1QYPA

Thermococcus celer rpb9, nmr, 25 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
57
structure length
57
Chain Sequence
b'GSHMEQDLKTLPTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRSYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA POLYMERASE II
molecule tags Transcription
source organism Thermococcus celer
publication title High-resolution structure of an archaeal zinc ribbon defines a general architectural motif in eukaryotic RNA polymerases.
pubmed doi rcsb
total genus 4
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1997-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qypA00
1X3WA 3PO2I 3FKII 4A3DI 4X6AI 1L1OC 4A3CI 3VMGA 1TFIA 5IP9I 2NVXI 3HOYI 1SFOI 3S1QI 1Y1WI 3EERA 1X3ZA 3GTMS 2J6AA 4BY1I 5C44I 2F4OA 4XX2A 2BJOA 2KPIA 2P3YA 4A3BI 2JNYA 4A93I 1TWFI 4BXXI 2JR6A 4A3KI 1I3QI 2R93I 4A3EI 2JA7I 3S16I 1USPB 3S1NI 4QTTA 3U50C 4A3FI 3I4NI 5C4JI 4NB8A 1ZB8A 3VMHA 2E2II 1PFTA 2E2HI 1TWCI 1WCMI 3S17I 2RBLA 4A3LI 2JA6I 3GTQI 1QYPA 4A3II 3S1MI 3GTJI 1I6HI 3K7AI 4QTUA 1RO4A 2JA8I 3VMIA 3M3YI 2JA5I 2NVYI 2F4MA 4A3GI 3M4OI 2DE6A 3HOZI 4BBSI 1NUIA 1N2FA 1RLYA 5C3EI 1YUAA 2HF1A 2NVTI 3HOXI 2R7ZI 2DE7A 3H3VJ 2VUMI 3GTOI 1I50I 1TWHI 1DL6A 1ML8A 5IP7I 4NBGA 1TWAI 1LQLA 2YU9I 1ZB9A 3I4MI 1Y1VS 3RZDI 4BY7I 3I07A 4A3JI 4A3MI 4NB9A 3HOUI 3GTLI 1USPA 3GKQA 4NBFA 3HOVI 4Y52I 2R92I 3H0GI 2E2JI 2B63I 3GTPI 3GTMI 1WW9A 3PO3I 4BBRI 5C4XI 4Y7NI 1VLAA 3LUSA 3CQZI 3HOWI 3RZOI 4NBHA 5FLMI 2K5RA 4NBDA 4NOZA 3S15I 2AKLA 3S1RI 4NBEA 2NVQI 4NBAA 3GCFA 3GTGI 3Q87A 3PO3S 1K83I 3S2HI 4NBBA 3D6WA 3S2DI 4NBCA 2DE5A 2PK7A 3GTKI 3S14I 3ESWA 1Y1VI 2JS4A 5CM2M 4MH4A 1R9TI 1TWGI 3VB9A
chains in the Genus database with same CATH superfamily
1X3WA 4MONA 4MD7A 2VPZA 1VQP1 3I55Z 1FDOA 3CCEZ 1RNIA 3S1QI 1VQ71 2QEXZ 4RVGA 2JIRA 2F4OA 2Q51A 2KPIA 4A93I 2QREB 1YHQ1 4A3EI 3S16I 2WAQA 1USPB 5IT9b 5C4JI 3OW2Y 1VQLZ 2LEXA 2OTJ1 3GTJI 1I6HI 3K7AI 3CPWY 1M1K1 1VQM1 3CC71 2NVYI 2JIOA 3IFUA 1NUIA 2IZ4A 2IZ3A 3IX0A 1AA6A 3BG0B 3NDIA 3F3PC 2DE7A 5FLXf 1K9M2 3GTOI 1TWHI 1TWAI 1LQLA 1WZNA 2EGTA 4A3MI 2V3VA 4DK1A 1YJNZ 1YIJ1 1USPA 1JJ2Y 4NBFA 1VQ4Z 3HOVI 4Y52I 2R92I 2E2JI 3GTMI 2GU2A 3VTNA 2B63I 1WW9A 4MRIA 3OW2Z 3CCRZ 4Y7NI 1Z01A 3CCJ1 