1I50I

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I01
3GTJI 3H3VJ 1PFTA 3S14I 5IP9I 1I6HI 3D6WA 4NBFA 2B63I 2R7ZI 4Y52I 1WCMI 5CM2M 2JNYA 3VMIA 1R9TI 2F4OA 4NBDA 5IP7I 4A3II 1ZB9A 4A3MI 1TWGI 3HOUI 2DE7A 2NVXI 3CQZI 2BJOA 3RZDI 1VLAA 4BY7I 1NUIA 3M3YI 3FKII 1K83I 3GKQA 3S15I 5FLMI 1LQLA 4Y7NI 4A3JI 1Y1WI 4X6AI 2JR6A 4NB9A 2PK7A 2NVQI 3I4MI 3Q87A 2NVYI 1QYPA 4NBHA 5C4XI 3GCFA 1I3QI 3S16I 1Y1VS 1RLYA 3HOXI 2JA7I 4A3CI 4A3GI 3S1NI 3GTQI 1TWFI 3HOZI 3EERA 3S1QI 3M4OI 2AKLA 3GTMI 2DE5A 2RBLA 1L1OC 2HF1A 1X3ZA 3GTPI 3PO3I 2K5RA 4BBSI 4A3DI 4QTTA 2E2HI 1ZB8A 3S17I 4NBBA 1SFOI 3I07A 4A3EI 1X3WA 2P3YA 3VB9A 3GTOI 3HOYI 4A3KI 4BXXI 3U50C 2F4MA 3GTLI 2JA6I 1ML8A 2E2II 1WW9A 3H0GI 3GTGI 2R92I 1DL6A 4NB8A 4A93I 3S2HI 2JA8I 3S2DI 1YUAA 1TWAI 5C4JI 1USPB 4A3FI 1TFIA 2NVTI 2JS4A 2J6AA 4QTUA 4BY1I 3K7AI 2VUMI 2R93I 2KPIA 3ESWA 4NBEA 1N2FA 3I4NI 3LUSA 2JA5I 4A3BI 4XX2A 2YU9I 3GTKI 2E2JI 4NBGA 3S1MI 4BBRI 3VMGA 1Y1VI 3GTMS 4MH4A 3RZOI 4A3LI 3PO3S 1TWHI 5C44I 4NOZA 5C3EI 3HOVI 4NBCA 4NBAA 3S1RI 1RO4A 2DE6A 1I50I 3HOWI 1USPA 3VMHA 3PO2I 1TWCI
chains in the Genus database with same CATH superfamily
1Q7Y1 1M1K2 3D6WA 2QA41 2YADA 1WCMI 2JMOA 2JIRA 3VMIA 2F4OA 4RVGA 4NBDA 4A3II 1FDOA 3CQZI 5IT9f 1AA6A 2P28A 1VQLZ 1K83I 1Q862 2WB1A 2QR1B 5D1OB 3MZKB 3S15I 2OOYB 1Y1WI 1M1K1 3I4MI 1JJ2Y 1KRLA 5C4XI 3GCFA 1RLYA 2JA7I 3CCLZ 2VPWA 3S1QI 2QEX1 1L1OC 1Y8CA 3PO3I 3J81f 5T6BA 4MD9A 4HGZA 1K9M2 1X3WA 1YUKA 2P3YA 3G4S1 3CCQ1 3OW2Y 2JIOA 2F4MA 3GTLI 2JA6I 1VQ7Z 5T64A 3GTGI 3S2HI 1Z03A 1VQOZ 3KIHA 1VQ81 5T67A 1M901 2NVTI 2J6AA 2QRCB 3K7AI 1Q822 3I4NI 3VTNA 2JA5I 4HGYA 3NH4A 2W03A 2QA4Z 4NBGA 4EWCA 1YI21 1P9NA 1Y1VI 3GTMS 4MH4A 1QF8A 3CCS1 5FLXb 1RO4A 2DE6A 3TDHB 2V8KA 4MD8A 1YJN1 1TWCI 2RPRA 2I3CA 3H3VJ 3D2LA 5A2Qf 2G2KA 2O53A 4E30A 1Q821 1KC82 1VQK1 4DGLA 1I6HI 3IF8A 4NBFA 2GU2A 5LL6f 2JNYA 2QRDB 1VQ91 3CCE1 5IP7I 2LEXA 1ZB9A 4A3MI 1TWGI 1QVGZ 4S1TA 1YJW1 2QEXZ 3RZDI 2OOXB 3FKII 3J80b 3F3FC 4HH4A 2IZ4A 1LQLA 2RHBA 4X6AI 1Q812 4E31A 2NVQI 2AYDA 3G4SZ 2RT9A 2E7ZA 1YIT1 1JWHC 3D9XA 3CCQZ 3EEDA 4A3CI 1TWFI 4E2XA 3HOZI 3CCM1 3M4OI 3NDJA 1KQSY 2DE5A 2RBLA 1K732 2OZKA 1W2BZ 