1I50I

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I01
1ZB9A 1TWAI 1ZB8A 3H0GI 1TFIA 3LUSA 3ESWA 3VMHA 4A3JI 3H3VJ 3VMGA 3PO3I 2JA6I 4BBSI 4A3BI 3S1RI 1WW9A 4XX2A 5C4JI 3S15I 2P3YA 2R93I 1PFTA 3HOZI 2JS4A 3S1QI 1ML8A 4NBDA 5FLMI 3GTQI 1TWCI 2F4MA 2YU9I 2F4OA 4A3EI 2NVTI 2JR6A 3VB9A 2BJOA 3I07A 3RZOI 1USPB 3U50C 3HOUI 3PO3S 4NBHA 1Y1VI 2JA7I 3D6WA 3M3YI 4BY7I 2K5RA 1TWHI 3GTPI 4A3MI 5C3EI 4NBEA 4NB8A 2NVXI 4A3LI 1I3QI 1TWGI 5IP9I 1Y1VS 2RBLA 2JA8I 5C4XI 2PK7A 4BBRI 5C44I 4QTTA 1RLYA 1R9TI 3PO2I 2J6AA 3GTMI 4A3GI 2E2II 3GTKI 3S2DI 1SFOI 4X6AI 4BXXI 3I4MI 4NBGA 4MH4A 2HF1A 3M4OI 2NVYI 3S1MI 2JNYA 2DE5A 3HOXI 3HOVI 4BY1I 3GKQA 1DL6A 2AKLA 3S1NI 3GTJI 3S14I 3GTMS 1L1OC 1X3ZA 2E2HI 3S17I 4A3DI 4A3FI 1YUAA 4QTUA 3GCFA 1X3WA 1Y1WI 4A3II 2E2JI 4NOZA 1N2FA 1USPA 3FKII 4NB9A 4NBAA 1LQLA 2KPIA 5CM2M 1I50I 2NVQI 1RO4A 3S2HI 3K7AI 1K83I 3GTLI 2VUMI 1TWFI 3RZDI 3GTOI 1VLAA 4Y52I 3VMIA 4A3CI 1WCMI 3EERA 2DE6A 3CQZI 5IP7I 4A93I 3HOWI 4Y7NI 3I4NI 1QYPA 4NBCA 3HOYI 4NBFA 4A3KI 2B63I 1NUIA 2R7ZI 4NBBA 3S16I 3Q87A 3GTGI 2R92I 1I6HI 2DE7A 2JA5I
chains in the Genus database with same CATH superfamily
1Q16A 3CC2Z 1ZB8A 3H0GI 3ESWA 1N8R1 1VQ4Z 1VQ51 1W2BY 4A3BI 1YJW1 4XX2A 1Q821 3S15I 2R93I 1K8A1 2JS4A 1ML8A 4E31A 4DK1A 5LL6f 1TWCI 2F4OA 3HKZA 1VQK1 3CPWZ 1Q7Y1 3G4S1 2JR6A 3VB9A 3FQQA 1USPB 3NH4A 3U50C 3HOUI 3PO3S 4MXUA 3I561 2ZAEB 3J81b 3NH8A 4BY7I 1YIJ1 2JIPA 1QVFY 1YJN1 5C3EI 4NB8A 2E7ZA 3G71Z 3IFUA 5FLXb 4E2YA 4MD8A 1Y1VS 3CC7Z 1VQ7Z 2RBLA 3CCSZ 4HGYA 1JJ2Z 2PK7A 5C44I 1RLYA 3PO2I 2KI7B 1M902 2HF1A 4MH4A 3VTNA 2NVYI 3HOVI 3CCJ1 2OTL1 1KD11 3NDJA 2NAPA 4RVHA 3S14I 5T64A 1VQLZ 1W2BZ 4A3DI 1YUAA 4QTUA 1RO0A 1K9M1 2E2JI 2PMZA 4NOZA 1RNIA 2VPWA 4NFRA 3J80f 2KPIA 5CM2M 1RO4A 2R6MA 