1I50I

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I01
4A3II 3S15I 1TFIA 1I50I 1SFOI 3H0GI 1R9TI 1I3QI 4A3GI 1L1OC 3FKII 2RBLA 3GTGI 3S16I 3VMIA 2P3YA 3GTMS 3M4OI 3S17I 4A3KI 3HOWI 5C4JI 5CM2M 3Q87A 2F4MA 3U50C 2B63I 1NUIA 1TWGI 1PFTA 2JA8I 1USPB 3GKQA 3GTQI 4QTTA 4NBGA 2NVTI 4A3EI 1Y1WI 3GTLI 3S1QI 2K5RA 3I4NI 2NVQI 2DE5A 2JS4A 3EERA 2R7ZI 1VLAA 4BXXI 4NB9A 1ZB8A 4A3MI 1USPA 1YUAA 3I4MI 4NBDA 2KPIA 4A93I 3HOYI 3GTPI 4NBEA 3S1RI 2DE7A 1TWAI 2DE6A 2F4OA 1ZB9A 1WW9A 3PO2I 3RZDI 2E2HI 1Y1VI 4A3DI 2NVYI 3GTMI 4NBHA 1RLYA 1ML8A 2J6AA 1TWCI 1RO4A 3HOUI 3GTKI 5C44I 3GTOI 3S2DI 2HF1A 1X3ZA 3PO3I 4XX2A 1DL6A 2VUMI 3S1NI 3GCFA 4QTUA 5IP9I 2NVXI 4A3BI 3HOVI 2JNYA 3VMHA 2JA5I 2AKLA 5FLMI 4X6AI 3HOXI 3I07A 3D6WA 5C4XI 4MH4A 2BJOA 4NBFA 3LUSA 4BY1I 1I6HI 1WCMI 4NB8A 2YU9I 4Y7NI 4A3FI 2PK7A 3HOZI 2R93I 4A3CI 1LQLA 1K83I 1QYPA 4NBAA 4Y52I 2JA6I 2R92I 1Y1VS 3CQZI 4BBRI 3RZOI 2JR6A 3VMGA 5C3EI 4BY7I 5IP7I 3VB9A 3K7AI 3M3YI 1TWFI 1X3WA 3GTJI 1TWHI 4A3LI 4NBBA 4NOZA 2E2JI 2E2II 3PO3S 1N2FA 3ESWA 3H3VJ 4A3JI 3S14I 3S1MI 4NBCA 2JA7I 4BBSI 3S2HI
chains in the Genus database with same CATH superfamily
3TE5B 3I551 2IV2X 1TFIA 4A3GI 2K3RA 2O53A 3NH5A 2WB1A 1L1OC 3CD6Z 1NP6A 2P3YA 2Q4ZA 5D1PA 3HOWI 2F4MA 2B63I 3IFUA 1TWGI 3CC7Z 4S1TA 3CPWZ 3P5JB 3J80f 1Q7Y2 3G4S1 4QTTA 2G2KA 4E2YA 1Q821 2DE5A 3CMAZ 1YJ91 4NB9A 2V3VA 1KRLA 4A93I 4MD8A 1RQFA 1YJWZ 3RZDI 2NVYI 3VTNA 4NBHA 1KC81 3NDIA 3GTKI 3GTOI 1K731 1VQKZ 2HF1A 5FLXb 1DL6A 2RT9A 3GCFA 3HOVI 2GU2A 2JNYA 1JJ2Z 2AKLA 2VPYA 2VUGA 3CCMZ 1VQ7Z 3CCJ1 2JIOA 5C4XI 1WIIA 3MZKB 3T4NB 1VQ5Z 3J81b 3CXCZ 4HGYA 4BY1I 1I6HI 3CD61 1K8A2 5A2Qf 2R6MA 1K83I 1QYPA 2R92I 4BBRI 3RZOI 1Z02A 3JAMf 3IX0A 5C3EI 3VB9A 3D2LA 4DQYB 1TWFI 3J80b 4NBBA 3FQQA 1N8R2 4E2XA 3CCR1 1VQ81 4A3II 3S15I 1R9TI 1I3QI 2PM9A 2V8KA 1ZH1A 2RBLA 2I3CA 3FKII 3MZLB 3I56Z 1AA6A 1K8A1 3M4OI 3NH4A 1VQK1 2VF1A 5C4JI 3NH8A 1S721 2GTHA 1S7MA 3J7A4 1Q812 3CCJZ 2LIYA 1QVFY 4RVFA 3CCQZ 3CCLZ 4A3EI 3BG1B 2K5RA 4MRIA 4HH4A 2JS4A 3FQMA 2R7ZI 1VLAA 4BXXI 1VQ51 1N8R1 1KC82 2OZKA 3I4MI 2V8IA 2DE7A 1TWAI 1K732 2OOYB 2F4OA 1ZB9A 1RLYA 1ML8A 2OTJZ 2HU9A 5LL6f 4MD9A 5A2Qb 3CC41 