1QYPA

Thermococcus celer rpb9, nmr, 25 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
GSHMEQDLKTLPTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of an archaeal zinc ribbon defines a general architectural motif in eukaryotic RNA polymerases.
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Transcription
molecule keywords RNA POLYMERASE II
total genus 4
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1997-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qypA00
4BY7I 3GTLI 1USPB 1Y1WI 3GTMI 3H0GI 3GTPI 1TWFI 1Y1VI 3VMGA 3D6WA 3HOYI 1RLYA 3K7AI 2YU9I 2DE7A 4Y52I 2K5RA 3VMIA 3GTJI 3VMHA 1TWCI 2VUMI 3S1NI 3ESWA 2JNYA 4A3EI 4A3LI 4A3MI 1QYPA 3S1RI 3S2DI 3PO3S 1PFTA 2R7ZI 3I4MI 5IP7I 1YUAA 3CQZI 4NB9A 4XX2A 3HOXI 2BJOA 4NBFA 3HOWI 4Y7NI 1X3ZA 5IP9I 4NBAA 2JR6A 4A3KI 1WCMI 4A3GI 3EERA 1R9TI 1DL6A 1TWAI 2RBLA 1K83I 3PO2I 5C4XI 4X6AI 4NBEA 5C4JI 2JA5I 5C3EI 1USPA 1WW9A 1VLAA 2NVTI 2B63I 1LQLA 2DE5A 3GTOI 3M3YI 3HOUI 3FKII 2F4OA 4A3II 3S15I 2P3YA 2R92I 3S2HI 4NBCA 5CM2M 3I07A 2F4MA 1TFIA 4NBDA 4A3JI 2NVQI 1X3WA 2E2II 4NBHA 4NBGA 1L1OC 1ML8A 3S14I 2E2JI 1I50I 4A3FI 4A3DI 2JS4A 4QTTA 4A3BI 2JA6I 3GTGI 2PK7A 2KPIA 3HOZI 2NVYI 3GCFA 3S1QI 4BBSI 3GTQI 2JA8I 2R93I 4BBRI 3Q87A 2E2HI 4QTUA 3S1MI 3I4NI 4NOZA 1I3QI 1RO4A 2J6AA 1Y1VS 1TWHI 5C44I 3RZDI 3GTMS 4BXXI 2AKLA 3U50C 3VB9A 2JA7I 2NVXI 3LUSA 1ZB8A 4NB8A 1I6HI 3S17I 3HOVI 3PO3I 4BY1I 1ZB9A 4MH4A 2HF1A 4NBBA 4A3CI 3H3VJ 3S16I 5FLMI 3M4OI 2DE6A 3GKQA 3RZOI 4A93I 1N2FA 3GTKI 1NUIA 1SFOI 1TWGI
chains in the Genus database with same CATH superfamily
3CMAZ 1Y1WI 4RVFA 3CCVZ 1Y1VI 1VQKZ 1RLYA 1Z03A 2K5RA 3GTJI 2M6NA 2VUMI 3ESWA 4A3EI 4A3LI 1VQM1 3IF8A 3J80b 3I4MI 1YIJZ 5IP7I 1Q811 2M48A 4NB9A 3HOXI 2QEX1 2VF1A 3HKZA 4NBFA 1YITZ 1Q821 2OTJZ 1X3ZA 1K9M1 3J80f 4A3KI 1WCMI 4A3GI 5D1PA 3PO2I 5C4XI 2JIOA 2IZ3A 1LQLA 3TDHB 1VQ71 3FKII 2JIQA 2GTHA 3I561 1S72Z 1YIT1 2R92I 4E2XA 2E7ZA 2HU9A 1TFIA 3VTNA 1L1OC 1ML8A 1Q862 1KQSY 3GTGI 2KPIA 1JWHC 3S1QI 4BBSI 3MONA 1YHQ1 4BBRI 3Q87A 3I4NI 2JUBA 1I3QI 5A2Qf 3CCUZ 4BXXI 1WJ2A 1KC81 3VB9A 2QLVB 2QR1B 3NH5A 3CPWZ 1SIWA 3LUSA 2LEXA 3HOVI 1M902 1YI21 2O4HA 2VPWA 2V8KA 3CMEZ 5FLMI 2DE6A 2Y0SA 4RV9A 1N8R1 2IV2X 