  2QRD B;  1ZH1 A;  4HH4 A;  2PM9 A;  4RVD A;  3GTM I;  1TWC I;  3MON A;  1Q7Y 1;  2KPI A;  1K8A 2;  1VQ8 Z;  3CXC Y;  3VMI A;  1KQS Y;  1M90 2;  2JMO A;  3HOU I;  2OOX B;  4A3B I;  2K5R A;  2V8K A;  4A3D I;  3J80 f;  5IP9 I;  2Q4Z A;  2O53 A;  1VQP Z;  1TWH I;  4AYB A;  3G71 Z;  1KD1 1;  1RLY A;  1RO4 A;  3S16 I;  1YUK A;  2E2J I;  2IZ3 A;  2QEX Z;  1YJW Z;  1YJ9 1;  1VQM Z;  1QVF Z;  4EWC A;  1USP A;  3HOX I;  3CCJ Z;  1LQL A;  3CCL Z;  3JAM f;  1K73 1;  3CCV 1;  2EGT A;  1WII A;  2QR1 B;  1Z01 A;  3GTQ I;  3GTP I;  1M90 1;  1NJI 1;  3ESW A;  1P9N A;  4DGL A;  3I4M I;  4S1T A;  1K9M 2;  1M1K 1;  4NBC A;  2O4H A;  1KC8 1;  4NBB A;  3TE5 B;  1WCM I;  2GTI A;  3I56 1;  1VQ8 1;  1SFO I;  1YIT 1;  4NFR A;  4NOZ A;  3D9X A;  2R92 I;  2E9H A;  2RBL A;  3S1N I;  5D1O A;  1RNI A;  3G4S 1;  1YI2 1;  5T64 A;  2HU9 A;  4RVH A;  5T6B A;  3GTM S;  1YJN Z;  2F4O A;  5CM2 M;  2JA5 I;  4A93 I;  5C4X I;  3CC4 Z;  3NH8 A;  3S1Q I;  3CCM 1;  1X3W A;  2R93 I;  1NUI A;  1K73 2;  1Q7Y 2;  3OW2 Z;  2HF1 A;  4NH1 C;  1Z02 A;  3S17 I;  3CCE Z;  4QTT A;  3CCU Z;  3CCM Z;  1VQ5 Z;  3GTK I;  5T67 A;  3U50 C;  2VF1 A;  3T4N B;  3HOV I;  3IX0 A;  1Q86 2;  3J80 b;  1YUA A;  1QVG Z;  1N8R 2;  4NB8 A;  4MXU A;  4E30 A;  3GTJ I;  1JWH C;  3EER A;  3CME 1;  3BG0 B;  1VQ5 1;  3HOW I;  5C44 I;  1K83 I;  5A2Q f;  4A3F I;  1Z03 A;  1VQP 1;  2LIY A;  2DE6 A;  1YJ9 Z;  3J81 f;  2OOY B;  3S2H I;  3M4O I;  1YHQ 1;  2B63 I;  3G6E 1;  3D6W A;  3PO3 I;  3CD6 1;  3QWU A;  1ZB9 A;  3K7A I;  5FLM I;  5C4J I;  4A3G I;  3KIF A;  1S72 Z;  2JS4 A;  1YHQ Z;  1YIJ 1;  5IP7 I;  4XX2 A;  5IT9 b;  2P3Y A;  3I55 1;  2YAD A;  2BJO A;  1VQ4 1;  1VQ7 Z;  1YIJ Z;  2ZAE B;  3LUS A;  3CME Z;  5LL6 f;  1DL6 A;  1X3Z A;  1ZB8 A;  4A3L I;  1TFI A;  3FQQ A;  1VLA A;  1QF8 A;  1VQN Z;  3FKI I;  4E32 A;  1I50 I;  2JR6 A;  2QRC B;  1VQO 1;  3VMG A;  3CCL 1;  4BBR I;  2QA4 Z;  2Y0S A;  4NBD A;  4A3I I;  3G6E Z;  3CCS 1;  4E2X A;  4NBG A;  4Y52 I;  3CCQ Z;  1VQ9 Z;  3CC2 1;  1VQ6 1;  3HKZ A;  2OTJ 1;  3RZO I;  2K3R A;  2QKD