1VQM1 1VQL1 2QRDB 1P9NA 1Q861 3CC2Z 3JAMb 3S1NI 4QTUA 4E32A 5IT9f 2JA5I 1YUKA 3CCEZ 1Q811 1VQP1 1FDIA 1YITZ 3CCRZ 1VQ8Z 3HOXI 2QKDA 3LUSA 1WCMI 1M1K1 3IR7A 3I561 4Y7NI 4A3FI 1SIWA 2PK7A 2P28A 1S72Z 4DK1A 1QVGY 1LQLA 2LEXA 2E7ZA 3NDJA 3KIFA 4NBAA 3VMGA 1YI2Z 2VPZA 5IP7I 1VQN1 3MONA 3CCQ1 2LFUA 3CCL1 3GTJI 1TWHI 3QWUA 4NOZA 3BG0B 2E2JI 3PO3S 5T67A 1QVFZ 3S14I 3S1MI 4NBCA 2O4HA 2M48A 1SFOI 4CL1A 2V45A 1YJN1 2W04A 2JIPA 2OTJ1 4MONA 3CC4Z 3GTGI 3S16I 1VQMZ 1VQLZ 1Z03A 3CCS1 3F3FC 4A3KI 5CM2M 3Q87A 4NFRA 3G71Z 1VQOZ 3U50C 1WJ2A 3CC21 1NUIA 4E2ZA 2EGTA 1YIJ1 1PFTA 2JA8I 1VQPZ 2ZAEB 3CCE1 4NBGA 5T64A 2KI7B 1YIT1 1FDOA 3D9XA 3S1QI 5IT9b 2QREB 3G6EZ 3I4NI 2NVQI 5AN9F 3OW2Y 2PMZA 4A3MI 1YUAA 2E9HA 4NBDA 1Z01A 4NBEA 1Q16A 3PO2I 2E2HI 4A3DI 3GTMI 1Q862 4EWCA 2J6AA 3F3PC 2IZ3A 2JIQA 3HOUI 5C44I 1VQNZ 1QVGZ 1YI21 1W2BY 2RHBA 3PO3I 4XX2A 2VUMI 3CCVZ 5IP9I 5FLXf 1RO2A 3VMHA 5FLMI 1M1K2 3I07A 2OTL1 4NBFA 1NJI1 1YJNZ 4NB8A 4HGZA 2YU9I 3TDHB 3CCSZ 1VQ91 4MD7A 1WZNA 2QR1B 3G711 1VQO1 1YIJZ 2JA6I 1RO0A 1Y1VS 3CQZI 1VQ61 2VPXA 1Y8CA 1K9M2 1X0TA 5D1OB 3K7AI 4RVHA 4NH1C 1KD11 1X3WA 4A3LI 4E2WA 3G6E1 1N2FA 2QA4Z 2VPWA 4A3JI 5D1OA 2JA7I 2QEXZ 3CCUZ 1I50I 3OW2Z 3H0GI 3KIHA 4RVGA 4E33A 4TNUA 3VMIA 3GTMS 3S17I 4RVDA 2AYDA 1KQSY 4E30A 3CME1 2M6NA 3CCV1 1YHQ1 1W2BZ 1K9M1 2WAQA 1USPB 3GKQA 2JIRA 4DGLA 1RNIA 1VQ41 3GTQI 2NVTI 2NAPA 1Y1WI 3GTLI 2OTLZ 1JWHC 2JIMA 3EERA 2QRCB 2JUBA 1ZB8A 2QLVB 1USPA 1Q7Y1 2RPRA 2KPIA 3HOYI 3GTPI 3I55Z 3S1RI 1VQ9Z 2DE6A 1WW9A 2Y0SA 1Y1VI 4RS4A 1TWCI 1RO4A 1M902 1VQ6Z 3S2DI 4RV9A 3CPWY 1X3ZA 2W03A 2JMOA 4A3BI 2NVXI 2Q51A 1NJI2 3CC71 3G4SZ 2QA41 4X6AI 2QEX1 4E31A 3D6WA 3CCU1 3HKZA 4MH4A 1YJ9Z 2BJOA 3CMA1 3IF8A 3NFZA 1QF8A 4MXUA 2V8JA 3HOZI 2R93I 4A3CI 2H85A 1YJW1 1QXFA 1KD12 3CMEZ 4AYBA 1M901 4Y52I 2YADA 1YHQZ 2JR6A 4BY7I 2IZ4A 2RIQA 1JJ2Y 1VQ4Z 3M3YI 1KQSZ 2OOXB 1Q822 2E2II 3ESWA 5T6BA 3H3VJ 3CXCY 2GTIA 4BBSI 3CCM1 1VQ71 3EEDA 3J81f 3S2HI
chains in the Genus database with same CATH topology