3CCSZ 3J81b 5AN9F 3D6WA 1Q16A 2DE7A 5IT9b 3VMIA 3VMHA 3S1NI 2JNYA 4A3MI 1QYPA 3S2DI 1PFTA 4S1TA 3CCV1 4XX2A 3CCS1 3FQMA 5T64A 4Y7NI 3CC41 2V45A 1RNIA 2RPRA 3EERA 1Q7Y2 2NAPA 1TWAI 1Q812 1K83I 3MZLB 2LFUA 3G4SZ 4NBEA 5C4JI 5C3EI 1USPA 3CCR1 5IT9f 1M901 3CCJZ 2OOXB 1M1K2 3G711 5FLXf 4A3II 2P3YA 1WZNA 3F3FC 3CCLZ 3I56Z 1S721 2PM9A 1KC82 1QVFZ 2AYDA 3I07A 3CC71 4A3JI 2NVQI 2P28A 2QREB 1VQ4Z 2E2JI 1K8A1 4QTTA 2LIYA 2JA6I 3D9XA 1KD12 4HH4A 1YUKA 1W2BY 1ZH1A 3GTQI 4AYBA 3I551 2R93I 2OTL1 4EWCA 1FDOA 4NOZA 4HGYA 1RO4A 1NJI2 1YIJ1 3RZDI 4MRIA 3GTMS 1YJ91 3G4S1 3OW2Y 2GTIA 2Q51A 3U50C 3EEDA 3CD61 3MZKB 2JA7I 2QA4Z 1Z01A 1ZB8A 4NB8A 1I6HI 3PO3I 2QA41 1ZB9A 2R6MA 4NBBA 3CCEZ 1AA6A 3CMA1 3CC7Z 2VPYA 3RZOI 3CCM1 1N2FA 2H85A 3BG0B 3GTKI 1WIIA 4DQYB 1K9M2 3D2LA 4TNUA 3G71Z 3GTLI 4BY7I 2ZAEB 3NDJA 1RO0A 4DGLA 1K732 3GTPI 1TWFI 3TE5B 3VMGA 3HOYI 2QRCB 5A2Qb 1TWCI 4NH1C 4MD8A 3S1RI 2R7ZI 2W03A 4E30A 2JMOA 3CME1 1VQOZ 2QKDA 3HOWI 1KQSZ 5LL6f 4RVHA 4NBAA 1QXFA 1R9TI 1DL6A 2WAQA 2RBLA 3IR7A 4X6AI 1YJN1 1YJ9Z 4RVDA 2G2KA 1WW9A 2V3VA 4E2YA 4NFRA 1FDIA 4E2ZA 2DE5A 3GTOI 3M3YI 3HOUI 1VQNZ 1VQL1 4RVGA 1K8A2 2F4OA 3CC4Z 3S2HI 4HGZA 2F4MA 1Q861 4NBDA 3G6E1 1X3WA 3T4NB 4NBGA 1YI2Z 1Q7Y1 3OW2Z 3S14I 4A3DI 5D1OA 3KIFA 1RQFA 2JS4A 1K731 4A3BI 2PK7A 3HOZI 3KIHA 2NVYI 1Z02A 3NFZA 3CD6Z 2QRDB 3NH8A 2JIRA 2QEXZ 2IZ4A 2JA8I 4E31A 4QTUA 3CCJ1 3S1MI 2VUGA 5D1OB 1Y1VS 1TWHI 1YJWZ 4E2WA 2JIPA 2OZKA 2YADA 4RS4A 3CXCY 2NVXI 2I3CA 1QVFY 3NDIA 5T6BA 1VQK1 3S17I 3CC21 1N8R2 1VQ61 3H3VJ 3S16I 3M4OI 1P9NA 4A93I 1NUIA 1VQ6Z 1SFOI 1USPB 3CC2Z 3GTMI 3H0GI 2VPZA 1QVGZ 3K7AI 2YU9I 1VQ7Z 4Y52I 1VQ41 4MD9A 4MD7A 2V8JA 3PO3S 2RHBA 1X0TA 1RO2A 2OOYB 3CCL1 2V8IA 3QWUA 1YUAA 1VQ91 3CQZI 1VQPZ 2EGTA 3NH4A 2BJOA 2OTLZ 4CL1A 5IP9I 2JR6A 3CCMZ 1JJ2Z 3CCQ1 1KRLA 1M1K1 2JA5I 3G6EZ 1VLAA 3J81f 2GU2A 2NVTI 2B63I 3P5JB 1QF8A 1W2BZ 1VQ81 1VQ51 2JIMA 1VQO1 2O53A 3IFUA 3S15I 2OTJ1 4MONA 2E9HA 3J7A4 4NBCA 1S7MA 5T67A 2K3RA 4E32A 5CM2M 1VQLZ 1NP6A 3CPWY 2W04A 4E33A 1JJ2Y 2Q4ZA 2WB1A 2E2II 4NBHA 3BG1B 1I50I 3CCRZ 4A3FI 2RT9A 1Y8CA 3CCQZ 3GCFA 1NJI1 1VQP1 1VQ9Z 1VQ5Z 2E2HI 1YJW1 1VQ8Z 3CXCZ 2J6AA 1KD11 5C44I 1Q822 2AKLA 2PMZA 2VPXA 4MXUA 1QVGY 4DK1A 1VQN1 3IX0A 2KI7B 3JAMf 3FQQA 3F3PC 4BY1I 4MH4A 2HF1A 1YJNZ 4A3CI 5FLXb 3CCU1 3JAMb 3GKQA 3CCE1 1VQMZ 3I55Z 2RIQA 1YHQZ 1TWGI