4A3DI 4QTTA 2E2HI 2WAQA 3CCJ1 2LFUA 1VQ8Z 3CMA1 3FQMA 3U50C 3I551 3CCR1 3H0GI 1QVFZ 2R92I 1VQP1 2OTL1 2VPYA 1YI2Z 2EGTA 2E9HA 3S2DI 1YUAA 3CCSZ 1USPB 4A3FI 4MXUA 3HKZA 4QTUA 1S721 1Q861 4RS4A 4NBEA 1YJNZ 3LUSA 4A3BI 2IZ3A 2K3RA 1VQKZ 1RO2A 3GTKI 1KQSZ 1VQ9Z 2O4HA 1QVGY 3HOVI 4NH1C 1NJI2 3CCEZ 2V45A 1YJWZ 4MRIA 3VMHA 3PO2I 2M6NA 3GTJI 3S14I 1K9M1 3CC41 1FDIA 2R7ZI 1WIIA 4RVDA 5CM2M 1R9TI 2V8JA 3CCV1 4CL1A 1YHQ1 3HOUI 1RNIA 2NVXI 3J7A4 2OTJ1 2JIQA 2BJOA 3CCMZ 1VLAA 3BG0B 1NUIA 1WJ2A 4MONA 4NFRA 1W2BY 3MONA 5FLMI 3CME1 1ZH1A 3JAMb 4Y7NI 3CCJZ 1YJ91 2JR6A 3CMAZ 3TE5B 3Q87A 2NVYI 2GTIA 4NBHA 3NH8A 1I3QI 3S16I 3CC21 4E33A 3GTQI 3I55Z 3CCRZ 3EERA 1QVFY 3GTMI 1VQPZ 2HF1A 4AYBA 2OTLZ 2QKDA 4BBSI 1SIWA 2KI7B 1ZB8A 2PM9A 4E2ZA 4NBBA 3CCU1 2JIPA 3BG1B 1Q7Y2 3I561 3IR7A 3I07A 4A3EI 3IX0A 3NFZA 3VB9A 1S72Z 3NH5A 4A3KI 4BXXI 1NP6A 1KC81 1VQN1 1ML8A 2E2II 1WW9A 2ZAEB 1DL6A 4NB8A 4A93I 3CPWZ 5FLXf 2HU9A 1VQ41 1N8R2 1VQ51 3MZLB 3CD61 4E2YA 4DK1A 5C4JI 3JAMf 1TFIA 2JS4A 3NDIA 2M48A 3J81b 4BY1I 2R93I 1RO0A 1N2FA 2IV2X 2R6MA 1Q811 2YU9I 3CC4Z 2E2JI 3S1MI 3VMGA 3RZOI 2VF1A 4A3LI 3PO3S 3CCVZ 5D1PA 4NOZA 3J80f 1Z01A 5C3EI 4NBCA 4NBAA 3CXCZ 1YHQZ 1N8R1 3FQQA 1K731 3HOWI 2VUGA 2OTJZ 1PFTA 1VQM1 3G711 1S7MA 5IP9I 4Y52I 2B63I 1VQ61 3KIFA 3CMEZ 1YJ9Z 3G6E1 2V8IA 1QXFA 3CC2Z 2DE7A 3CC71 4RVFA 4BY7I 1M902 1Q16A 2RIQA 1YIJ1 2PMZA 3M3YI 2JIMA 3P5JB 2JUBA 3GKQA 3CCUZ 4A3JI 1K8A2 3I56Z 1Z02A 4NB9A 2PK7A 2NAPA 1QYPA 5A2Qb 1Y1VS 3HOXI 4A3GI 2LIYA 1VQNZ 3S1NI 2AKLA 1YITZ 1VQL1 3CPWY 2QLVB 2W04A 3IFUA 1X3ZA 4RV9A 3GTPI 2K5RA 2H85A 4RVHA 1KD12 4E32A 1NJI1 1VQ4Z 1VQ5Z 3S17I 2VPXA 3CD6Z 2Y0SA 1SFOI 2Q4ZA 4DQYB 1WZNA 3GTOI 3HOYI 1JJ2Z 1K8A1 3CCL1 2Q51A 3T4NB 2JA8I 3CXCY 1TWAI 1KD11 4E2WA 5IT9b 2VUMI 2GTHA 2KPIA 3ESWA 5D1OA 3OW2Z 1VQ71 2QREB 1X0TA 1VQMZ 3QWUA 4XX2A 4TNUA 3G71Z 4MD7A 1VQ6Z 4BBRI 1VQO1 2VPZA 1RQFA 3G6EZ 1TWHI 5C44I 3F3PC 3S1RI 3CC7Z 1I50I 5AN9F 1USPA 1YIJZ 2V3VA
chains in the Genus database with same CATH topology