3TE5B 3I551 1TFIA 4A3GI 2K3RA 2O53A 3NH5A 2WB1A 1L1OC 3CD6Z 1NP6A 2P3YA 2Q4ZA 5D1PA 3HOWI 2F4MA 2B63I 3IFUA 1TWGI 3CC7Z 4S1TA 3CPWZ 3P5JB 3J80f 1Q7Y2 3G4S1 4QTTA 2G2KA 4E2YA 1Q821 2DE5A 3CMAZ 1YJ91 4NB9A 1KRLA 4A93I 4MD8A 1RQFA 1YJWZ 3RZDI 2NVYI 3VTNA 4NBHA 1KC81 3NDIA 3GTKI 3GTOI 1K731 1VQKZ 2HF1A 5FLXb 1DL6A 2RT9A 3GCFA 3HOVI 2GU2A 2JNYA 1JJ2Z 2AKLA 2VUGA 3CCMZ 1VQ7Z 3CCJ1 5C4XI 1WIIA 3MZKB 3T4NB 1VQ5Z 3J81b 3CXCZ 4HGYA 4BY1I 1I6HI 3CD61 1K8A2 5A2Qf 2R6MA 1K83I 1QYPA 2R92I 4BBRI 3RZOI 1Z02A 3JAMf 3IX0A 5C3EI 3VB9A 4DQYB 1TWFI 3J80b 4NBBA 3FQQA 1N8R2 4E2XA 3CCR1 1VQ81 4A3II 3S15I 1R9TI 1I3QI 2PM9A 2V8KA 1ZH1A 2RBLA 2I3CA 3FKII 3MZLB 3I56Z 1K8A1 3M4OI 3NH4A 1VQK1 2VF1A 5C4JI 3NH8A 1S721 2GTHA 1S7MA 3J7A4 1Q812 3CCJZ 2LIYA 1QVFY 4RVFA 3CCQZ 3CCLZ 4A3EI 3BG1B 2K5RA 4MRIA 4HH4A 2JS4A 3FQMA 2R7ZI 1VLAA 4BXXI 1VQ51 1N8R1 1KC82 2OZKA 3I4MI 2V8IA 2DE7A 1TWAI 1K732 2OOYB 2F4OA 1ZB9A 1RLYA 1ML8A 2OTJZ 2HU9A 5LL6f 4MD9A 5A2Qb 3CC41 1VQM1 1VQL1 2QRDB 1P9NA 1Q861 3CC2Z 3JAMb 3S1NI 4QTUA 4E32A 5IT9f 2JA5I 1YUKA 3CCEZ 1Q811 1VQP1 1YITZ 3CCRZ 1VQ8Z 3HOXI 2QKDA 3LUSA 1WCMI 1M1K1 3I561 4Y7NI 4A3FI 2PK7A 2P28A 1S72Z 4DK1A 1QVGY 1LQLA 3NDJA 3KIFA 4NBAA 3VMGA 1YI2Z 5IP7I 1VQN1 3MONA 3CCQ1 2LFUA 3CCL1 3GTJI 1TWHI 3QWUA 4NOZA 3BG0B 2E2JI 3PO3S 5T67A 1QVFZ 3S14I 3S1MI 4NBCA 2O4HA 2M48A 1SFOI 4CL1A 1YJN1 2W04A 2OTJ1 4MONA 3CC4Z 3GTGI 3S16I 1VQMZ 1VQLZ 1Z03A 3CCS1 3F3FC 4A3KI 5CM2M 3Q87A 4NFRA 3G71Z 1VQOZ 3U50C 3CC21 1NUIA 4E2ZA 2EGTA 1YIJ1 1PFTA 2JA8I 1VQPZ 2ZAEB 3CCE1 4NBGA 5T64A 2KI7B 1YIT1 3D9XA 3S1QI 5IT9b 2QREB 3G6EZ 3I4NI 2NVQI 5AN9F 3OW2Y 2PMZA 4A3MI 1YUAA 2E9HA 4NBDA 1Z01A 4NBEA 3PO2I 2E2HI 4A3DI 3GTMI 1Q862 4EWCA 2J6AA 3F3PC 2IZ3A 3HOUI 5C44I 1VQNZ 1QVGZ 1YI21 1W2BY 2RHBA 3PO3I 4XX2A 2VUMI 3CCVZ 5IP9I 5FLXf 1RO2A 3VMHA 5FLMI 1M1K2 3I07A 2OTL1 4NBFA 1NJI1 1YJNZ 4NB8A 4HGZA 2YU9I 3TDHB 3CCSZ 1VQ91 4MD7A 2QR1B 3G711 1VQO1 1YIJZ 2JA6I 1RO0A 1Y1VS 3CQZI 1VQ61 1K9M2 1X0TA 5D1OB 3K7AI 4RVHA 4NH1C 1KD11 1X3WA 4A3LI 4E2WA 3G6E1 1N2FA 2QA4Z 4A3JI 5D1OA 2JA7I 2QEXZ 3CCUZ 1I50I 3OW2Z 3H0GI 3KIHA 4RVGA 4E33A 4TNUA 3VMIA 3GTMS 3S17I 4RVDA 1KQSY 4E30A 3CME1 2M6NA 3CCV1 1YHQ1 1W2BZ 1K9M1 2WAQA 1USPB 3GKQA 1VQ41 4DGLA 1RNIA 3GTQI 2NVTI 1Y1WI 3GTLI 2OTLZ 1JWHC 3EERA 2QRCB 2JUBA 1ZB8A 2QLVB 1USPA 1Q7Y1 2RPRA 2KPIA 3HOYI 3GTPI 3I55Z 