chains in the Genus database with same CATH topology
3CMAZ 1Y1WI 4RVFA 3CCVZ 1Y1VI 1VQKZ 1RLYA 1Z03A 2K5RA 3GTJI 2M6NA 2VUMI 3ESWA 4A3EI 4A3LI 1VQM1 3IF8A 3J80b 3I4MI 1YIJZ 5IP7I 1Q811 2M48A 4NB9A 3HOXI 2QEX1 2VF1A 3HKZA 4NBFA 1YITZ 1Q821 2OTJZ 1X3ZA 1K9M1 3J80f 4A3KI 1WCMI 4A3GI 5D1PA 3PO2I 5C4XI 2IZ3A 1LQLA 3TDHB 1VQ71 3FKII 2GTHA 3I561 1S72Z 1YIT1 2R92I 4E2XA 2HU9A 1TFIA 3VTNA 1L1OC 1ML8A 1Q862 1KQSY 3GTGI 2KPIA 1JWHC 3S1QI 4BBSI 3MONA 1YHQ1 4BBRI 3Q87A 3I4NI 2JUBA 1I3QI 5A2Qf 3CCUZ 4BXXI 1KC81 3VB9A 2QLVB 2QR1B 3NH5A 3CPWZ 3LUSA 3HOVI 1M902 1YI21 2O4HA 2V8KA 3CMEZ 5FLMI 2DE6A 2Y0SA 4RV9A 1N8R1 3CCSZ 3J81b 5AN9F 3D6WA 2DE7A 5IT9b 3VMIA 3VMHA 3S1NI 2JNYA 4A3MI 1QYPA 3S2DI 1PFTA 4S1TA 3CCV1 4XX2A 3CCS1 3FQMA 5T64A 4Y7NI 3CC41 1RNIA 2RPRA 3EERA 1Q7Y2 1TWAI 1Q812 1K83I 3MZLB 2LFUA 3G4SZ 4NBEA 5C4JI 5C3EI 1USPA 3CCR1 5IT9f 1M901 3CCJZ 2OOXB 1M1K2 3G711 5FLXf 4A3II 2P3YA 3F3FC 3CCLZ 3I56Z 1S721 2PM9A 1KC82 1QVFZ 3CC71 3I07A 4A3JI 2NVQI 2P28A 2QREB 1VQ4Z 2E2JI 1K8A1 4QTTA 2LIYA 2JA6I 3D9XA 1KD12 4HH4A 1YUKA 1W2BY 1ZH1A 3GTQI 4AYBA 3I551 2R93I 2OTL1 4EWCA 4NOZA 4HGYA 1RO4A 1NJI2 1YIJ1 3RZDI 4MRIA 3GTMS 1YJ91 3G4S1 3OW2Y 2GTIA 2Q51A 3U50C 3EEDA 3CD61 3MZKB 2JA7I 2QA4Z 1Z01A 1ZB8A 4NB8A 1I6HI 3PO3I 2QA41 1ZB9A 2R6MA 4NBBA 3CCEZ 3CMA1 3CC7Z 3RZOI 3CCM1 1N2FA 2H85A 3BG0B 3GTKI 1WIIA 4DQYB 1K9M2 4TNUA 3G71Z 3GTLI 4BY7I 2ZAEB 3NDJA 1RO0A 4DGLA 1K732 3GTPI 1TWFI 3TE5B 3VMGA 3HOYI 2QRCB 5A2Qb 1TWCI 4NH1C 4MD8A 3S1RI 2R7ZI 2W03A 4E30A 2JMOA 3CME1 1VQOZ 2QKDA 3HOWI 1KQSZ 5LL6f 4RVHA 4NBAA 1R9TI 1DL6A 2WAQA 2RBLA 4X6AI 1YJN1 1YJ9Z 4RVDA 2G2KA 1WW9A 4E2YA 4NFRA 4E2ZA 2DE5A 3GTOI 3M3YI 3HOUI 1VQNZ 1VQL1 4RVGA 1K8A2 2F4OA 3CC4Z 3S2HI 4HGZA 2F4MA 1Q861 4NBDA 3G6E1 1X3WA 3T4NB 4NBGA 1YI2Z 1Q7Y1 3OW2Z 3S14I 4A3DI 5D1OA 3KIFA 1RQFA 2JS4A 1K731 4A3BI 2PK7A 3HOZI 3KIHA 2NVYI 1Z02A 3NFZA 3CD6Z 2QRDB 3NH8A 2QEXZ 2IZ4A 2JA8I 4E31A 4QTUA 3CCJ1 3S1MI 2VUGA 5D1OB 1Y1VS 1TWHI 1YJWZ 4E2WA 2OZKA 2YADA 4RS4A 3CXCY 2NVXI 2I3CA 1QVFY 3NDIA 5T6BA 1VQK1 3S17I 3CC21 1N8R2 1VQ61 3H3VJ 3S16I 3M4OI 1P9NA 4A93I 1NUIA 1VQ6Z 1SFOI 1USPB 