1Q7Y1 1M1K2 3D6WA 2QA41 2YADA 1WCMI 2JMOA 3VMIA 2F4OA 4RVGA 4NBDA 4A3II 3CQZI 5IT9f 2P28A 1VQLZ 1K83I 1Q862 2WB1A 2QR1B 5D1OB 3MZKB 3S15I 2OOYB 1Y1WI 1M1K1 3I4MI 1JJ2Y 1KRLA 5C4XI 3GCFA 1RLYA 2JA7I 3CCLZ 3S1QI 2QEX1 1L1OC 3PO3I 3J81f 5T6BA 4MD9A 4HGZA 1K9M2 1X3WA 1YUKA 2P3YA 3G4S1 3CCQ1 3OW2Y 2F4MA 3GTLI 2JA6I 1VQ7Z 5T64A 3GTGI 3S2HI 1Z03A 1VQOZ 3KIHA 1VQ81 5T67A 1M901 2NVTI 2J6AA 2QRCB 3K7AI 1Q822 3I4NI 3VTNA 2JA5I 4HGYA 3NH4A 2W03A 2QA4Z 4NBGA 4EWCA 1YI21 1P9NA 1Y1VI 3GTMS 4MH4A 1QF8A 3CCS1 5FLXb 1RO4A 2DE6A 3TDHB 2V8KA 4MD8A 1YJN1 1TWCI 2RPRA 2I3CA 3H3VJ 5A2Qf 2G2KA 2O53A 4E30A 1Q821 1KC82 1VQK1 4DGLA 1I6HI 3IF8A 4NBFA 2GU2A 5LL6f 2JNYA 2QRDB 1VQ91 3CCE1 5IP7I 1ZB9A 4A3MI 1TWGI 1QVGZ 4S1TA 1YJW1 2QEXZ 3RZDI 2OOXB 3FKII 3J80b 3F3FC 4HH4A 2IZ4A 1LQLA 2RHBA 4X6AI 1Q812 4E31A 2NVQI 3G4SZ 2RT9A 1YIT1 1JWHC 3D9XA 3CCQZ 3EEDA 4A3CI 1TWFI 4E2XA 3HOZI 3CCM1 3M4OI 3NDJA 1KQSY 2DE5A 2RBLA 1K732 2OZKA 1W2BZ 4A3DI 4QTTA 2E2HI 2WAQA 3CCJ1 2LFUA 1VQ8Z 3CMA1 3FQMA 3U50C 3I551 3CCR1 3H0GI 1QVFZ 2R92I 1VQP1 2OTL1 1YI2Z 2EGTA 2E9HA 3S2DI 1YUAA 3CCSZ 1USPB 4A3FI 4MXUA 3HKZA 4QTUA 1S721 1Q861 4RS4A 4NBEA 1YJNZ 3LUSA 4A3BI 2IZ3A 2K3RA 1VQKZ 1RO2A 3GTKI 1KQSZ 1VQ9Z 2O4HA 1QVGY 3HOVI 4NH1C 1NJI2 3CCEZ 1YJWZ 4MRIA 3VMHA 3PO2I 2M6NA 3GTJI 3S14I 1K9M1 3CC41 2R7ZI 1WIIA 4RVDA 5CM2M 1R9TI 2V8JA 3CCV1 4CL1A 1YHQ1 3HOUI 1RNIA 2NVXI 3J7A4 2OTJ1 2BJOA 3CCMZ 1VLAA 3BG0B 1NUIA 4MONA 4NFRA 1W2BY 3MONA 5FLMI 3CME1 1ZH1A 3JAMb 4Y7NI 3CCJZ 1YJ91 2JR6A 3CMAZ 3TE5B 3Q87A 2NVYI 2GTIA 4NBHA 3NH8A 1I3QI 3S16I 3CC21 4E33A 3GTQI 3I55Z 3CCRZ 3EERA 1QVFY 3GTMI 1VQPZ 2HF1A 4AYBA 2OTLZ 2QKDA 4BBSI 2KI7B 1ZB8A 2PM9A 4E2ZA 4NBBA 3CCU1 1Q7Y2 3BG1B 3I561 3I07A 4A3EI 3IX0A 3NFZA 3VB9A 1S72Z 3NH5A 4A3KI 4BXXI 1NP6A 1KC81 1VQN1 1ML8A 2E2II 1WW9A 2ZAEB 1DL6A 4NB8A 4A93I 3CPWZ 5FLXf 2HU9A 1VQ41 1N8R2 1VQ51 3MZLB 3CD61 4E2YA 4DK1A 5C4JI 3JAMf 1TFIA 2JS4A 3NDIA 2M48A 3J81b 4BY1I 2R93I 1RO0A 1N2FA 2R6MA 1Q811 2YU9I 3CC4Z 2E2JI 3S1MI 3VMGA 3RZOI 2VF1A 4A3LI 3PO3S 3CCVZ 5D1PA 4NOZA 3J80f 1Z01A 5C3EI 4NBCA 4NBAA 3CXCZ 1YHQZ 1N8R1 3FQQA 1K731 3HOWI 2VUGA 2OTJZ 1PFTA 1VQM1 3G711 1S7MA 5IP9I 4Y52I 2B63I 1VQ61 3KIFA 3CMEZ 1YJ9Z 3G6E1 2V8IA 3CC2Z 2DE7A 3CC71 4RVFA 4BY7I 1M902 2RIQA 1YIJ1 2PMZA 3M3YI 3P5JB 2JUBA 3GKQA 3CCUZ 4A3JI 1K8A2 3I56Z 1Z02A 4NB9A 2PK7A 1QYPA 