2OOXB 2QRCB 4RS4A 3CXCZ 3JAMf 4MRIA 3OW2Y 5IP7I 3TDHB 3I4NI 1VQMZ 2B63I 2W03A 5IT9b 1KQSY 2QEXZ 3CME1 2RPRA 3Q87A 1Q822 3QWUA 1JJ2Y 3CCU1 1VQ61 2K3RA 3BG0B 3VMHA 2I3CA 3H3VJ 3VMGA 1VQ8Z 4BBSI 2IZ4A 3OW2Z 1YJ91 1WW9A 5C4JI 1QVGZ 1NP6A 2P3YA 4CL1A 3CCM1 1KD12 2RIQA 3CCE1 3GTQI 2F4MA 3CCS1 2VPZA 1VQO1 2RT9A 1RQFA 3I07A 3CD6Z 2IV2X 2JA7I 1QXFA 2JIRA 1S721 1FDOA 2K5RA 1TWHI 2AYDA 1ZH1A 4NBEA 4RVFA 2QRDB 2NVXI 1S72Z 2GU2A 5IP9I 2V8JA 2JA8I 5C4XI 3J81f 3CCVZ 2OOYB 2G2KA 3CCQZ 1VQOZ 3GTMI 1YIJZ 3S2DI 1SFOI 1VQ81 4HH4A 2M6NA 5FLXf 1NJI2 2JIQA 4BY1I 2Q4ZA 2QR1B 2H85A 3CC21 1YIT1 5AN9F 3MZLB 3GTMS 1P9NA 2O4HA 1N8R2 2LFUA 1VQM1 1VQ9Z 1X3ZA 3I56Z 3IF8A 1Z02A 1Y1WI 2OTJ1 3CCQ1 5A2Qf 1FDIA 2VF1A 2V8IA 3CCRZ 1I50I 2NVQI 2VUMI 4DGLA 1TWFI 5T6BA 3P5JB 3GTOI 2QKDA 1K732 2JIMA 5T67A 3F3FC 4A3CI 1WCMI 1VQPZ 2Y0SA 4Y7NI 3HOYI 2OTJZ 2O53A 1NUIA 4NBBA 3S16I 4RVDA 2M48A 3G6E1 3KIFA 1YHQZ 1YI21 2DE7A 1I6HI 2JA5I 1ZB9A 1YUKA 4A3JI 1M1K1 2QEX1 2V3VA 3CD61 3CC4Z 1YJNZ 4S1TA 4E30A 1Q812 3TE5B 2LIYA 1NJI1 1PFTA 3HOZI 3CCUZ 1VQ6Z 5FLMI 3G4SZ 2YU9I 3CCMZ 2VUGA 1K8A2 1K9M2 5D1PA 2BJOA 3RZOI 3NDIA 3CMA1 1Y1VI 3D6WA 4RV9A 3D9XA 3GTPI 4A3MI 3CMEZ 1X0TA 2JIOA 3I551 3G6EZ 4BBRI 1Q811 2LEXA 4A3GI 2OZKA 4MD7A 1WIIA 4X6AI 3CCR1 2YADA 4MD9A 3S1MI 2PM9A 1JWHC 3HOXI 3MONA 3NH5A 1Y8CA 2P28A 1DL6A 1S7MA 3CXCY 1L1OC 3GCFA 3J80b 4A3II 1YJ9Z 1Q862 1K731 1N2FA 1USPA 1YHQ1 3FKII 4NB9A 4NBAA 5A2Qb 1YJWZ 1K83I 3K7AI 2HU9A 2Q51A 3D2LA 3MZKB 3CCV1 3T4NB 3CCLZ 3BG1B 3VMIA 2DE6A 3CQZI 1AA6A 3HOWI 4A93I 3I55Z 4E2XA 1QYPA 1QVGY 4E2ZA 2R7ZI 4TNUA 1VQ41 3GTGI 5IT9f 1TWAI 3LUSA 3CMAZ 1TFIA 4MONA 3PO3I 3IR7A 1KC81 2JA6I 4RVGA 3S1RI 1VQN1 4E32A 1WZNA 1QF8A 3NFZA 1KQSZ 3S1QI 1VQL1 4NBDA 4A3EI 2V45A 1VQ91 2NVTI 3CCEZ 2EGTA 2VPXA 3FQMA 