3CC2Z 3GTMI 3H0GI 1QVGZ 3K7AI 2YU9I 1VQ7Z 4Y52I 1VQ41 4MD9A 4MD7A 2V8JA 3PO3S 2RHBA 1X0TA 1RO2A 2OOYB 3CCL1 2V8IA 3QWUA 1YUAA 1VQ91 3CQZI 1VQPZ 2EGTA 3NH4A 2BJOA 2OTLZ 4CL1A 5IP9I 2JR6A 3CCMZ 1JJ2Z 3CCQ1 1KRLA 1M1K1 2JA5I 3G6EZ 1VLAA 3J81f 2GU2A 2NVTI 2B63I 3P5JB 1QF8A 1W2BZ 1VQ81 1VQ51 1VQO1 2O53A 3IFUA 3S15I 2OTJ1 4MONA 2E9HA 3J7A4 4NBCA 1S7MA 5T67A 1VQLZ 2K3RA 4E32A 5CM2M 1NP6A 3CPWY 2W04A 4E33A 1JJ2Y 2Q4ZA 2WB1A 2E2II 4NBHA 3BG1B 1I50I 3CCRZ 4A3FI 2RT9A 3CCQZ 3GCFA 1NJI1 1VQP1 1VQ9Z 1VQ5Z 2E2HI 1YJW1 1VQ8Z 3CXCZ 2J6AA 1KD11 5C44I 1Q822 2AKLA 2PMZA 4MXUA 1QVGY 4DK1A 1VQN1 3IX0A 2KI7B 3JAMf 3FQQA 3F3PC 4BY1I 4MH4A 2HF1A 1YJNZ 4A3CI 5FLXb 3CCU1 3JAMb 3GKQA 3CCE1 1VQMZ 3I55Z 2RIQA 1YHQZ 1TWGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 I;  3GTL I;  1USP B;  1Y1W I;  3GTM I;  3H0G I;  3GTP I;  1TWF I;  1Y1V I;  3VMG A;  3D6W A;  3HOY I;  1RLY A;  3K7A I;  2YU9 I;  2DE7 A;  4Y52 I;  2K5R A;  3VMI A;  3GTJ I;  3VMH A;  1TWC I;  2VUM I;  3S1N I;  3ESW A;  2JNY A;  4A3E I;  4A3L I;  4A3M I;  1QYP A;  3S1R I;  3S2D I;  3PO3 S;  1PFT A;  2R7Z I;  3I4M I;  5IP7 I;  1YUA A;  3CQZ I;  4NB9 A;  4XX2 A;  3HOX I;  2BJO A;  4NBF A;  3HOW I;  4Y7N I;  1X3Z A;  5IP9 I;  4NBA A;  2JR6 A;  4A3K I;  1WCM I;  4A3G I;  3EER A;  1R9T I;  1DL6 A;  1TWA I;  2RBL A;  1K83 I;  3PO2 I;  5C4X I;  4X6A I;  4NBE A;  5C4J I;  2JA5 I;  5C3E I;  1USP A;  1WW9 A;  1VLA A;  2NVT I;  2B63 I;  1LQL A;  2DE5 A;  3GTO I;  3M3Y I;  3HOU I;  3FKI I;  2F4O A;  4A3I I;  3S15 I;  2P3Y A;  2R92 I;  3S2H I;  4NBC A;  5CM2 M;  3I07 A;  2F4M A;  1TFI A;  4NBD A;  4A3J I;  2NVQ I;  1X3W A;  2E2I I;  4NBH A;  4NBG A;  1L1O C;  1ML8 A;  3S14 I;  2E2J I;  1I50 I;  4A3F I;  4A3D I;  2JS4 A;  4QTT A;  4A3B I;  2JA6 I;  3GTG I;  2PK7 A;  2KPI A;  3HOZ I;  2NVY I;  3GCF A;  3S1Q I;  4BBS I;  3GTQ I;  2JA8 I;  2R93 I;  4BBR I;  3Q87 A;  2E2H I;  4QTU A;  3S1M I;  3I4N I;  4NOZ A;  1I3Q I;  1RO4 A;  2J6A A;  1Y1V S;  1TWH I;  5C44 I;  3RZD I;  3GTM S;  4BXX I;  2AKL A;  3U50 C;  3VB9 A;  2JA7 I;  2NVX I;  3LUS A;  1ZB8 A;  4NB8 A;  1I6H I;  3S17 I;  3HOV I;  3PO3 I;  4BY1 I;  1ZB9 A;  4MH4 A;  2HF1 A;  4NBB A;  4A3C I;  3H3V J;  3S16 I;  5FLM I;  3M4O I;  2DE6 A;  3GKQ A;  3RZO I;  4A93 I;  1N2F A;  3GTK I;  1NUI A;  1SFO I;  1TWG I; 