A;  2F4M A;  1I3Q I;  2KI7 B;  2JA6 I;  3NFZ A;  3NH4 A;  3OW2 Y;  1RQF A;  1PFT A;  2H85 A;  5IT9 f;  3CXC Z;  1KQS Z;  2JA8 I;  4HGZ A;  5AN9 F;  3CMA Z;  3G4S Z;  1YI2 Z;  3EED A;  2LFU A;  2NVY I;  3CC4 1;  4MH4 A;  4RVG A;  2RPR A;  2JNY A;  3H3V J;  2Q51 A;  2PK7 A;  2IZ4 A;  4RS4 A;  3G71 1;  3I07 A;  1WW9 A;  3J81 b;  1Q81 1;  4BXX I;  2OTJ Z;  3F3P C;  2WB1 A;  3CC2 Z;  1N2F A;  1VQL 1;  3CCR Z;  4MON A;  3RZD I;  1Y1V I;  2M48 A;  2QRE B;  3GTG I;  3J7A 4;  3JAM b;  1I6H I;  4TNU A;  4E33 A;  3NH5 A;  1KRL A;  1QYP A;  1L1O C;  1USP B;  2VUG A;  5FLX f;  2J6A A;  4Y7N I;  2VUM I;  2M6N A;  1TWG I;  3FQM A;  4A3E I;  1W2B Y;  2W04 A;  2DE5 A;  1S72 1;  1NP6 A;  5FLX b;  4DQY B;  2DE7 A;  1QVF Y;  2R6M A;  3P5J B;  4NBH A;  3CPW Z;  2RHB A;  2V8J A;  3CQZ I;  1Q82 2;  3VTN A;  3CCJ 1;  4A3M I;  4MD7 A;  4RVF A;  3S14 I;  2OTL Z;  1KD1 2;  4QTU A;  3CD6 Z;  3S1R I;  5D1O B;  3GTO I;  4A3K I;  2OZK A;  3CCR 1;  2GU2 A;  1NJI 2;  2PMZ A;  3CCE 1;  3I55 Z;  1VQ9 1;  1VQ6 Z;  4E2Y A;  3CCS Z;  1JJ2 Z;  3BG1 B;  4MD8 A;  1VQK Z;  1R9T I;  3NDI A;  4NB9 A;  1Q82 1;  3HOY I;  3KIH A;  1N8R 1;  1RO0 A;  2V8I A;  3GCF A;  3IF8 A;  5D1P A;  1TWF I;  2JUB A;  2P28 A;  4MD9 A;  3Q87 A;  4DK1 A;  4E2Z A;  1YJN 1;  1Y1V S;  2WAQ A;  4NBE A;  2E2H I;  1VQN 1;  4CL1 A;  3I56 Z;  1VQM 1;  3CC7 1;  4HGY A;  3PO2 I;  2QEX 1;  3NDJ A;  1KC8 2;  3GTL I;  1M1K 2;  2JA7 I;  1VQ7 1;  3VMH A;  2OTL 1;  2QLV B;  3CCV Z;  2NVQ I;  4E2W A;  4MRI A;  3M3Y I;  1K8A 1;  1S7M A;  3I4N I;  4A3J I;  1Q81 2;  3MZK B;  3IFU A;  4RV9 A;  1VQK 1;  3H0G I;  4X6A I;  3S2D I;  1YIT Z;  2I3C A;  1VQ4 Z;  4BBS I;  2NVT I;  2RIQ A;  1W2B Z;  5C3E I;  3HOZ I;  3GKQ A;  3CCQ 1;  3CMA 1;  5A2Q b;  1JJ2 Y;  3VB9 A;  4BY7 I;  1Y1W I;  3CCU 1;  1K9M 1;  4NBF A;  1QVG Y;  1ML8 A;  1TWA I;  4A3C I;  3CC7 Z;  4E31 A;  4NBA A;  2GTH A;  3S15 I;  2R7Z I;  3PO3 S;  1VQL Z;  2NVX I;  3F3F C;  2QA4 1;  1VQO Z;  1YJW 1;  2YU9 I;  3S1M I;  1Q86 1;  2AKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...