5FLMI 2QEX1 3S15I 1K732 2VPXA 3GTGI 3GCFA 1K83I 3G6EZ 3QWUA 3I56Z 4E2XA 2RT9A 2VPWA 2I3CA 4E30A 1YIT1 1Q821 4E2YA 1KQSY 1Z02A 3CPWZ 4HGZA 5D1OA 1TWGI 3VB9A 3KIFA 1VQ5Z 3FKII 3PO2I 2OOXB 1L1OC 1YJ91 2OTL1 1TFIA 3MZLB 1VQO1 4RVHA 1QVGZ 3EERA 1X3ZA 2J6AA 2V8IA 3EEDA 3JAMb 5C44I 1KC81 1S72Z 3CCLZ 2BJOA 1YUKA 5A2Qb 3CCQZ 4A3BI 3CC7Z 2M6NA 4A3KI 1QVFZ 4RS4A 1Z03A 3S1NI 2VPYA 2AYDA 3TDHB 4AYBA 1S7MA 4NB8A 2E9HA 3VMHA 2JMOA 1YJW1 3F3FC 1WCMI 2RBLA 4S1TA 3CCU1 3CC4Z 1W2BY 1RO4A 2VF1A 2JA8I 3VMIA 1WIIA 5A2Qf 2G2KA 1M1K2 5AN9F 1VQNZ 4E2ZA 5LL6f 4A3GI 2K3RA 5D1OB 2P28A 1N2FA 1Q862 2W04A 1VQ8Z 3MONA 4MD8A 1M901 2QA4Z 3H3VJ 1RQFA 1DL6A 3CME1 2V8KA 3NDJA 3KIHA 3CCV1 2YU9I 4HH4A 1KD12 1Y1VS 3MZKB 2RHBA 4BY7I 1Q7Y2 3CC2Z 2IV2X 5D1PA 2NAPA 4EWCA 3CCMZ 2QRCB 2V45A 5C4XI 1VLAA 1YJ9Z 2OTLZ 1QVFY 3CQZI 1K9M1 1VQOZ 1VQ7Z 4NOZA 3S1RI 1NJI1 3PO3S 1YI2Z 1VQK1 3CCS1 3S2DI 3J7A4 5T6BA 1RO0A 3ESWA 1KD11 5CM2M 1N8R2 1R9TI 5IT9f 3CD61 3TE5B 4X6AI 4A3CI 3JAMf 1VQL1 1RO2A 3J80f 1SFOI 1JWHC 2GTHA 3CC41 1Y1WI 3GTMS 4MD9A 2P3YA 3FQQA 3CMA1 3G711 1TWFI 1VQN1 2JR6A 1I3QI 5T67A 4MXUA 4RVFA 4QTTA 3U50C 4A3FI 2H85A 3I4NI 2JUBA 1VQ81 2QA41 3BG1B 4A3LI 1VQPZ 3GTQI 3CCE1 3S1MI 1Q16A 4QTUA 3G4SZ 1ZH1A 2Y0SA 3M3YI 1YJN1 1K8A1 1VQ41 1VQ61 3CCM1 1KRLA 2QR1B 3HOZI 4RV9A 1P9NA 2M48A 1RLYA 1YUAA 2HF1A 3CCJZ 2R7ZI 2R6MA 3CXCZ 4DGLA 2W03A 2VUMI 4TNUA 1KQSZ 1I50I 1ML8A 5IP7I 2OZKA 1YI21 3I561 3I4MI 1VQKZ 1Q7Y1 3CCSZ 2QLVB 3RZDI 2RIQA 3I07A 4NB9A 3HOUI 1VQ91 3GKQA 1SIWA 3H0GI 3GTPI 2JIQA 1NP6A 1K731 1VQ51 3J81b 1W2BZ 3NFZA 3HOWI 4NBHA 2K5RA 2QRDB 4NBDA 2AKLA 4E31A 2NVQI 4NBAA 4CL1A 3G71Z 4NBBA 4NBCA 3P5JB 3GTKI 2E7ZA 2PMZA 3S14I 1YIJZ 3NH8A 4MH4A 4E33A 2VUGA 3CCR1 1YJWZ 4A3DI 3VMGA 5IP9I 2NVXI 1X0TA 3HOYI 1K8A2 1Q861 3G4S1 3IF8A 4BY1I 3D2LA 2OOYB 4XX2A 4E2WA 1Y8CA 1Q812 2V8JA 3G6E1 1VQ6Z 4BXXI 2JNYA 4NFRA 2JIMA 1QXFA 2R93I 3J81f 2JA7I 4HGYA 2KI7B 2QKDA 2O4HA 1YITZ 1Q822 3FQMA 5T64A 1ZB8A 2E2II 1PFTA 2E2HI 1TWCI 2JIPA 3S17I 3NH4A 4RVDA 2JA6I 3I551 1QYPA 4A3II 2GTIA 3D9XA 3CC21 1S721 1VQ9Z 3NH5A 3HKZA 3CCL1 3CCQ1 2YADA 2JA5I 1YHQZ 2F4MA 2ZAEB 1JJ2Z 3M4OI 2DE6A 4BBSI 1WJ2A 1QVGY 5FLXb 5C3EI 1N8R1 2NVTI 3HOXI 2Q4ZA 2LFUA 4NBGA 1ZB9A 3CCUZ 2OTJZ 4DQYB 4A3JI 2HU9A 3GTLI 2PM9A 4E32A 1KC82 1VQMZ 3PO3I 2LIYA 4BBRI 3T4NB 3CD6Z 3CXCY 3LUSA 3RZOI 2RPRA 4NBEA 3CMEZ 3Q87A 3J80b 3CCVZ 3CMAZ 1M902 3S2HI 3IR7A 3D6WA 1Q811 2WB1A 2DE5A 2O53A 2PK7A 1NJI2 1Y1VI 2JS4A 4NH1C 1QF8A 1FDIA