5A2Qb 1Y1VS 3HOXI 4A3GI 2LIYA 1VQNZ 3S1NI 2AKLA 1YITZ 1VQL1 3CPWY 2QLVB 2W04A 3IFUA 1X3ZA 4RV9A 3GTPI 2K5RA 2H85A 4RVHA 1KD12 4E32A 1NJI1 1VQ4Z 1VQ5Z 3S17I 3CD6Z 2Y0SA 1SFOI 2Q4ZA 4DQYB 3GTOI 3HOYI 1JJ2Z 1K8A1 3CCL1 2Q51A 3T4NB 2JA8I 3CXCY 1TWAI 1KD11 4E2WA 5IT9b 2VUMI 2GTHA 2KPIA 3ESWA 5D1OA 3OW2Z 1VQ71 2QREB 1X0TA 1VQMZ 3QWUA 4XX2A 4TNUA 3G71Z 4MD7A 1VQ6Z 4BBRI 1VQO1 1RQFA 3G6EZ 1TWHI 5C44I 3F3PC 3S1RI 3CC7Z 1I50I 5AN9F 1USPA 1YIJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ I;  3H3V J;  1PFT A;  3S14 I;  5IP9 I;  1I6H I;  3D6W A;  4NBF A;  2B63 I;  2R7Z I;  4Y52 I;  1WCM I;  5CM2 M;  2JNY A;  3VMI A;  1R9T I;  2F4O A;  4NBD A;  5IP7 I;  4A3I I;  1ZB9 A;  4A3M I;  1TWG I;  3HOU I;  2DE7 A;  2NVX I;  3CQZ I;  2BJO A;  3RZD I;  1VLA A;  4BY7 I;  1NUI A;  3M3Y I;  3FKI I;  1K83 I;  3GKQ A;  3S15 I;  5FLM I;  1LQL A;  4Y7N I;  4A3J I;  1Y1W I;  4X6A I;  2JR6 A;  4NB9 A;  2PK7 A;  2NVQ I;  3I4M I;  3Q87 A;  2NVY I;  1QYP A;  4NBH A;  5C4X I;  3GCF A;  1I3Q I;  3S16 I;  1Y1V S;  1RLY A;  3HOX I;  2JA7 I;  4A3C I;  4A3G I;  3S1N I;  3GTQ I;  1TWF I;  3HOZ I;  3EER A;  3S1Q I;  3M4O I;  2AKL A;  3GTM I;  2DE5 A;  2RBL A;  1L1O C;  2HF1 A;  1X3Z A;  3GTP I;  3PO3 I;  2K5R A;  4BBS I;  4A3D I;  4QTT A;  2E2H I;  1ZB8 A;  3S17 I;  4NBB A;  1SFO I;  3I07 A;  4A3E I;  1X3W A;  2P3Y A;  3VB9 A;  3GTO I;  3HOY I;  4A3K I;  4BXX I;  3U50 C;  2F4M A;  3GTL I;  2JA6 I;  1ML8 A;  2E2I I;  1WW9 A;  3H0G I;  3GTG I;  2R92 I;  1DL6 A;  4NB8 A;  4A93 I;  3S2H I;  2JA8 I;  3S2D I;  1YUA A;  1TWA I;  5C4J I;  1USP B;  4A3F I;  1TFI A;  2NVT I;  2JS4 A;  2J6A A;  4QTU A;  4BY1 I;  3K7A I;  2VUM I;  2R93 I;  2KPI A;  3ESW A;  4NBE A;  1N2F A;  3I4N I;  3LUS A;  2JA5 I;  4A3B I;  4XX2 A;  2YU9 I;  3GTK I;  2E2J I;  4NBG A;  3S1M I;  4BBR I;  3VMG A;  1Y1V I;  3GTM S;  4MH4 A;  3RZO I;  4A3L I;  3PO3 S;  1TWH I;  5C44 I;  4NOZ A;  5C3E I;  3HOV I;  4NBC A;  4NBA A;  3S1R I;  1RO4 A;  2DE6 A;  1I50 I;  3HOW I;  1USP A;  3VMH A;  3PO2 I;  1TWC I; 
#chains in the Genus database with same CATH topology