#chains in the Genus database with same CATH topology
 3CMA Z;  1Y1W I;  4RVF A;  3CCV Z;  1Y1V I;  1VQK Z;  1RLY A;  1Z03 A;  2K5R A;  3GTJ I;  2M6N A;  2VUM I;  3ESW A;  4A3E I;  4A3L I;  1VQM 1;  3IF8 A;  3J80 b;  3I4M I;  1YIJ Z;  5IP7 I;  1Q81 1;  2M48 A;  4NB9 A;  3HOX I;  2QEX 1;  2VF1 A;  3HKZ A;  4NBF A;  1YIT Z;  1Q82 1;  2OTJ Z;  1X3Z A;  1K9M 1;  3J80 f;  4A3K I;  1WCM I;  4A3G I;  5D1P A;  3PO2 I;  5C4X I;  2JIO A;  2IZ3 A;  1LQL A;  3TDH B;  1VQ7 1;  3FKI I;  2JIQ A;  2GTH A;  3I56 1;  1S72 Z;  1YIT 1;  2R92 I;  4E2X A;  2E7Z A;  2HU9 A;  1TFI A;  3VTN A;  1L1O C;  1ML8 A;  1Q86 2;  1KQS Y;  3GTG I;  2KPI A;  1JWH C;  3S1Q I;  4BBS I;  3MON A;  1YHQ 1;  4BBR I;  3Q87 A;  3I4N I;  2JUB A;  1I3Q I;  5A2Q f;  3CCU Z;  4BXX I;  1WJ2 A;  1KC8 1;  3VB9 A;  2QLV B;  2QR1 B;  3NH5 A;  3CPW Z;  1SIW A;  3LUS A;  2LEX A;  3HOV I;  1M90 2;  1YI2 1;  2O4H A;  2VPW A;  2V8K A;  3CME Z;  5FLM I;  2DE6 A;  2Y0S A;  4RV9 A;  1N8R 1;  2IV2 X;  3CCS Z;  3J81 b;  5AN9 F;  3D6W A;  1Q16 A;  2DE7 A;  5IT9 b;  3VMI A;  3VMH A;  3S1N I;  2JNY A;  4A3M I;  1QYP A;  3S2D I;  1PFT A;  4S1T A;  3CCV 1;  4XX2 A;  3CCS 1;  3FQM A;  5T64 A;  4Y7N I;  3CC4 1;  2V45 A;  1RNI A;  2RPR A;  3EER A;  1Q7Y 2;  2NAP A;  1TWA I;  1Q81 2;  1K83 I;  3MZL B;  2LFU A;  3G4S Z;  4NBE A;  5C4J I;  5C3E I;  1USP A;  3CCR 1;  5IT9 f;  1M90 1;  3CCJ Z;  2OOX B;  1M1K 2;  3G71 1;  5FLX f;  4A3I I;  2P3Y A;  1WZN A;  3F3F C;  3CCL Z;  3I56 Z;  1S72 1;  2PM9 A;  1KC8 2;  1QVF Z;  2AYD A;  3I07 A;  3CC7 1;  4A3J I;  2NVQ I;  2P28 A;  2QRE B;  1VQ4 Z;  2E2J I;  1K8A 1;  4QTT A;  2LIY A;  2JA6 I;  3D9X A;  1KD1 2;  4HH4 A;  1YUK A;  1W2B Y;  1ZH1 A;  3GTQ I;  4AYB A;  3I55 1;  2R93 I;  2OTL 1;  4EWC A;  1FDO A;  4NOZ A;  4HGY A;  1RO4 A;  1NJI 2;  1YIJ 1;  3RZD I;  4MRI A;  3GTM S;  1YJ9 1;  3G4S 1;  3OW2 Y;  2GTI A;  2Q51 A;  3U50 C;  3EED A;  3CD6 1;  3MZK B;  2JA7 I;  2QA4 Z;  1Z01 A;  1ZB8 A;  4NB8 A;  1I6H I;  3PO3 I;  2QA4 1;  1ZB9 A;  2R6M A;  4NBB A;  3CCE Z;  1AA6 A;  3CMA 1;  3CC7 Z;  2VPY A;  3RZO I;  3CCM 1;  1N2F A;  2H85 A;  