chains in the Genus database with same CATH topology
1X3WA 4MONA 4MD7A 1VQP1 3I55Z 3CCEZ 1RNIA 3S1QI 1VQ71 2QEXZ 4RVGA 2F4OA 2Q51A 2KPIA 4A93I 2QREB 1YHQ1 4A3EI 3S16I 2WAQA 1USPB 5IT9b 5C4JI 3OW2Y 1VQLZ 2OTJ1 3GTJI 1I6HI 3K7AI 3CPWY 1M1K1 1VQM1 3CC71 2NVYI 3IFUA 1NUIA 2IZ4A 2IZ3A 3IX0A 3BG0B 3NDIA 3F3PC 2DE7A 5FLXf 1K9M2 3GTOI 1TWHI 1TWAI 1LQLA 2EGTA 4A3MI 4DK1A 1YJNZ 1YIJ1 1USPA 1JJ2Y 4NBFA 1VQ4Z 3HOVI 4Y52I 2R92I 2E2JI 3GTMI 2GU2A 3VTNA 2B63I 1WW9A 4MRIA 3OW2Z 3CCRZ 4Y7NI 1Z01A 3CCJ1 5FLMI 2QEX1 3S15I 1K732 3GTGI 3GCFA 1K83I 3G6EZ 3QWUA 3I56Z 4E2XA 2RT9A 2I3CA 4E30A 1YIT1 1Q821 4E2YA 1KQSY 1Z02A 3CPWZ 4HGZA 5D1OA 1TWGI 3VB9A 3KIFA 1VQ5Z 3FKII 3PO2I 2OOXB 1L1OC 1YJ91 2OTL1 1TFIA 3MZLB 1VQO1 4RVHA 1QVGZ 3EERA 1X3ZA 2J6AA 2V8IA 3EEDA 3JAMb 5C44I 1KC81 1S72Z 3CCLZ 2BJOA 1YUKA 5A2Qb 3CCQZ 4A3BI 3CC7Z 2M6NA 4A3KI 1QVFZ 4RS4A 1Z03A 3S1NI 3TDHB 4AYBA 1S7MA 4NB8A 2E9HA 3VMHA 2JMOA 1YJW1 3F3FC 1WCMI 2RBLA 4S1TA 3CCU1 3CC4Z 1W2BY 1RO4A 2VF1A 2JA8I 3VMIA 1WIIA 5A2Qf 2G2KA 1M1K2 5AN9F 1VQNZ 4E2ZA 5LL6f 4A3GI 2K3RA 5D1OB 2P28A 1N2FA 1Q862 2W04A 1VQ8Z 3MONA 4MD8A 1M901 2QA4Z 3H3VJ 1RQFA 1DL6A 3CME1 2V8KA 3NDJA 3KIHA 3CCV1 2YU9I 4HH4A 1KD12 1Y1VS 3MZKB 2RHBA 4BY7I 1Q7Y2 3CC2Z 5D1PA 4EWCA 3CCMZ 2QRCB 5C4XI 1VLAA 1YJ9Z 2OTLZ 1QVFY 3CQZI 1K9M1 1VQOZ 1VQ7Z 4NOZA 3S1RI 1NJI1 3PO3S 1YI2Z 1VQK1 3CCS1 3S2DI 3J7A4 5T6BA 1RO0A 3ESWA 1KD11 5CM2M 1N8R2 1R9TI 5IT9f 3CD61 3TE5B 4X6AI 4A3CI 3JAMf 1VQL1 1RO2A 3J80f 1SFOI 1JWHC 2GTHA 3CC41 1Y1WI 3GTMS 4MD9A 2P3YA 3FQQA 3CMA1 3G711 1TWFI 1VQN1 2JR6A 1I3QI 5T67A 4MXUA 4RVFA 4QTTA 3U50C 4A3FI 2H85A 3I4NI 2JUBA 1VQ81 2QA41 3BG1B 4A3LI 1VQPZ 3GTQI 3CCE1 3S1MI 3G4SZ 4QTUA 1ZH1A 2Y0SA 3M3YI 1YJN1 1K8A1 1VQ41 1VQ61 3CCM1 1KRLA 2QR1B 3HOZI 4RV9A 1P9NA 2M48A 1RLYA 1YUAA 2HF1A 3CCJZ 2R7ZI 2R6MA 3CXCZ 4DGLA 2W03A 2VUMI 4TNUA 1KQSZ 1I50I 1ML8A 5IP7I 2OZKA 1YI21 3I561 3I4MI 1VQKZ 1Q7Y1 3CCSZ 2QLVB 3RZDI 2RIQA 3I07A 4NB9A 3HOUI 1VQ91 3GKQA 3H0GI 3GTPI 1NP6A 1K731 1VQ51 3J81b 1W2BZ 3NFZA 3HOWI 4NBHA 2K5RA 