1Q7Y2 2WB1A 4NH1C 4DQYB 4NBHA 1VQ5Z 3KIHA 3M3YI 1RO2A 5D1OB 2W04A 4A3LI 4EWCA 1I3QI 2RHBA 3CC41 1TWGI 1Z03A 4QTTA 1KRLA 3F3PC 1VQNZ 1R9TI 1YI2Z 2J6AA 2E2II 2JUBA 3GTKI 2OTLZ 2QA4Z 4BXXI 3I4MI 4NBGA 3M4OI 2JNYA 1YITZ 1Z01A 2DE5A 3GKQA 3G711 2AKLA 3S1NI 3GTJI 1WJ2A 2IZ3A 1M901 1KC82 3J7A4 3CPWY 3CC71 1VQ71 2E2HI 1Q861 3S17I 4A3FI 1SIWA 1X3WA 5D1OA 4E2WA 2QLVB 1LQLA 1VQKZ 2QREB 3S2HI 1QVFZ 3GTLI 3EEDA 3JAMb 4E33A 3RZDI 4AYBA 2WAQA 1VLAA 3CCJZ 4Y52I 2QA41 2GTHA 3EERA 3CCL1 2E9HA 4HGZA 2VPYA 4NBCA 1M1K2 4NBFA 4A3KI 1VQP1 2GTIA 2V8KA 2JMOA 2R92I 3IX0A
chains in the Genus database with same CATH topology
3CC2Z 1ZB8A 3H0GI 3ESWA 1N8R1 1VQ4Z 1VQ51 1W2BY 4A3BI 1YJW1 4XX2A 1Q821 3S15I 2R93I 1K8A1 2JS4A 1ML8A 4E31A 4DK1A 5LL6f 1TWCI 2F4OA 3HKZA 1VQK1 3CPWZ 1Q7Y1 3G4S1 2JR6A 3VB9A 3FQQA 1USPB 3NH4A 3U50C 3HOUI 3PO3S 4MXUA 3I561 2ZAEB 3J81b 3NH8A 4BY7I 1YIJ1 1QVFY 1YJN1 5C3EI 4NB8A 3G71Z 3IFUA 5FLXb 4E2YA 4MD8A 1Y1VS 3CC7Z 1VQ7Z 2RBLA 3CCSZ 4HGYA 1JJ2Z 2PK7A 5C44I 1RLYA 3PO2I 2KI7B 1M902 2HF1A 4MH4A 3VTNA 2NVYI 3HOVI 3CCJ1 2OTL1 1KD11 3NDJA 4RVHA 3S14I 5T64A 1VQLZ 1W2BZ 4A3DI 1YUAA 4QTUA 1RO0A 1K9M1 2E2JI 2PMZA 4NOZA 1RNIA 4NFRA 3J80f 2KPIA 5CM2M 1RO4A 2R6MA 2OOXB 2QRCB 4RS4A 3CXCZ 3JAMf 4MRIA 5IP7I 3OW2Y 3TDHB 3I4NI 1VQMZ 2B63I 2W03A 5IT9b 1KQSY 2QEXZ 3CME1 2RPRA 3Q87A 1Q822 3QWUA 1JJ2Y 3CCU1 1VQ61 2K3RA 3BG0B 3VMHA 2I3CA 3H3VJ 3VMGA 1VQ8Z 4BBSI 2IZ4A 3OW2Z 1YJ91 1WW9A 5C4JI 1QVGZ 1NP6A 2P3YA 4CL1A 3CCM1 1KD12 2RIQA 3CCE1 3GTQI 2F4MA 3CCS1 1VQO1 2RT9A 1RQFA 3I07A 3CD6Z 2JA7I 1S721 2K5RA 1TWHI 1ZH1A 4NBEA 4RVFA 2QRDB 2NVXI 1S72Z 2GU2A 5IP9I 2V8JA 2JA8I 5C4XI 3J81f 3CCVZ 2OOYB 2G2KA 3CCQZ 1VQOZ 3GTMI 1YIJZ 3S2DI 1SFOI 1VQ81 4HH4A 2M6NA 5FLXf 1NJI2 4BY1I 2Q4ZA 2QR1B 2H85A 3CC21 