3BG0 B;  3GTK I;  1WII A;  4DQY B;  1K9M 2;  3D2L A;  4TNU A;  3G71 Z;  3GTL I;  4BY7 I;  2ZAE B;  3NDJ A;  1RO0 A;  4DGL A;  1K73 2;  3GTP I;  1TWF I;  3TE5 B;  3VMG A;  3HOY I;  2QRC B;  5A2Q b;  1TWC I;  4NH1 C;  4MD8 A;  3S1R I;  2R7Z I;  2W03 A;  4E30 A;  2JMO A;  3CME 1;  1VQO Z;  2QKD A;  3HOW I;  1KQS Z;  5LL6 f;  4RVH A;  4NBA A;  1QXF A;  1R9T I;  1DL6 A;  2WAQ A;  2RBL A;  3IR7 A;  4X6A I;  1YJN 1;  1YJ9 Z;  4RVD A;  2G2K A;  1WW9 A;  2V3V A;  4E2Y A;  4NFR A;  1FDI A;  4E2Z A;  2DE5 A;  3GTO I;  3M3Y I;  3HOU I;  1VQN Z;  1VQL 1;  4RVG A;  1K8A 2;  2F4O A;  3CC4 Z;  3S2H I;  4HGZ A;  2F4M A;  1Q86 1;  4NBD A;  3G6E 1;  1X3W A;  3T4N B;  4NBG A;  1YI2 Z;  1Q7Y 1;  3OW2 Z;  3S14 I;  4A3D I;  5D1O A;  3KIF A;  1RQF A;  2JS4 A;  1K73 1;  4A3B I;  2PK7 A;  3HOZ I;  3KIH A;  2NVY I;  1Z02 A;  3NFZ A;  3CD6 Z;  2QRD B;  3NH8 A;  2JIR A;  2QEX Z;  2IZ4 A;  2JA8 I;  4E31 A;  4QTU A;  3CCJ 1;  3S1M I;  2VUG A;  5D1O B;  1Y1V S;  1TWH I;  1YJW Z;  4E2W A;  2JIP A;  2OZK A;  2YAD A;  4RS4 A;  3CXC Y;  2NVX I;  2I3C A;  1QVF Y;  3NDI A;  5T6B A;  1VQK 1;  3S17 I;  3CC2 1;  1N8R 2;  1VQ6 1;  3H3V J;  3S16 I;  3M4O I;  1P9N A;  4A93 I;  1NUI A;  1VQ6 Z;  1SFO I;  1USP B;  3CC2 Z;  3GTM I;  3H0G I;  2VPZ A;  1QVG Z;  3K7A I;  2YU9 I;  1VQ7 Z;  4Y52 I;  1VQ4 1;  4MD9 A;  4MD7 A;  2V8J A;  3PO3 S;  2RHB A;  1X0T A;  1RO2 A;  2OOY B;  3CCL 1;  2V8I A;  3QWU A;  1YUA A;  1VQ9 1;  3CQZ I;  1VQP Z;  2EGT A;  3NH4 A;  2BJO A;  2OTL Z;  4CL1 A;  5IP9 I;  2JR6 A;  3CCM Z;  1JJ2 Z;  3CCQ 1;  1KRL A;  1M1K 1;  2JA5 I;  3G6E Z;  1VLA A;  3J81 f;  2GU2 A;  2NVT I;  2B63 I;  3P5J B;  1QF8 A;  1W2B Z;  1VQ8 1;  1VQ5 1;  2JIM A;  1VQO 1;  2O53 A;  3IFU A;  3S15 I;  2OTJ 1;  4MON A;  2E9H A;  3J7A 4;  4NBC A;  1S7M A;  5T67 A;  2K3R A;  4E32 A;  5CM2 M;  1VQL Z;  1NP6 A;  3CPW Y;  2W04 A;  4E33 A;  1JJ2 Y;  2Q4Z A;  2WB1 A;  2E2I I;  4NBH A;  3BG1 B;  1I50 I;  3CCR Z;  4A3F I;  2RT9 A;  1Y8C A;  3CCQ Z;  3GCF A;  1NJI 1;  1VQP 1;  1VQ9 Z;  1VQ5 Z;  2E2H I;  1YJW 1;  1VQ8 Z;  3CXC Z;  2J6A A;  1KD1 1;  5C44 I;  1Q82 2;  2AKL A;  2PMZ A;  2VPX A;  4MXU A;  1QVG Y;  4DK1 A;  1VQN 1;  3IX0 A;  2KI7 B;  3JAM f;  3FQQ A;  3F3P C;  4BY1 I;  4MH4 A;  2HF1 A;  1YJN Z;  4A3C I;  5FLX b;  3CCU 1;  3JAM b;  3GKQ A;  3CCE 1;  1VQM Z;  3I55 Z;  2RIQ A;  1YHQ Z;  1TWG I; 