3S1RI 1VQ9Z 2DE6A 1WW9A 2Y0SA 1Y1VI 4RS4A 1TWCI 1RO4A 1M902 1VQ6Z 3S2DI 4RV9A 3CPWY 1X3ZA 2W03A 2JMOA 4A3BI 2NVXI 2Q51A 1NJI2 3CC71 3G4SZ 2QA41 4X6AI 2QEX1 4E31A 3D6WA 3CCU1 3HKZA 4MH4A 1YJ9Z 2BJOA 3CMA1 3IF8A 3NFZA 1QF8A 4MXUA 2V8JA 3HOZI 2R93I 4A3CI 2H85A 1YJW1 1KD12 3CMEZ 4AYBA 1M901 4Y52I 2YADA 1YHQZ 2JR6A 4BY7I 2IZ4A 2RIQA 1JJ2Y 1VQ4Z 3M3YI 1KQSZ 2OOXB 1Q822 2E2II 3ESWA 5T6BA 3H3VJ 3CXCY 2GTIA 4BBSI 3CCM1 1VQ71 3EEDA 3J81f 3S2HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I I;  3S15 I;  1TFI A;  1I50 I;  1SFO I;  3H0G I;  1R9T I;  1I3Q I;  4A3G I;  1L1O C;  3FKI I;  2RBL A;  3GTG I;  3S16 I;  3VMI A;  2P3Y A;  3GTM S;  3M4O I;  3S17 I;  4A3K I;  3HOW I;  5C4J I;  5CM2 M;  3Q87 A;  2F4M A;  3U50 C;  2B63 I;  1NUI A;  1TWG I;  1PFT A;  2JA8 I;  1USP B;  3GKQ A;  3GTQ I;  4QTT A;  4NBG A;  2NVT I;  4A3E I;  1Y1W I;  3GTL I;  3S1Q I;  2K5R A;  3I4N I;  2NVQ I;  2DE5 A;  2JS4 A;  3EER A;  2R7Z I;  1VLA A;  4BXX I;  4NB9 A;  1ZB8 A;  4A3M I;  1USP A;  1YUA A;  3I4M I;  4NBD A;  2KPI A;  4A93 I;  3HOY I;  3GTP I;  4NBE A;  3S1R I;  2DE7 A;  1TWA I;  2DE6 A;  2F4O A;  1ZB9 A;  1WW9 A;  3PO2 I;  3RZD I;  2E2H I;  1Y1V I;  4A3D I;  2NVY I;  3GTM I;  4NBH A;  1RLY A;  1ML8 A;  2J6A A;  1TWC I;  1RO4 A;  3HOU I;  3GTK I;  5C44 I;  3GTO I;  3S2D I;  2HF1 A;  1X3Z A;  3PO3 I;  4XX2 A;  1DL6 A;  2VUM I;  3S1N I;  3GCF A;  4QTU A;  5IP9 I;  2NVX I;  4A3B I;  3HOV I;  2JNY A;  3VMH A;  2JA5 I;  2AKL A;  5FLM I;  4X6A I;  3HOX I;  3I07 A;  3D6W A;  5C4X I;  4MH4 A;  2BJO A;  4NBF A;  3LUS A;  4BY1 I;  1I6H I;  1WCM I;  4NB8 A;  2YU9 I;  4Y7N I;  4A3F I;  2PK7 A;  3HOZ I;  2R93 I;  4A3C I;  1LQL A;  1K83 I;  1QYP A;  4NBA A;  4Y52 I;  2JA6 I;  2R92 I;  1Y1V S;  3CQZ I;  4BBR I;  3RZO I;  2JR6 A;  3VMG A;  5C3E I;  4BY7 I;  5IP7 I;  3VB9 A;  3K7A I;  3M3Y I;  1TWF I;  1X3W A;  3GTJ I;  1TWH I;  4A3L I;  4NBB A;  4NOZ A;  2E2J I;  2E2I I;  3PO3 S;  1N2F A;  3ESW A;  3H3V J;  4A3J I;  3S14 I;  3S1M I;  4NBC A;  2JA7 I;  4BBS I;  3S2H I; 
#chains in the Genus database with same CATH topology