 1Q7Y 1;  1M1K 2;  3D6W A;  2QA4 1;  2YAD A;  1WCM I;  2JMO A;  2JIR A;  3VMI A;  2F4O A;  4RVG A;  4NBD A;  4A3I I;  1FDO A;  3CQZ I;  5IT9 f;  1AA6 A;  2P28 A;  1VQL Z;  1K83 I;  1Q86 2;  2WB1 A;  2QR1 B;  5D1O B;  3MZK B;  3S15 I;  2OOY B;  1Y1W I;  1M1K 1;  3I4M I;  1JJ2 Y;  1KRL A;  5C4X I;  3GCF A;  1RLY A;  2JA7 I;  3CCL Z;  2VPW A;  3S1Q I;  2QEX 1;  1L1O C;  1Y8C A;  3PO3 I;  3J81 f;  5T6B A;  4MD9 A;  4HGZ A;  1K9M 2;  1X3W A;  1YUK A;  2P3Y A;  3G4S 1;  3CCQ 1;  3OW2 Y;  2JIO A;  2F4M A;  3GTL I;  2JA6 I;  1VQ7 Z;  5T64 A;  3GTG I;  3S2H I;  1Z03 A;  1VQO Z;  3KIH A;  1VQ8 1;  5T67 A;  1M90 1;  2NVT I;  2J6A A;  2QRC B;  3K7A I;  1Q82 2;  3I4N I;  3VTN A;  2JA5 I;  4HGY A;  3NH4 A;  2W03 A;  2QA4 Z;  4NBG A;  4EWC A;  1YI2 1;  1P9N A;  1Y1V I;  3GTM S;  4MH4 A;  1QF8 A;  3CCS 1;  5FLX b;  1RO4 A;  2DE6 A;  3TDH B;  2V8K A;  4MD8 A;  1YJN 1;  1TWC I;  2RPR A;  2I3C A;  3H3V J;  3D2L A;  5A2Q f;  2G2K A;  2O53 A;  4E30 A;  1Q82 1;  1KC8 2;  1VQK 1;  4DGL A;  1I6H I;  3IF8 A;  4NBF A;  2GU2 A;  5LL6 f;  2JNY A;  2QRD B;  1VQ9 1;  3CCE 1;  5IP7 I;  2LEX A;  1ZB9 A;  4A3M I;  1TWG I;  1QVG Z;  4S1T A;  1YJW 1;  2QEX Z;  3RZD I;  2OOX B;  3FKI I;  3J80 b;  3F3F C;  4HH4 A;  2IZ4 A;  1LQL A;  2RHB A;  4X6A I;  1Q81 2;  4E31 A;  2NVQ I;  2AYD A;  3G4S Z;  2RT9 A;  2E7Z A;  1YIT 1;  1JWH C;  3D9X A;  3CCQ Z;  3EED A;  4A3C I;  1TWF I;  4E2X A;  3HOZ I;  3CCM 1;  3M4O I;  3NDJ A;  1KQS Y;  2DE5 A;  2RBL A;  1K73 2;  2OZK A;  1W2B Z;  4A3D I;  4QTT A;  2E2H I;  2WAQ A;  3CCJ 1;  2LFU A;  1VQ8 Z;  3CMA 1;  3FQM A;  3U50 C;  3I55 1;  3CCR 1;  3H0G I;  1QVF Z;  2R92 I;  1VQP 1;  2OTL 1;  2VPY A;  1YI2 Z;  2EGT A;  2E9H A;  3S2D I;  1YUA A;  3CCS Z;  1USP B;  4A3F I;  4MXU A;  3HKZ A;  4QTU A;  1S72 1;  1Q86 1;  4RS4 A;  4NBE A;  1YJN Z;  3LUS A;  4A3B I;  2IZ3 A;  2K3R A;  1VQK Z;  1RO2 A;  3GTK I;  1KQS Z;  1VQ9 Z;  2O4H A;  1QVG Y;  3HOV I;  4NH1 C;  1NJI 2;  3CCE Z;  2V45 A;  1YJW Z;  4MRI A;  3VMH A;  3PO2 I;  2M6N A;  3GTJ I;  3S14 I;  1K9M 1;  3CC4 1;  1FDI A;  2R7Z I;  1WII A;  4RVD A;  5CM2 M;  1R9T I;  2V8J A;  3CCV 1;  4CL1 A;  1YHQ 1;  3HOU I;  1RNI A;  2NVX I;  3J7A 4;  2OTJ 1;  2JIQ A;  2BJO A;  