1YIT1 5AN9F 3MZLB 3GTMS 1P9NA 2O4HA 1N8R2 2LFUA 1VQM1 1VQ9Z 1X3ZA 3I56Z 3IF8A 1Z02A 1Y1WI 2OTJ1 3CCQ1 5A2Qf 2VF1A 2V8IA 3CCRZ 1I50I 2NVQI 2VUMI 4DGLA 1TWFI 5T6BA 3P5JB 3GTOI 2QKDA 1K732 5T67A 3F3FC 4A3CI 1WCMI 1VQPZ 2Y0SA 4Y7NI 3HOYI 2OTJZ 2O53A 1NUIA 4NBBA 3S16I 4RVDA 2M48A 3G6E1 3KIFA 1YHQZ 1YI21 2DE7A 1I6HI 2JA5I 1ZB9A 1YUKA 4A3JI 1M1K1 2QEX1 3CD61 3CC4Z 1YJNZ 4S1TA 4E30A 1Q812 3TE5B 2LIYA 1NJI1 1PFTA 3HOZI 3CCUZ 1VQ6Z 5FLMI 3G4SZ 2YU9I 3CCMZ 2VUGA 1K8A2 1K9M2 5D1PA 2BJOA 3RZOI 3NDIA 3CMA1 1Y1VI 3D6WA 4RV9A 3D9XA 3GTPI 4A3MI 3CMEZ 1X0TA 3I551 3G6EZ 4BBRI 1Q811 4A3GI 2OZKA 4MD7A 1WIIA 4X6AI 3CCR1 2YADA 4MD9A 3S1MI 2PM9A 1JWHC 3HOXI 3MONA 3NH5A 2P28A 1DL6A 1S7MA 3CXCY 1L1OC 3GCFA 3J80b 4A3II 1YJ9Z 1Q862 1K731 1N2FA 1USPA 1YHQ1 3FKII 4NB9A 4NBAA 5A2Qb 1YJWZ 1K83I 3K7AI 2HU9A 2Q51A 3MZKB 3CCV1 3T4NB 3CCLZ 3BG1B 3VMIA 2DE6A 3CQZI 4A93I 3HOWI 3I55Z 4E2XA 1QYPA 1QVGY 4E2ZA 2R7ZI 4TNUA 1VQ41 3GTGI 5IT9f 1TWAI 3LUSA 3CMAZ 1TFIA 4MONA 3PO3I 1KC81 2JA6I 4RVGA 3S1RI 1VQN1 4E32A 1QF8A 3NFZA 1KQSZ 3S1QI 1VQL1 4NBDA 4A3EI 1VQ91 2NVTI 3CCEZ 2EGTA 3FQMA 1Q7Y2 2WB1A 4NH1C 4DQYB 4NBHA 1VQ5Z 3KIHA 3M3YI 1RO2A 5D1OB 2W04A 4A3LI 4EWCA 1I3QI 2RHBA 3CC41 1TWGI 1Z03A 4QTTA 1KRLA 3F3PC 1VQNZ 1R9TI 1YI2Z 2J6AA 2E2II 2JUBA 3GTKI 2OTLZ 2QA4Z 4BXXI 3I4MI 4NBGA 3M4OI 2JNYA 1YITZ 1Z01A 2DE5A 3GKQA 3G711 2AKLA 3S1NI 3GTJI 2IZ3A 1M901 1KC82 3J7A4 3CPWY 3CC71 1VQ71 2E2HI 1Q861 3S17I 4A3FI 1X3WA 5D1OA 4E2WA 2QLVB 1LQLA 1VQKZ 2QREB 3S2HI 1QVFZ 3GTLI 3EEDA 3JAMb 4E33A 3RZDI 4AYBA 2WAQA 1VLAA 3CCJZ 4Y52I 2QA41 2GTHA 3EERA 3CCL1 2E9HA 4HGZA 4NBCA 1M1K2 4NBFA 4A3KI 1VQP1 2GTIA 2V8KA 2JMOA 2R92I 3IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB9 A;  1TWA I;  1ZB8 A;  3H0G I;  1TFI A;  3LUS A;  3ESW