2QRDB 4NBDA 2AKLA 4E31A 2NVQI 4NBAA 4CL1A 3G71Z 4NBBA 4NBCA 3P5JB 3GTKI 2PMZA 3S14I 1YIJZ 3NH8A 4MH4A 4E33A 2VUGA 3CCR1 1YJWZ 4A3DI 3VMGA 5IP9I 2NVXI 1X0TA 3HOYI 1K8A2 1Q861 3G4S1 3IF8A 4BY1I 2OOYB 4XX2A 4E2WA 1Q812 2V8JA 3G6E1 1VQ6Z 4BXXI 2JNYA 4NFRA 2R93I 3J81f 2JA7I 4HGYA 2KI7B 2QKDA 2O4HA 1YITZ 1Q822 3FQMA 5T64A 1ZB8A 2E2II 1PFTA 2E2HI 1TWCI 3S17I 3NH4A 4RVDA 2JA6I 3I551 1QYPA 4A3II 2GTIA 3D9XA 3CC21 1S721 1VQ9Z 3NH5A 3HKZA 3CCL1 3CCQ1 2YADA 2JA5I 1YHQZ 2F4MA 2ZAEB 1JJ2Z 3M4OI 2DE6A 4BBSI 1QVGY 5FLXb 5C3EI 1N8R1 2NVTI 3HOXI 2Q4ZA 2LFUA 4NBGA 1ZB9A 3CCUZ 2OTJZ 4DQYB 4A3JI 2HU9A 3GTLI 2PM9A 4E32A 1KC82 1VQMZ 3PO3I 2LIYA 4BBRI 3T4NB 3CD6Z 3CXCY 3LUSA 3RZOI 2RPRA 4NBEA 3CMEZ 3Q87A 3J80b 3CCVZ 3CMAZ 1M902 3S2HI 3D6WA 1Q811 2WB1A 2DE5A 2O53A 2PK7A 1NJI2 1Y1VI 2JS4A 4NH1C 1QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3W A;  3PO2 I;  3FKI I;  4A3D I;  4X6A I;  1L1O C;  4A3C I;  3VMG A;  1TFI A;  5IP9 I;  2NVX I;  3HOY I;  1SFO I;  3S1Q I;  1Y1W I;  3EER A;  1X3Z A;  3GTM S;  2J6A A;  4BY1 I;  5C44 I;  2F4O A;  4XX2 A;  2BJO A;  2KPI A;  2P3Y A;  4A3B I;  2JNY A;  4A93 I;  1TWF I;  4BXX I;  2JR6 A;  4A3K I;  1I3Q I;  2R93 I;  4A3E I;  2JA7 I;  3S16 I;  1USP B;  3S1N I;  4QTT A;  3U50 C;  4A3F I;  3I4N I;  5C4J I;  4NB8 A;  1ZB8 A;  3VMH A;  2E2I I;  1PFT A;  2E2H I;  1TWC I;  1WCM I;  3S17 I;  2RBL A;  4A3L I;  2JA6 I;  3GTQ I;  1QYP A;  4A3I I;  3S1M I;  3GTJ I;  1I6H I;  3K7A I;  4QTU A;  1RO4 A;  2JA8 I;  3VMI A;  3M3Y I;  2JA5 I;  2NVY I;  2F4M A;  4A3G I;  3M4O I;  2DE6 A;  3HOZ I;  4BBS I;  1NUI A;  1N2F A;  1RLY A;  5C3E I;  1YUA A;  2HF1 A;  2NVT I;  3HOX I;  2R7Z I;  2DE7 A;  3H3V J;  2VUM I;  3GTO I;  1I50 I;  1TWH I;  1DL6 A;  1ML8 A;  5IP7 I;  4NBG A;  1TWA I;  1LQL A;  2YU9 I;  1ZB9 A;  3I4M I;  1Y1V S;  3RZD I;  4BY7 I;  3I07 A;  4A3J I;  4A3M I;  4NB9 A;  3HOU I;  3GTL I;  1USP A;  3GKQ A;  4NBF A;  3HOV I;  4Y52 I;  2R92 I;  3H0G I;  2E2J I;  2B63 I;  3GTP I;  3GTM I;  1WW9 A;  3PO3 I;  4BBR I;  5C4X I;  4Y7N I;  1VLA A;  3LUS A;  3CQZ I;  3HOW I;  3RZO I;  4NBH A;  5FLM I;  2K5R A;  4NBD A;  4NOZ A;  3S15 I;  2AKL A;  3S1R I;  4NBE A;  2NVQ I;  4NBA A;  3GCF A;  3GTG I;  3Q87 A;  3PO3 S;  1K83 I;  3S2H I;  4NBB A;  3D6W A;  3S2D I;  4NBC A;  2DE5 A;  2PK7 A;  3GTK I;  3S14 I;  3ESW A;  1Y1V I;  2JS4 A;  5CM2 M;  4MH4 A;  1R9T I;  1TWG I;  3VB9 A; 