3CCM Z;  1VLA A;  3BG0 B;  1NUI A;  1WJ2 A;  4MON A;  4NFR A;  1W2B Y;  3MON A;  5FLM I;  3CME 1;  1ZH1 A;  3JAM b;  4Y7N I;  3CCJ Z;  1YJ9 1;  2JR6 A;  3CMA Z;  3TE5 B;  3Q87 A;  2NVY I;  2GTI A;  4NBH A;  3NH8 A;  1I3Q I;  3S16 I;  3CC2 1;  4E33 A;  3GTQ I;  3I55 Z;  3CCR Z;  3EER A;  1QVF Y;  3GTM I;  1VQP Z;  2HF1 A;  4AYB A;  2OTL Z;  2QKD A;  4BBS I;  1SIW A;  2KI7 B;  1ZB8 A;  2PM9 A;  4E2Z A;  4NBB A;  3CCU 1;  2JIP A;  3BG1 B;  1Q7Y 2;  3I56 1;  3IR7 A;  3I07 A;  4A3E I;  3IX0 A;  3NFZ A;  3VB9 A;  1S72 Z;  3NH5 A;  4A3K I;  4BXX I;  1NP6 A;  1KC8 1;  1VQN 1;  1ML8 A;  2E2I I;  1WW9 A;  2ZAE B;  1DL6 A;  4NB8 A;  4A93 I;  3CPW Z;  5FLX f;  2HU9 A;  1VQ4 1;  1N8R 2;  1VQ5 1;  3MZL B;  3CD6 1;  4E2Y A;  4DK1 A;  5C4J I;  3JAM f;  1TFI A;  2JS4 A;  3NDI A;  2M48 A;  3J81 b;  4BY1 I;  2R93 I;  1RO0 A;  1N2F A;  2IV2 X;  2R6M A;  1Q81 1;  2YU9 I;  3CC4 Z;  2E2J I;  3S1M I;  3VMG A;  3RZO I;  2VF1 A;  4A3L I;  3PO3 S;  3CCV Z;  5D1P A;  4NOZ A;  3J80 f;  1Z01 A;  5C3E I;  4NBC A;  4NBA A;  3CXC Z;  1YHQ Z;  1N8R 1;  3FQQ A;  1K73 1;  3HOW I;  2VUG A;  2OTJ Z;  1PFT A;  1VQM 1;  3G71 1;  1S7M A;  5IP9 I;  4Y52 I;  2B63 I;  1VQ6 1;  3KIF A;  3CME Z;  1YJ9 Z;  3G6E 1;  2V8I A;  1QXF A;  3CC2 Z;  2DE7 A;  3CC7 1;  4RVF A;  4BY7 I;  1M90 2;  1Q16 A;  2RIQ A;  1YIJ 1;  2PMZ A;  3M3Y I;  2JIM A;  3P5J B;  2JUB A;  3GKQ A;  3CCU Z;  4A3J I;  1K8A 2;  3I56 Z;  1Z02 A;  4NB9 A;  2PK7 A;  2NAP A;  1QYP A;  5A2Q b;  1Y1V S;  3HOX I;  4A3G I;  2LIY A;  1VQN Z;  3S1N I;  2AKL A;  1YIT Z;  1VQL 1;  3CPW Y;  2QLV B;  2W04 A;  3IFU A;  1X3Z A;  4RV9 A;  3GTP I;  2K5R A;  2H85 A;  4RVH A;  1KD1 2;  4E32 A;  1NJI 1;  1VQ4 Z;  1VQ5 Z;  3S17 I;  2VPX A;  3CD6 Z;  2Y0S A;  1SFO I;  2Q4Z A;  4DQY B;  1WZN A;  3GTO I;  3HOY I;  1JJ2 Z;  1K8A 1;  3CCL 1;  2Q51 A;  3T4N B;  2JA8 I;  3CXC Y;  1TWA I;  1KD1 1;  4E2W A;  5IT9 b;  2VUM I;  2GTH A;  2KPI A;  3ESW A;  5D1O A;  3OW2 Z;  1VQ7 1;  2QRE B;  1X0T A;  1VQM Z;  3QWU A;  4XX2 A;  4TNU A;  3G71 Z;  4MD7 A;  1VQ6 Z;  4BBR I;  1VQO 1;  2VPZ A;  1RQF A;  3G6E Z;  1TWH I;  5C44 I;  3F3P C;  3S1R I;  3CC7 Z;  1I50 I;  5AN9 F;  1USP A;  1YIJ Z;  2V3V A; 