#chains in the Genus database with same CATH homology
 3CMA Z;  1Y1W I;  4RVF A;  3CCV Z;  1Y1V I;  1VQK Z;  1RLY A;  1Z03 A;  2K5R A;  3GTJ I;  2M6N A;  2VUM I;  3ESW A;  4A3E I;  4A3L I;  1VQM 1;  3IF8 A;  3J80 b;  3I4M I;  1YIJ Z;  5IP7 I;  1Q81 1;  2M48 A;  4NB9 A;  3HOX I;  2QEX 1;  2VF1 A;  3HKZ A;  4NBF A;  1YIT Z;  1Q82 1;  2OTJ Z;  1X3Z A;  1K9M 1;  3J80 f;  4A3K I;  1WCM I;  4A3G I;  5D1P A;  3PO2 I;  5C4X I;  2IZ3 A;  1LQL A;  3TDH B;  1VQ7 1;  3FKI I;  2GTH A;  3I56 1;  1S72 Z;  1YIT 1;  2R92 I;  4E2X A;  2HU9 A;  1TFI A;  3VTN A;  1L1O C;  1ML8 A;  1Q86 2;  1KQS Y;  3GTG I;  2KPI A;  1JWH C;  3S1Q I;  4BBS I;  3MON A;  1YHQ 1;  4BBR I;  3Q87 A;  3I4N I;  2JUB A;  1I3Q I;  5A2Q f;  3CCU Z;  4BXX I;  1KC8 1;  3VB9 A;  2QLV B;  2QR1 B;  3NH5 A;  3CPW Z;  3LUS A;  3HOV I;  1M90 2;  1YI2 1;  2O4H A;  2V8K A;  3CME Z;  5FLM I;  2DE6 A;  2Y0S A;  4RV9 A;  1N8R 1;  3CCS Z;  3J81 b;  5AN9 F;  3D6W A;  2DE7 A;  5IT9 b;  3VMI A;  3VMH A;  3S1N I;  2JNY A;  4A3M I;  1QYP A;  3S2D I;  1PFT A;  4S1T A;  3CCV 1;  4XX2 A;  3CCS 1;  3FQM A;  5T64 A;  4Y7N I;  3CC4 1;  1RNI A;  2RPR A;  3EER A;  1Q7Y 2;  1TWA I;  1Q81 2;  1K83 I;  3MZL B;  2LFU A;  3G4S Z;  4NBE A;  5C4J I;  5C3E I;  1USP A;  3CCR 1;  5IT9 f;  1M90 1;  3CCJ Z;  2OOX B;  1M1K 2;  3G71 1;  5FLX f;  4A3I I;  2P3Y A;  3F3F C;  3CCL Z;  3I56 Z;  1S72 1;  2PM9 A;  1KC8 2;  1QVF Z;  3CC7 1;  3I07 A;  4A3J I;  2NVQ I;  2P28 A;  2QRE B;  1VQ4 Z;  2E2J I;  1K8A 1;  4QTT A;  2LIY A;  2JA6 I;  3D9X A;  1KD1 2;  4HH4 A;  1YUK A;  1W2B Y;  1ZH1 A;  3GTQ I;  4AYB A;  3I55 1;  2R93 I;  2OTL 1;  4EWC A;  4NOZ A;  4HGY A;  1RO4 A;  1NJI 2;  1YIJ 1;  3RZD I;  4MRI A;  3GTM S;  1YJ9 1;  3G4S 1;  3OW2 Y;  2GTI A;  2Q51 A;  3U50 C;  3EED A;  3CD6 1;  3MZK B;  2JA7 I;  2QA4 Z;  1Z01 A;  1ZB8 A;  4NB8 A;  1I6H I;  3PO3 I;  2QA4 1;  1ZB9 A;  2R6M A;  4NBB A;  3CCE Z;  3CMA 1;  3CC7 Z;  3RZO I;  3CCM 1;  1N2F A;  2H85 A;  3BG0 B;  3GTK I;  1WII A;  4DQY B;  1K9M 2;  4TNU A;  3G71 Z;  3GTL I;  4BY7 I;  2ZAE B;  3NDJ A;  