#chains in the Genus database with same CATH topology
 1X3W A;  4MON A;  4MD7 A;  2VPZ A;  1VQP 1;  3I55 Z;  1FDO A;  3CCE Z;  1RNI A;  3S1Q I;  1VQ7 1;  2QEX Z;  4RVG A;  2JIR A;  2F4O A;  2Q51 A;  2KPI A;  4A93 I;  2QRE B;  1YHQ 1;  4A3E I;  3S16 I;  2WAQ A;  1USP B;  5IT9 b;  5C4J I;  3OW2 Y;  1VQL Z;  2LEX A;  2OTJ 1;  3GTJ I;  1I6H I;  3K7A I;  3CPW Y;  1M1K 1;  1VQM 1;  3CC7 1;  2NVY I;  2JIO A;  3IFU A;  1NUI A;  2IZ4 A;  2IZ3 A;  3IX0 A;  1AA6 A;  3BG0 B;  3NDI A;  3F3P C;  2DE7 A;  5FLX f;  1K9M 2;  3GTO I;  1TWH I;  1TWA I;  1LQL A;  1WZN A;  2EGT A;  4A3M I;  2V3V A;  4DK1 A;  1YJN Z;  1YIJ 1;  1USP A;  1JJ2 Y;  4NBF A;  1VQ4 Z;  3HOV I;  4Y52 I;  2R92 I;  2E2J I;  3GTM I;  2GU2 A;  3VTN A;  2B63 I;  1WW9 A;  4MRI A;  3OW2 Z;  3CCR Z;  4Y7N I;  1Z01 A;  3CCJ 1;  5FLM I;  2QEX 1;  3S15 I;  1K73 2;  2VPX A;  3GTG I;  3GCF A;  1K83 I;  3G6E Z;  3QWU A;  3I56 Z;  4E2X A;  2RT9 A;  2VPW A;  2I3C A;  4E30 A;  1YIT 1;  1Q82 1;  4E2Y A;  1KQS Y;  1Z02 A;  3CPW Z;  4HGZ A;  5D1O A;  1TWG I;  3VB9 A;  3KIF A;  1VQ5 Z;  3FKI I;  3PO2 I;  2OOX B;  1L1O C;  1YJ9 1;  2OTL 1;  1TFI A;  3MZL B;  1VQO 1;  4RVH A;  1QVG Z;  3EER A;  1X3Z A;  2J6A A;  2V8I A;  3EED A;  3JAM b;  5C44 I;  1KC8 1;  1S72 Z;  3CCL Z;  2BJO A;  1YUK A;  5A2Q b;  3CCQ Z;  4A3B I;  3CC7 Z;  2M6N A;  4A3K I;  1QVF Z;  4RS4 A;  1Z03 A;  3S1N I;  2VPY A;  2AYD A;  3TDH B;  4AYB A;  1S7M A;  4NB8 A;  2E9H A;  3VMH A;  2JMO A;  1YJW 1;  3F3F C;  1WCM I;  2RBL A;  4S1T A;  3CCU 1;  3CC4 Z;  1W2B Y;  1RO4 A;  2VF1 A;  2JA8 I;  3VMI A;  1WII A;  5A2Q f;  2G2K A;  1M1K 2;  5AN9 F;  1VQN Z;  4E2Z A;  5LL6 f;  4A3G I;  2K3R A;  5D1O B;  2P28 A;  1N2F A;  1Q86 2;  2W04 A;  1VQ8 Z;  3MON A;  4MD8 A;  1M90 1;  2QA4 Z;  3H3V J;  1RQF A;  1DL6 A;  3CME 1;  2V8K A;  3NDJ A;  3KIH A;  3CCV 1;  2YU9 I;  4HH4 A;  1KD1 2;  1Y1V S;  3MZK B;  2RHB A;  4BY7 I;  1Q7Y 2;  3CC2 Z;  2IV2 X;  5D1P A;  2NAP A;  4EWC A;  3CCM Z;  2QRC B;  2V45 A;  5C4X I;  1VLA A;  1YJ9 Z;  2OTL Z;  1QVF Y;  3CQZ I;  1K9M 1;  1VQO