#chains in the Genus database with same CATH homology
 1Q7Y 1;  1M1K 2;  3D6W A;  2QA4 1;  2YAD A;  1WCM I;  2JMO A;  3VMI A;  2F4O A;  4RVG A;  4NBD A;  4A3I I;  3CQZ I;  5IT9 f;  2P28 A;  1VQL Z;  1K83 I;  1Q86 2;  2WB1 A;  2QR1 B;  5D1O B;  3MZK B;  3S15 I;  2OOY B;  1Y1W I;  1M1K 1;  3I4M I;  1JJ2 Y;  1KRL A;  5C4X I;  3GCF A;  1RLY A;  2JA7 I;  3CCL Z;  3S1Q I;  2QEX 1;  1L1O C;  3PO3 I;  3J81 f;  5T6B A;  4MD9 A;  4HGZ A;  1K9M 2;  1X3W A;  1YUK A;  2P3Y A;  3G4S 1;  3CCQ 1;  3OW2 Y;  2F4M A;  3GTL I;  2JA6 I;  1VQ7 Z;  5T64 A;  3GTG I;  3S2H I;  1Z03 A;  1VQO Z;  3KIH A;  1VQ8 1;  5T67 A;  1M90 1;  2NVT I;  2J6A A;  2QRC B;  3K7A I;  1Q82 2;  3I4N I;  3VTN A;  2JA5 I;  4HGY A;  3NH4 A;  2W03 A;  2QA4 Z;  4NBG A;  4EWC A;  1YI2 1;  1P9N A;  1Y1V I;  3GTM S;  4MH4 A;  1QF8 A;  3CCS 1;  5FLX b;  1RO4 A;  2DE6 A;  3TDH B;  2V8K A;  4MD8 A;  1YJN 1;  1TWC I;  2RPR A;  2I3C A;  3H3V J;  5A2Q f;  2G2K A;  2O53 A;  4E30 A;  1Q82 1;  1KC8 2;  1VQK 1;  4DGL A;  1I6H I;  3IF8 A;  4NBF A;  2GU2 A;  5LL6 f;  2JNY A;  2QRD B;  1VQ9 1;  3CCE 1;  5IP7 I;  1ZB9 A;  4A3M I;  1TWG I;  1QVG Z;  4S1T A;  1YJW 1;  2QEX Z;  3RZD I;  2OOX B;  3FKI I;  3J80 b;  3F3F C;  4HH4 A;  2IZ4 A;  1LQL A;  2RHB A;  4X6A I;  1Q81 2;  4E31 A;  2NVQ I;  3G4S Z;  2RT9 A;  1YIT 1;  1JWH C;  3D9X A;  3CCQ Z;  3EED A;  4A3C I;  1TWF I;  4E2X A;  3HOZ I;  3CCM 1;  3M4O I;  3NDJ A;  1KQS Y;  2DE5 A;  2RBL A;  1K73 2;  2OZK A;  1W2B Z;  4A3D I;  4QTT A;  2E2H I;  2WAQ A;  3CCJ 1;  2LFU A;  1VQ8 Z;  3CMA 1;  3FQM A;  3U50 C;  3I55 1;  3CCR 1;  3H0G I;  1QVF Z;  2R92 I;  1VQP 1;  2OTL 1;  1YI2 Z;  2EGT A;  2E9H A;  3S2D I;  1YUA A;  3CCS Z;  1USP B;  4A3F I;  4MXU A;  3HKZ A;  4QTU A;  1S72 1;  1Q86 1;  4RS4 A;  4NBE A;  1YJN Z;  3LUS A;  4A3B I;  2IZ3 A;  2K3R A;  1VQK Z;  1RO2 A;  3GTK I;  1KQS Z;  1VQ9 Z;  2O4H A;  1QVG Y;  3HOV I;  4NH1 C;  1NJI 2;  3CCE Z;  1YJW Z;  4MRI A;  3VMH A;  3PO2 I;  2M6N A;  3GTJ I;  3S14 I;  1K9M 1;  3CC4 1;  2R7Z I;  1WII A;  4RVD A;  5CM2 M;  1R9T I;  2V8J A;  3CCV 1;  4CL1 A;  1YHQ 1;  3HOU I;  1RNI A;  2NVX