1RO0 A;  4DGL A;  1K73 2;  3GTP I;  1TWF I;  3TE5 B;  3VMG A;  3HOY I;  2QRC B;  5A2Q b;  1TWC I;  4NH1 C;  4MD8 A;  3S1R I;  2R7Z I;  2W03 A;  4E30 A;  2JMO A;  3CME 1;  1VQO Z;  2QKD A;  3HOW I;  1KQS Z;  5LL6 f;  4RVH A;  4NBA A;  1R9T I;  1DL6 A;  2WAQ A;  2RBL A;  4X6A I;  1YJN 1;  1YJ9 Z;  4RVD A;  2G2K A;  1WW9 A;  4E2Y A;  4NFR A;  4E2Z A;  2DE5 A;  3GTO I;  3M3Y I;  3HOU I;  1VQN Z;  1VQL 1;  4RVG A;  1K8A 2;  2F4O A;  3CC4 Z;  3S2H I;  4HGZ A;  2F4M A;  1Q86 1;  4NBD A;  3G6E 1;  1X3W A;  3T4N B;  4NBG A;  1YI2 Z;  1Q7Y 1;  3OW2 Z;  3S14 I;  4A3D I;  5D1O A;  3KIF A;  1RQF A;  2JS4 A;  1K73 1;  4A3B I;  2PK7 A;  3HOZ I;  3KIH A;  2NVY I;  1Z02 A;  3NFZ A;  3CD6 Z;  2QRD B;  3NH8 A;  2QEX Z;  2IZ4 A;  2JA8 I;  4E31 A;  4QTU A;  3CCJ 1;  3S1M I;  2VUG A;  5D1O B;  1Y1V S;  1TWH I;  1YJW Z;  4E2W A;  2OZK A;  2YAD A;  4RS4 A;  3CXC Y;  2NVX I;  2I3C A;  1QVF Y;  3NDI A;  5T6B A;  1VQK 1;  3S17 I;  3CC2 1;  1N8R 2;  1VQ6 1;  3H3V J;  3S16 I;  3M4O I;  1P9N A;  4A93 I;  1NUI A;  1VQ6 Z;  1SFO I;  1USP B;  3CC2 Z;  3GTM I;  3H0G I;  1QVG Z;  3K7A I;  2YU9 I;  1VQ7 Z;  4Y52 I;  1VQ4 1;  4MD9 A;  4MD7 A;  2V8J A;  3PO3 S;  2RHB A;  1X0T A;  1RO2 A;  2OOY B;  3CCL 1;  2V8I A;  3QWU A;  1YUA A;  1VQ9 1;  3CQZ I;  1VQP Z;  2EGT A;  3NH4 A;  2BJO A;  2OTL Z;  4CL1 A;  5IP9 I;  2JR6 A;  3CCM Z;  1JJ2 Z;  3CCQ 1;  1KRL A;  1M1K 1;  2JA5 I;  3G6E Z;  1VLA A;  3J81 f;  2GU2 A;  2NVT I;  2B63 I;  3P5J B;  1QF8 A;  1W2B Z;  1VQ8 1;  1VQ5 1;  1VQO 1;  2O53 A;  3IFU A;  3S15 I;  2OTJ 1;  4MON A;  2E9H A;  3J7A 4;  4NBC A;  1S7M A;  5T67 A;  1VQL Z;  2K3R A;  4E32 A;  5CM2 M;  1NP6 A;  3CPW Y;  2W04 A;  4E33 A;  1JJ2 Y;  2Q4Z A;  2WB1 A;  2E2I I;  4NBH A;  3BG1 B;  1I50 I;  3CCR Z;  4A3F I;  2RT9 A;  3CCQ Z;  3GCF A;  1NJI 1;  1VQP 1;  1VQ9 Z;  1VQ5 Z;  2E2H I;  1YJW 1;  1VQ8 Z;  3CXC Z;  2J6A A;  1KD1 1;  5C44 I;  1Q82 2;  2AKL A;  2PMZ A;  4MXU A;  1QVG Y;  4DK1 A;  1VQN 1;  3IX0 A;  2KI7 B;  3JAM f;  3FQQ A;  3F3P C;  4BY1 I;  4MH4 A;  2HF1 A;  1YJN Z;  4A3C I;  5FLX b;  3CCU 1;  3JAM b;  3GKQ A;  3CCE 1;  1VQM Z;  3I55 Z;  2RIQ A;  1YHQ Z;  1TWG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...