Z;  1VQ7 Z;  4NOZ A;  3S1R I;  1NJI 1;  3PO3 S;  1YI2 Z;  1VQK 1;  3CCS 1;  3S2D I;  3J7A 4;  5T6B A;  1RO0 A;  3ESW A;  1KD1 1;  5CM2 M;  1N8R 2;  1R9T I;  5IT9 f;  3CD6 1;  3TE5 B;  4X6A I;  4A3C I;  3JAM f;  1VQL 1;  1RO2 A;  3J80 f;  1SFO I;  1JWH C;  2GTH A;  3CC4 1;  1Y1W I;  3GTM S;  4MD9 A;  2P3Y A;  3FQQ A;  3CMA 1;  3G71 1;  1TWF I;  1VQN 1;  2JR6 A;  1I3Q I;  5T67 A;  4MXU A;  4RVF A;  4QTT A;  3U50 C;  4A3F I;  2H85 A;  3I4N I;  2JUB A;  1VQ8 1;  2QA4 1;  3BG1 B;  4A3L I;  1VQP Z;  3GTQ I;  3CCE 1;  3S1M I;  1Q16 A;  4QTU A;  3G4S Z;  1ZH1 A;  2Y0S A;  3M3Y I;  1YJN 1;  1K8A 1;  1VQ4 1;  1VQ6 1;  3CCM 1;  1KRL A;  2QR1 B;  3HOZ I;  4RV9 A;  1P9N A;  2M48 A;  1RLY A;  1YUA A;  2HF1 A;  3CCJ Z;  2R7Z I;  2R6M A;  3CXC Z;  4DGL A;  2W03 A;  2VUM I;  4TNU A;  1KQS Z;  1I50 I;  1ML8 A;  5IP7 I;  2OZK A;  1YI2 1;  3I56 1;  3I4M I;  1VQK Z;  1Q7Y 1;  3CCS Z;  2QLV B;  3RZD I;  2RIQ A;  3I07 A;  4NB9 A;  3HOU I;  1VQ9 1;  3GKQ A;  1SIW A;  3H0G I;  3GTP I;  2JIQ A;  1NP6 A;  1K73 1;  1VQ5 1;  3J81 b;  1W2B Z;  3NFZ A;  3HOW I;  4NBH A;  2K5R A;  2QRD B;  4NBD A;  2AKL A;  4E31 A;  2NVQ I;  4NBA A;  4CL1 A;  3G71 Z;  4NBB A;  4NBC A;  3P5J B;  3GTK I;  2E7Z A;  2PMZ A;  3S14 I;  1YIJ Z;  3NH8 A;  4MH4 A;  4E33 A;  2VUG A;  3CCR 1;  1YJW Z;  4A3D I;  3VMG A;  5IP9 I;  2NVX I;  1X0T A;  3HOY I;  1K8A 2;  1Q86 1;  3G4S 1;  3IF8 A;  4BY1 I;  3D2L A;  2OOY B;  4XX2 A;  4E2W A;  1Y8C A;  1Q81 2;  2V8J A;  3G6E 1;  1VQ6 Z;  4BXX I;  2JNY A;  4NFR A;  2JIM A;  1QXF A;  2R93 I;  3J81 f;  2JA7 I;  4HGY A;  2KI7 B;  2QKD A;  2O4H A;  1YIT Z;  1Q82 2;  3FQM A;  5T64 A;  1ZB8 A;  2E2I I;  1PFT A;  2E2H I;  1TWC I;  2JIP A;  3S17 I;  3NH4 A;  4RVD A;  2JA6 I;  3I55 1;  1QYP A;  4A3I I;  2GTI A;  3D9X A;  3CC2 1;  1S72 1;  1VQ9 Z;  3NH5 A;  3HKZ A;  3CCL 1;  3CCQ 1;  2YAD A;  2JA5 I;  1YHQ Z;  2F4M A;  2ZAE B;  1JJ2 Z;  3M4O I;  2DE6 A;  4BBS I;  1WJ2 A;  1QVG Y;  5FLX b;  5C3E I;  1N8R 1;  2NVT I;  3HOX I;  2Q4Z A;  2LFU A;  4NBG A;  1ZB9 A;  3CCU Z;  2OTJ Z;  4DQY B;  4A3J I;  2HU9 A;  3GTL I;  2PM9 A;  4E32 A;  1KC8 2;  1VQM Z;  3PO3 I;  2LIY A;  4BBR I;  3T4N B;  3CD6 Z;  3CXC Y;  3LUS A;  3RZO I;  2RPR A;  4NBE A;  3CME Z;  3Q87 A;  3J80 b;  3CCV Z;  3CMA Z;  1M90 2;  3S2H I;  3IR7 A;  3D6W A;  1Q81 1;  2WB1 A;  2DE5 A;  2O53 A;  2PK7 A;  1NJI 2;  1Y1V I;  2JS4 A;  4NH1 C;  1QF8 A;  1FDI A; 