I;  3J7A 4;  2OTJ 1;  2BJO A;  3CCM Z;  1VLA A;  3BG0 B;  1NUI A;  4MON A;  4NFR A;  1W2B Y;  3MON A;  5FLM I;  3CME 1;  1ZH1 A;  3JAM b;  4Y7N I;  3CCJ Z;  1YJ9 1;  2JR6 A;  3CMA Z;  3TE5 B;  3Q87 A;  2NVY I;  2GTI A;  4NBH A;  3NH8 A;  1I3Q I;  3S16 I;  3CC2 1;  4E33 A;  3GTQ I;  3I55 Z;  3CCR Z;  3EER A;  1QVF Y;  3GTM I;  1VQP Z;  2HF1 A;  4AYB A;  2OTL Z;  2QKD A;  4BBS I;  2KI7 B;  1ZB8 A;  2PM9 A;  4E2Z A;  4NBB A;  3CCU 1;  1Q7Y 2;  3BG1 B;  3I56 1;  3I07 A;  4A3E I;  3IX0 A;  3NFZ A;  3VB9 A;  1S72 Z;  3NH5 A;  4A3K I;  4BXX I;  1NP6 A;  1KC8 1;  1VQN 1;  1ML8 A;  2E2I I;  1WW9 A;  2ZAE B;  1DL6 A;  4NB8 A;  4A93 I;  3CPW Z;  5FLX f;  2HU9 A;  1VQ4 1;  1N8R 2;  1VQ5 1;  3MZL B;  3CD6 1;  4E2Y A;  4DK1 A;  5C4J I;  3JAM f;  1TFI A;  2JS4 A;  3NDI A;  2M48 A;  3J81 b;  4BY1 I;  2R93 I;  1RO0 A;  1N2F A;  2R6M A;  1Q81 1;  2YU9 I;  3CC4 Z;  2E2J I;  3S1M I;  3VMG A;  3RZO I;  2VF1 A;  4A3L I;  3PO3 S;  3CCV Z;  5D1P A;  4NOZ A;  3J80 f;  1Z01 A;  5C3E I;  4NBC A;  4NBA A;  3CXC Z;  1YHQ Z;  1N8R 1;  3FQQ A;  1K73 1;  3HOW I;  2VUG A;  2OTJ Z;  1PFT A;  1VQM 1;  3G71 1;  1S7M A;  5IP9 I;  4Y52 I;  2B63 I;  1VQ6 1;  3KIF A;  3CME Z;  1YJ9 Z;  3G6E 1;  2V8I A;  3CC2 Z;  2DE7 A;  3CC7 1;  4RVF A;  4BY7 I;  1M90 2;  2RIQ A;  1YIJ 1;  2PMZ A;  3M3Y I;  3P5J B;  2JUB A;  3GKQ A;  3CCU Z;  4A3J I;  1K8A 2;  3I56 Z;  1Z02 A;  4NB9 A;  2PK7 A;  1QYP A;  5A2Q b;  1Y1V S;  3HOX I;  4A3G I;  2LIY A;  1VQN Z;  3S1N I;  2AKL A;  1YIT Z;  1VQL 1;  3CPW Y;  2QLV B;  2W04 A;  3IFU A;  1X3Z A;  4RV9 A;  3GTP I;  2K5R A;  2H85 A;  4RVH A;  1KD1 2;  4E32 A;  1NJI 1;  1VQ4 Z;  1VQ5 Z;  3S17 I;  3CD6 Z;  2Y0S A;  1SFO I;  2Q4Z A;  4DQY B;  3GTO I;  3HOY I;  1JJ2 Z;  1K8A 1;  3CCL 1;  2Q51 A;  3T4N B;  2JA8 I;  3CXC Y;  1TWA I;  1KD1 1;  4E2W A;  5IT9 b;  2VUM I;  2GTH A;  2KPI A;  3ESW A;  5D1O A;  3OW2 Z;  1VQ7 1;  2QRE B;  1X0T A;  1VQM Z;  3QWU A;  4XX2 A;  4TNU A;  3G71 Z;  4MD7 A;  1VQ6 Z;  4BBR I;  1VQO 1;  1RQF A;  3G6E Z;  1TWH I;  5C44 I;  3F3P C;  3S1R I;  3CC7 Z;  1I50 I;  5AN9 F;  1USP A;  1YIJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...