 3TE5 B;  3I55 1;  2IV2 X;  1TFI A;  4A3G I;  2K3R A;  2O53 A;  3NH5 A;  2WB1 A;  1L1O C;  3CD6 Z;  1NP6 A;  2P3Y A;  2Q4Z A;  5D1P A;  3HOW I;  2F4M A;  2B63 I;  3IFU A;  1TWG I;  3CC7 Z;  4S1T A;  3CPW Z;  3P5J B;  3J80 f;  1Q7Y 2;  3G4S 1;  4QTT A;  2G2K A;  4E2Y A;  1Q82 1;  2DE5 A;  3CMA Z;  1YJ9 1;  4NB9 A;  2V3V A;  1KRL A;  4A93 I;  4MD8 A;  1RQF A;  1YJW Z;  3RZD I;  2NVY I;  3VTN A;  4NBH A;  1KC8 1;  3NDI A;  3GTK I;  3GTO I;  1K73 1;  1VQK Z;  2HF1 A;  5FLX b;  1DL6 A;  2RT9 A;  3GCF A;  3HOV I;  2GU2 A;  2JNY A;  1JJ2 Z;  2AKL A;  2VPY A;  2VUG A;  3CCM Z;  1VQ7 Z;  3CCJ 1;  2JIO A;  5C4X I;  1WII A;  3MZK B;  3T4N B;  1VQ5 Z;  3J81 b;  3CXC Z;  4HGY A;  4BY1 I;  1I6H I;  3CD6 1;  1K8A 2;  5A2Q f;  2R6M A;  1K83 I;  1QYP A;  2R92 I;  4BBR I;  3RZO I;  1Z02 A;  3JAM f;  3IX0 A;  5C3E I;  3VB9 A;  3D2L A;  4DQY B;  1TWF I;  3J80 b;  4NBB A;  3FQQ A;  1N8R 2;  4E2X A;  3CCR 1;  1VQ8 1;  4A3I I;  3S15 I;  1R9T I;  1I3Q I;  2PM9 A;  2V8K A;  1ZH1 A;  2RBL A;  2I3C A;  3FKI I;  3MZL B;  3I56 Z;  1AA6 A;  1K8A 1;  3M4O I;  3NH4 A;  1VQK 1;  2VF1 A;  5C4J I;  3NH8 A;  1S72 1;  2GTH A;  1S7M A;  3J7A 4;  1Q81 2;  3CCJ Z;  2LIY A;  1QVF Y;  4RVF A;  3CCQ Z;  3CCL Z;  4A3E I;  3BG1 B;  2K5R A;  4MRI A;  4HH4 A;  2JS4 A;  3FQM A;  2R7Z I;  1VLA A;  4BXX I;  1VQ5 1;  1N8R 1;  1KC8 2;  2OZK A;  3I4M I;  2V8I A;  2DE7 A;  1TWA I;  1K73 2;  2OOY B;  2F4O A;  1ZB9 A;  1RLY A;  1ML8 A;  2OTJ Z;  2HU9 A;  5LL6 f;  4MD9 A;  5A2Q b;  3CC4 1;  1VQM 1;  1VQL 1;  2QRD B;  1P9N A;  1Q86 1;  3CC2 Z;  3JAM b;  3S1N I;  4QTU A;  4E32 A;  5IT9 f;  2JA5 I;  1YUK A;  3CCE Z;  1Q81 1;  1VQP 1;  1FDI A;  1YIT Z;  3CCR Z;  1VQ8 Z;  3HOX I;  2QKD A;  3LUS A;  1WCM I;  1M1K 1;  3IR7 A;  3I56 1;  4Y7N I;  4A3F I;  1SIW A;  2PK7 A;  2P28 A;  1S72 Z;  4DK1 A;  1QVG Y;  1LQL A;  2LEX A;  2E7Z A;  3NDJ A;  3KIF A;  4NBA A;  3VMG A;  1YI2 Z;  2VPZ A;  5IP7 I;  1VQN 1;  3MON A;  3CCQ 1;  2LFU A;  3CCL 1;  3GTJ I;  1TWH I;  3QWU A;  4NOZ A;  3BG0 B;  2E2J I;  3PO3 S;  5T67 A;  1QVF Z;  3S14 I;  3S1M I;  4NBC A;  2O4H A;  2M48 A;  1SFO I;  4CL1 A;  2V45 A;  1YJN 1;  2W04 A;  2JIP A;  2OTJ 1;  4MON A;  3CC4 Z;  3GTG I;  3S16 I;  1VQM Z;  