#chains in the Genus database with same CATH homology
 1X3W A;  4MON A;  4MD7 A;  1VQP 1;  3I55 Z;  3CCE Z;  1RNI A;  3S1Q I;  1VQ7 1;  2QEX Z;  4RVG A;  2F4O A;  2Q51 A;  2KPI A;  4A93 I;  2QRE B;  1YHQ 1;  4A3E I;  3S16 I;  2WAQ A;  1USP B;  5IT9 b;  5C4J I;  3OW2 Y;  1VQL Z;  2OTJ 1;  3GTJ I;  1I6H I;  3K7A I;  3CPW Y;  1M1K 1;  1VQM 1;  3CC7 1;  2NVY I;  3IFU A;  1NUI A;  2IZ4 A;  2IZ3 A;  3IX0 A;  3BG0 B;  3NDI A;  3F3P C;  2DE7 A;  5FLX f;  1K9M 2;  3GTO I;  1TWH I;  1TWA I;  1LQL A;  2EGT A;  4A3M I;  4DK1 A;  1YJN Z;  1YIJ 1;  1USP A;  1JJ2 Y;  4NBF A;  1VQ4 Z;  3HOV I;  4Y52 I;  2R92 I;  2E2J I;  3GTM I;  2GU2 A;  3VTN A;  2B63 I;  1WW9 A;  4MRI A;  3OW2 Z;  3CCR Z;  4Y7N I;  1Z01 A;  3CCJ 1;  5FLM I;  2QEX 1;  3S15 I;  1K73 2;  3GTG I;  3GCF A;  1K83 I;  3G6E Z;  3QWU A;  3I56 Z;  4E2X A;  2RT9 A;  2I3C A;  4E30 A;  1YIT 1;  1Q82 1;  4E2Y A;  1KQS Y;  1Z02 A;  3CPW Z;  4HGZ A;  5D1O A;  1TWG I;  3VB9 A;  3KIF A;  1VQ5 Z;  3FKI I;  3PO2 I;  2OOX B;  1L1O C;  1YJ9 1;  2OTL 1;  1TFI A;  3MZL B;  1VQO 1;  4RVH A;  1QVG Z;  3EER A;  1X3Z A;  2J6A A;  2V8I A;  3EED A;  3JAM b;  5C44 I;  1KC8 1;  1S72 Z;  3CCL Z;  2BJO A;  1YUK A;  5A2Q b;  3CCQ Z;  4A3B I;  3CC7 Z;  2M6N A;  4A3K I;  1QVF Z;  4RS4 A;  1Z03 A;  3S1N I;  3TDH B;  4AYB A;  1S7M A;  4NB8 A;  2E9H A;  3VMH A;  2JMO A;  1YJW 1;  3F3F C;  1WCM I;  2RBL A;  4S1T A;  3CCU 1;  3CC4 Z;  1W2B Y;  1RO4 A;  2VF1 A;  2JA8 I;  3VMI A;  1WII A;  5A2Q f;  2G2K A;  1M1K 2;  5AN9 F;  1VQN Z;  4E2Z A;  5LL6 f;  4A3G I;  2K3R A;  5D1O B;  2P28 A;  1N2F A;  1Q86 2;  2W04 A;  1VQ8 Z;  3MON A;  4MD8 A;  1M90 1;  2QA4 Z;  3H3V J;  1RQF A;  1DL6 A;  3CME 1;  2V8K A;  3NDJ A;  3KIH A;  3CCV 1;  2YU9 I;  4HH4 A;  1KD1 2;  1Y1V S;  3MZK B;  2RHB A;  4BY7 I;  1Q7Y 2;  3CC2 Z;  5D1P A;  4EWC A;  3CCM Z;  2QRC B;  5C4X I;  1VLA A;  1YJ9 Z;  2OTL Z;  1QVF Y;  3CQZ I;  1K9M 1;  1VQO Z;  1VQ7 Z;  4NOZ A;  3S1R I;  1NJI 1;  3PO3 S;  1YI2 Z;  1VQK 1;  3CCS 1;  3S2D I;  3J7A 4;  5T6B A;  1RO0 A;  3ESW A;  