A;  3VMH A;  4A3J I;  3H3V J;  3VMG A;  3PO3 I;  2JA6 I;  4BBS I;  4A3B I;  3S1R I;  1WW9 A;  4XX2 A;  5C4J I;  3S15 I;  2P3Y A;  2R93 I;  1PFT A;  3HOZ I;  2JS4 A;  3S1Q I;  1ML8 A;  4NBD A;  5FLM I;  3GTQ I;  1TWC I;  2F4M A;  2YU9 I;  2F4O A;  4A3E I;  2NVT I;  2JR6 A;  3VB9 A;  2BJO A;  3I07 A;  3RZO I;  1USP B;  3U50 C;  3HOU I;  3PO3 S;  4NBH A;  1Y1V I;  2JA7 I;  3D6W A;  3M3Y I;  4BY7 I;  2K5R A;  1TWH I;  3GTP I;  4A3M I;  5C3E I;  4NBE A;  4NB8 A;  2NVX I;  4A3L I;  1I3Q I;  1TWG I;  5IP9 I;  1Y1V S;  2RBL A;  2JA8 I;  5C4X I;  2PK7 A;  4BBR I;  5C44 I;  4QTT A;  1RLY A;  1R9T I;  3PO2 I;  2J6A A;  3GTM I;  4A3G I;  2E2I I;  3GTK I;  3S2D I;  1SFO I;  4X6A I;  4BXX I;  3I4M I;  4NBG A;  4MH4 A;  2HF1 A;  3M4O I;  2NVY I;  3S1M I;  2JNY A;  2DE5 A;  3HOX I;  3HOV I;  4BY1 I;  3GKQ A;  1DL6 A;  2AKL A;  3S1N I;  3GTJ I;  3S14 I;  3GTM S;  1L1O C;  1X3Z A;  2E2H I;  3S17 I;  4A3D I;  4A3F I;  1YUA A;  4QTU A;  3GCF A;  1X3W A;  1Y1W I;  4A3I I;  2E2J I;  4NOZ A;  1N2F A;  1USP A;  3FKI I;  4NB9 A;  4NBA A;  1LQL A;  2KPI A;  5CM2 M;  1I50 I;  2NVQ I;  1RO4 A;  3S2H I;  3K7A I;  1K83 I;  3GTL I;  2VUM I;  1TWF I;  3RZD I;  3GTO I;  1VLA A;  4Y52 I;  3VMI A;  4A3C I;  1WCM I;  3EER A;  2DE6 A;  3CQZ I;  5IP7 I;  4A93 I;  3HOW I;  4Y7N I;  3I4N I;  1QYP A;  4NBC A;  3HOY I;  4NBF A;  4A3K I;  2B63 I;  1NUI A;  2R7Z I;  4NBB A;  3S16 I;  3Q87 A;  3GTG I;  2R92 I;  1I6H I;  2DE7 A;  2JA5 I; 
#chains in the Genus database with same CATH topology