1VQL Z;  1Z03 A;  3CCS 1;  3F3F C;  4A3K I;  5CM2 M;  3Q87 A;  4NFR A;  3G71 Z;  1VQO Z;  3U50 C;  1WJ2 A;  3CC2 1;  1NUI A;  4E2Z A;  2EGT A;  1YIJ 1;  1PFT A;  2JA8 I;  1VQP Z;  2ZAE B;  3CCE 1;  4NBG A;  5T64 A;  2KI7 B;  1YIT 1;  1FDO A;  3D9X A;  3S1Q I;  5IT9 b;  2QRE B;  3G6E Z;  3I4N I;  2NVQ I;  5AN9 F;  3OW2 Y;  2PMZ A;  4A3M I;  1YUA A;  2E9H A;  4NBD A;  1Z01 A;  4NBE A;  1Q16 A;  3PO2 I;  2E2H I;  4A3D I;  3GTM I;  1Q86 2;  4EWC A;  2J6A A;  3F3P C;  2IZ3 A;  2JIQ A;  3HOU I;  5C44 I;  1VQN Z;  1QVG Z;  1YI2 1;  1W2B Y;  2RHB A;  3PO3 I;  4XX2 A;  2VUM I;  3CCV Z;  5IP9 I;  5FLX f;  1RO2 A;  3VMH A;  5FLM I;  1M1K 2;  3I07 A;  2OTL 1;  4NBF A;  1NJI 1;  1YJN Z;  4NB8 A;  4HGZ A;  2YU9 I;  3TDH B;  3CCS Z;  1VQ9 1;  4MD7 A;  1WZN A;  2QR1 B;  3G71 1;  1VQO 1;  1YIJ Z;  2JA6 I;  1RO0 A;  1Y1V S;  3CQZ I;  1VQ6 1;  2VPX A;  1Y8C A;  1K9M 2;  1X0T A;  5D1O B;  3K7A I;  4RVH A;  4NH1 C;  1KD1 1;  1X3W A;  4A3L I;  4E2W A;  3G6E 1;  1N2F A;  2QA4 Z;  2VPW A;  4A3J I;  5D1O A;  2JA7 I;  2QEX Z;  3CCU Z;  1I50 I;  3OW2 Z;  3H0G I;  3KIH A;  4RVG A;  4E33 A;  4TNU A;  3VMI A;  3GTM S;  3S17 I;  4RVD A;  2AYD A;  1KQS Y;  4E30 A;  3CME 1;  2M6N A;  3CCV 1;  1YHQ 1;  1W2B Z;  1K9M 1;  2WAQ A;  1USP B;  3GKQ A;  2JIR A;  4DGL A;  1RNI A;  1VQ4 1;  3GTQ I;  2NVT I;  2NAP A;  1Y1W I;  3GTL I;  2OTL Z;  1JWH C;  2JIM A;  3EER A;  2QRC B;  2JUB A;  1ZB8 A;  2QLV B;  1USP A;  1Q7Y 1;  2RPR A;  2KPI A;  3HOY I;  3GTP I;  3I55 Z;  3S1R I;  1VQ9 Z;  2DE6 A;  1WW9 A;  2Y0S A;  1Y1V I;  4RS4 A;  1TWC I;  1RO4 A;  1M90 2;  1VQ6 Z;  3S2D I;  4RV9 A;  3CPW Y;  1X3Z A;  2W03 A;  2JMO A;  4A3B I;  2NVX I;  2Q51 A;  1NJI 2;  3CC7 1;  3G4S Z;  2QA4 1;  4X6A I;  2QEX 1;  4E31 A;  3D6W A;  3CCU 1;  3HKZ A;  4MH4 A;  1YJ9 Z;  2BJO A;  3CMA 1;  3IF8 A;  3NFZ A;  1QF8 A;  4MXU A;  2V8J A;  3HOZ I;  2R93 I;  4A3C I;  2H85 A;  1YJW 1;  1QXF A;  1KD1 2;  3CME Z;  4AYB A;  1M90 1;  4Y52 I;  2YAD A;  1YHQ Z;  2JR6 A;  4BY7 I;  2IZ4 A;  2RIQ A;  1JJ2 Y;  1VQ4 Z;  3M3Y I;  1KQS Z;  2OOX B;  1Q82 2;  2E2I I;  3ESW A;  5T6B A;  3H3V J;  3CXC Y;  2GTI A;  4BBS I;  3CCM 1;  1VQ7 1;  3EED A;  3J81 f;  3S2H I; 