1KD1 1;  5CM2 M;  1N8R 2;  1R9T I;  5IT9 f;  3CD6 1;  3TE5 B;  4X6A I;  4A3C I;  3JAM f;  1VQL 1;  1RO2 A;  3J80 f;  1SFO I;  1JWH C;  2GTH A;  3CC4 1;  1Y1W I;  3GTM S;  4MD9 A;  2P3Y A;  3FQQ A;  3CMA 1;  3G71 1;  1TWF I;  1VQN 1;  2JR6 A;  1I3Q I;  5T67 A;  4MXU A;  4RVF A;  4QTT A;  3U50 C;  4A3F I;  2H85 A;  3I4N I;  2JUB A;  1VQ8 1;  2QA4 1;  3BG1 B;  4A3L I;  1VQP Z;  3GTQ I;  3CCE 1;  3S1M I;  3G4S Z;  4QTU A;  1ZH1 A;  2Y0S A;  3M3Y I;  1YJN 1;  1K8A 1;  1VQ4 1;  1VQ6 1;  3CCM 1;  1KRL A;  2QR1 B;  3HOZ I;  4RV9 A;  1P9N A;  2M48 A;  1RLY A;  1YUA A;  2HF1 A;  3CCJ Z;  2R7Z I;  2R6M A;  3CXC Z;  4DGL A;  2W03 A;  2VUM I;  4TNU A;  1KQS Z;  1I50 I;  1ML8 A;  5IP7 I;  2OZK A;  1YI2 1;  3I56 1;  3I4M I;  1VQK Z;  1Q7Y 1;  3CCS Z;  2QLV B;  3RZD I;  2RIQ A;  3I07 A;  4NB9 A;  3HOU I;  1VQ9 1;  3GKQ A;  3H0G I;  3GTP I;  1NP6 A;  1K73 1;  1VQ5 1;  3J81 b;  1W2B Z;  3NFZ A;  3HOW I;  4NBH A;  2K5R A;  2QRD B;  4NBD A;  2AKL A;  4E31 A;  2NVQ I;  4NBA A;  4CL1 A;  3G71 Z;  4NBB A;  4NBC A;  3P5J B;  3GTK I;  2PMZ A;  3S14 I;  1YIJ Z;  3NH8 A;  4MH4 A;  4E33 A;  2VUG A;  3CCR 1;  1YJW Z;  4A3D I;  3VMG A;  5IP9 I;  2NVX I;  1X0T A;  3HOY I;  1K8A 2;  1Q86 1;  3G4S 1;  3IF8 A;  4BY1 I;  2OOY B;  4XX2 A;  4E2W A;  1Q81 2;  2V8J A;  3G6E 1;  1VQ6 Z;  4BXX I;  2JNY A;  4NFR A;  2R93 I;  3J81 f;  2JA7 I;  4HGY A;  2KI7 B;  2QKD A;  2O4H A;  1YIT Z;  1Q82 2;  3FQM A;  5T64 A;  1ZB8 A;  2E2I I;  1PFT A;  2E2H I;  1TWC I;  3S17 I;  3NH4 A;  4RVD A;  2JA6 I;  3I55 1;  1QYP A;  4A3I I;  2GTI A;  3D9X A;  3CC2 1;  1S72 1;  1VQ9 Z;  3NH5 A;  3HKZ A;  3CCL 1;  3CCQ 1;  2YAD A;  2JA5 I;  1YHQ Z;  2F4M A;  2ZAE B;  1JJ2 Z;  3M4O I;  2DE6 A;  4BBS I;  1QVG Y;  5FLX b;  5C3E I;  1N8R 1;  2NVT I;  3HOX I;  2Q4Z A;  2LFU A;  4NBG A;  1ZB9 A;  3CCU Z;  2OTJ Z;  4DQY B;  4A3J I;  2HU9 A;  3GTL I;  2PM9 A;  4E32 A;  1KC8 2;  1VQM Z;  3PO3 I;  2LIY A;  4BBR I;  3T4N B;  3CD6 Z;  3CXC Y;  3LUS A;  3RZO I;  2RPR A;  4NBE A;  3CME Z;  3Q87 A;  3J80 b;  3CCV Z;  3CMA Z;  1M90 2;  3S2H I;  3D6W A;  1Q81 1;  2WB1 A;  2DE5 A;  2O53 A;  2PK7 A;  1NJI 2;  1Y1V I;  2JS4 A;  4NH1 C;  1QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...