 1Q16 A;  3CC2 Z;  1ZB8 A;  3H0G I;  3ESW A;  1N8R 1;  1VQ4 Z;  1VQ5 1;  1W2B Y;  4A3B I;  1YJW 1;  4XX2 A;  1Q82 1;  3S15 I;  2R93 I;  1K8A 1;  2JS4 A;  1ML8 A;  4E31 A;  4DK1 A;  5LL6 f;  1TWC I;  2F4O A;  3HKZ A;  1VQK 1;  3CPW Z;  1Q7Y 1;  3G4S 1;  2JR6 A;  3VB9 A;  3FQQ A;  1USP B;  3NH4 A;  3U50 C;  3HOU I;  3PO3 S;  4MXU A;  3I56 1;  2ZAE B;  3J81 b;  3NH8 A;  4BY7 I;  1YIJ 1;  2JIP A;  1QVF Y;  1YJN 1;  5C3E I;  4NB8 A;  2E7Z A;  3G71 Z;  3IFU A;  5FLX b;  4E2Y A;  4MD8 A;  1Y1V S;  3CC7 Z;  1VQ7 Z;  2RBL A;  3CCS Z;  4HGY A;  1JJ2 Z;  2PK7 A;  5C44 I;  1RLY A;  3PO2 I;  2KI7 B;  1M90 2;  2HF1 A;  4MH4 A;  3VTN A;  2NVY I;  3HOV I;  3CCJ 1;  2OTL 1;  1KD1 1;  3NDJ A;  2NAP A;  4RVH A;  3S14 I;  5T64 A;  1VQL Z;  1W2B Z;  4A3D I;  1YUA A;  4QTU A;  1RO0 A;  1K9M 1;  2E2J I;  2PMZ A;  4NOZ A;  1RNI A;  2VPW A;  4NFR A;  3J80 f;  2KPI A;  5CM2 M;  1RO4 A;  2R6M A;  2OOX B;  2QRC B;  4RS4 A;  3CXC Z;  3JAM f;  4MRI A;  3OW2 Y;  5IP7 I;  3TDH B;  3I4N I;  1VQM Z;  2B63 I;  2W03 A;  5IT9 b;  1KQS Y;  2QEX Z;  3CME 1;  2RPR A;  3Q87 A;  1Q82 2;  3QWU A;  1JJ2 Y;  3CCU 1;  1VQ6 1;  2K3R A;  3BG0 B;  3VMH A;  2I3C A;  3H3V J;  3VMG A;  1VQ8 Z;  4BBS I;  2IZ4 A;  3OW2 Z;  1YJ9 1;  1WW9 A;  5C4J I;  1QVG Z;  1NP6 A;  2P3Y A;  4CL1 A;  3CCM 1;  1KD1 2;  2RIQ A;  3CCE 1;  3GTQ I;  2F4M A;  3CCS 1;  2VPZ A;  1VQO 1;  2RT9 A;  1RQF A;  3I07 A;  3CD6 Z;  2IV2 X;  2JA7 I;  1QXF A;  2JIR A;  1S72 1;  1FDO A;  2K5R A;  1TWH I;  2AYD A;  1ZH1 A;  4NBE A;  4RVF A;  2QRD B;  2NVX I;  1S72 Z;  2GU2 A;  5IP9 I;  2V8J A;  2JA8 I;  5C4X I;  3J81 f;  3CCV Z;  2OOY B;  2G2K A;  3CCQ Z;  1VQO Z;  3GTM I;  1YIJ Z;  3S2D I;  1SFO I;  1VQ8 1;  4HH4 A;  2M6N A;  5FLX f;  1NJI 2;  2JIQ A;  4BY1 I;  2Q4Z A;  2QR1 B;  2H85 A;  3CC2 1;  1YIT 1;  5AN9 F;  3MZL B;  3GTM S;  1P9N A;  2O4H A;  1N8R 2;  2LFU A;  1VQM 1;  1VQ9 Z;  1X3Z A;  3I56 Z;  3IF8 A;  1Z02 A;  1Y1W I;  2OTJ 1;  3CCQ 1;  5A2Q f;  1FDI A;  2VF1 