#chains in the Genus database with same CATH homology
 3TE5 B;  3I55 1;  1TFI A;  4A3G I;  2K3R A;  2O53 A;  3NH5 A;  2WB1 A;  1L1O C;  3CD6 Z;  1NP6 A;  2P3Y A;  2Q4Z A;  5D1P A;  3HOW I;  2F4M A;  2B63 I;  3IFU A;  1TWG I;  3CC7 Z;  4S1T A;  3CPW Z;  3P5J B;  3J80 f;  1Q7Y 2;  3G4S 1;  4QTT A;  2G2K A;  4E2Y A;  1Q82 1;  2DE5 A;  3CMA Z;  1YJ9 1;  4NB9 A;  1KRL A;  4A93 I;  4MD8 A;  1RQF A;  1YJW Z;  3RZD I;  2NVY I;  3VTN A;  4NBH A;  1KC8 1;  3NDI A;  3GTK I;  3GTO I;  1K73 1;  1VQK Z;  2HF1 A;  5FLX b;  1DL6 A;  2RT9 A;  3GCF A;  3HOV I;  2GU2 A;  2JNY A;  1JJ2 Z;  2AKL A;  2VUG A;  3CCM Z;  1VQ7 Z;  3CCJ 1;  5C4X I;  1WII A;  3MZK B;  3T4N B;  1VQ5 Z;  3J81 b;  3CXC Z;  4HGY A;  4BY1 I;  1I6H I;  3CD6 1;  1K8A 2;  5A2Q f;  2R6M A;  1K83 I;  1QYP A;  2R92 I;  4BBR I;  3RZO I;  1Z02 A;  3JAM f;  3IX0 A;  5C3E I;  3VB9 A;  4DQY B;  1TWF I;  3J80 b;  4NBB A;  3FQQ A;  1N8R 2;  4E2X A;  3CCR 1;  1VQ8 1;  4A3I I;  3S15 I;  1R9T I;  1I3Q I;  2PM9 A;  2V8K A;  1ZH1 A;  2RBL A;  2I3C A;  3FKI I;  3MZL B;  3I56 Z;  1K8A 1;  3M4O I;  3NH4 A;  1VQK 1;  2VF1 A;  5C4J I;  3NH8 A;  1S72 1;  2GTH A;  1S7M A;  3J7A 4;  1Q81 2;  3CCJ Z;  2LIY A;  1QVF Y;  4RVF A;  3CCQ Z;  3CCL Z;  4A3E I;  3BG1 B;  2K5R A;  4MRI A;  4HH4 A;  2JS4 A;  3FQM A;  2R7Z I;  1VLA A;  4BXX I;  1VQ5 1;  1N8R 1;  1KC8 2;  2OZK A;  3I4M I;  2V8I A;  2DE7 A;  1TWA I;  1K73 2;  2OOY B;  2F4O A;  1ZB9 A;  1RLY A;  1ML8 A;  2OTJ Z;  2HU9 A;  5LL6 f;  4MD9 A;  5A2Q b;  3CC4 1;  1VQM 1;  1VQL 1;  2QRD B;  1P9N A;  1Q86 1;  3CC2 Z;  3JAM b;  3S1N I;  4QTU A;  4E32 A;  5IT9 f;  2JA5 I;  1YUK A;  3CCE Z;  1Q81 1;  1VQP 1;  1YIT Z;  3CCR Z;  1VQ8 Z;  3HOX I;  2QKD A;  3LUS A;  1WCM I;  1M1K 1;  3I56 1;  4Y7N I;  4A3F I;  2PK7 A;  2P28 A;  1S72 Z;  4DK1 A;  1QVG Y;  1LQL A;  3NDJ A;  3KIF A;  4NBA A;  3VMG A;  1YI2 Z;  5IP7 I;  1VQN 1;  3MON A;  3CCQ 1;  2LFU A;  3CCL 1;  3GTJ I;  1TWH I;  3QWU A;  4NOZ A;  3BG0 B;  2E2J I;  3PO3 S;  5T67 A;  1QVF Z;  3S14 I;  3S1M I;  4NBC A;  2O4H A;  2M48 A;  1SFO I;  4CL1 A;  1YJN 1;  2W04 A;  2OTJ 1;  4MON A;  3CC4 Z;  3GTG I;  3S16 I;  1VQM Z;  1VQL Z;  1Z03 A;  3CCS 1;  3F3F C;  4A3K I;  5CM2 M;  3Q87 A;  4NFR A;  3G71 Z;  1VQO Z;  3U50 C;  3CC2 1;  1NUI A;  4E2Z A;  2EGT A;  1YIJ 1;  1PFT A;  2JA8 I;  1VQP Z;  2ZAE B;  3CCE 1;  4NBG A;  5T64 A;  2KI7 B;  1YIT 1;  3D9X A;  3S1Q I;  5IT9 b;  2QRE B;  3G6E Z;  3I4N I;  2NVQ I;  5AN9 F;  3OW2 Y;  2PMZ A;  4A3M I;  1YUA A;  2E9H A;  4NBD A;  1Z01 A;  4NBE A;  3PO2 I;  2E2H I;  4A3D I;  3GTM I;  1Q86 2;  4EWC A;  2J6A A;  3F3P C;  2IZ3 A;  3HOU I;  5C44 I;  1VQN Z;  1QVG Z;  1YI2 1;  1W2B Y;  2RHB A;  3PO3 I;  4XX2 A;  2VUM I;  3CCV Z;  5IP9 I;  5FLX f;  1RO2 A;  3VMH A;  5FLM I;  1M1K 2;  3I07 A;  2OTL 1;  4NBF A;  1NJI 1;  1YJN Z;  4NB8 A;  4HGZ A;  2YU9 I;  3TDH B;  3CCS Z;  1VQ9 1;  4MD7 A;  2QR1 B;  3G71 1;  1VQO 1;  1YIJ Z;  2JA6 I;  1RO0 A;  1Y1V S;  3CQZ I;  1VQ6 1;  1K9M 2;  1X0T A;  5D1O B;  3K7A I;  4RVH A;  4NH1 C;  1KD1 1;  1X3W A;  4A3L I;  4E2W A;  3G6E 1;  1N2F A;  2QA4 Z;  4A3J I;  5D1O A;  2JA7 I;  2QEX Z;  3CCU Z;  1I50 I;  3OW2 Z;  3H0G I;  3KIH A;  4RVG A;  4E33 A;  4TNU A;  3VMI A;  3GTM S;  3S17 I;  4RVD A;  1KQS Y;  4E30 A;  3CME 1;  2M6N A;  3CCV 1;  1YHQ 1;  1W2B Z;  1K9M 1;  2WAQ A;  1USP B;  3GKQ A;  1VQ4 1;  4DGL A;  1RNI A;  3GTQ I;  2NVT I;  1Y1W I;  3GTL I;  2OTL Z;  1JWH C;  3EER A;  2QRC B;  2JUB A;  1ZB8 A;  2QLV B;  1USP A;  1Q7Y 1;  2RPR A;  2KPI A;  3HOY I;  3GTP I;  3I55 Z;  3S1R I;  1VQ9 Z;  2DE6 A;  1WW9 A;  2Y0S A;  1Y1V I;  4RS4 A;  1TWC I;  1RO4 A;  1M90 2;  1VQ6 Z;  3S2D I;  4RV9 A;  3CPW Y;  1X3Z A;  2W03 A;  2JMO A;  4A3B I;  2NVX I;  2Q51 A;  1NJI 2;  3CC7 1;  3G4S Z;  2QA4 1;  4X6A I;  2QEX 1;  4E31 A;  3D6W A;  3CCU 1;  3HKZ A;  4MH4 A;  1YJ9 Z;  2BJO A;  3CMA 1;  3IF8 A;  3NFZ A;  1QF8 A;  4MXU A;  2V8J A;  3HOZ I;  2R93 I;  4A3C I;  2H85 A;  1YJW 1;  1KD1 2;  3CME Z;  4AYB A;  1M90 1;  4Y52 I;  2YAD A;  1YHQ Z;  2JR6 A;  4BY7 I;  2IZ4 A;  2RIQ A;  1JJ2 Y;  1VQ4 Z;  3M3Y I;  1KQS Z;  2OOX B;  1Q82 2;  2E2I I;  3ESW A;  5T6B A;  3H3V J;  3CXC Y;  2GTI A;  4BBS I;  3CCM 1;  1VQ7 1;  3EED A;  3J81 f;  3S2H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...