A;  2V8I A;  3CCR Z;  1I50 I;  2NVQ I;  2VUM I;  4DGL A;  1TWF I;  5T6B A;  3P5J B;  3GTO I;  2QKD A;  1K73 2;  2JIM A;  5T67 A;  3F3F C;  4A3C I;  1WCM I;  1VQP Z;  2Y0S A;  4Y7N I;  3HOY I;  2OTJ Z;  2O53 A;  1NUI A;  4NBB A;  3S16 I;  4RVD A;  2M48 A;  3G6E 1;  3KIF A;  1YHQ Z;  1YI2 1;  2DE7 A;  1I6H I;  2JA5 I;  1ZB9 A;  1YUK A;  4A3J I;  1M1K 1;  2QEX 1;  2V3V A;  3CD6 1;  3CC4 Z;  1YJN Z;  4S1T A;  4E30 A;  1Q81 2;  3TE5 B;  2LIY A;  1NJI 1;  1PFT A;  3HOZ I;  3CCU Z;  1VQ6 Z;  5FLM I;  3G4S Z;  2YU9 I;  3CCM Z;  2VUG A;  1K8A 2;  1K9M 2;  5D1P A;  2BJO A;  3RZO I;  3NDI A;  3CMA 1;  1Y1V I;  3D6W A;  4RV9 A;  3D9X A;  3GTP I;  4A3M I;  3CME Z;  1X0T A;  2JIO A;  3I55 1;  3G6E Z;  4BBR I;  1Q81 1;  2LEX A;  4A3G I;  2OZK A;  4MD7 A;  1WII A;  4X6A I;  3CCR 1;  2YAD A;  4MD9 A;  3S1M I;  2PM9 A;  1JWH C;  3HOX I;  3MON A;  3NH5 A;  1Y8C A;  2P28 A;  1DL6 A;  1S7M A;  3CXC Y;  1L1O C;  3GCF A;  3J80 b;  4A3I I;  1YJ9 Z;  1Q86 2;  1K73 1;  1N2F A;  1USP A;  1YHQ 1;  3FKI I;  4NB9 A;  4NBA A;  5A2Q b;  1YJW Z;  1K83 I;  3K7A I;  2HU9 A;  2Q51 A;  3D2L A;  3MZK B;  3CCV 1;  3T4N B;  3CCL Z;  3BG1 B;  3VMI A;  2DE6 A;  3CQZ I;  1AA6 A;  3HOW I;  4A93 I;  3I55 Z;  4E2X A;  1QYP A;  1QVG Y;  4E2Z A;  2R7Z I;  4TNU A;  1VQ4 1;  3GTG I;  5IT9 f;  1TWA I;  3LUS A;  3CMA Z;  1TFI A;  4MON A;  3PO3 I;  3IR7 A;  1KC8 1;  2JA6 I;  4RVG A;  3S1R I;  1VQN 1;  4E32 A;  1WZN A;  1QF8 A;  3NFZ A;  1KQS Z;  3S1Q I;  1VQL 1;  4NBD A;  4A3E I;  2V45 A;  1VQ9 1;  2NVT I;  3CCE Z;  2EGT A;  2VPX A;  3FQM A;  1Q7Y 2;  2WB1 A;  4NH1 C;  4DQY B;  4NBH A;  1VQ5 Z;  3KIH A;  3M3Y I;  1RO2 A;  5D1O B;  2W04 A;  4A3L I;  4EWC A;  1I3Q I;  2RHB A;  3CC4 1;  1TWG I;  1Z03 A;  4QTT A;  1KRL A;  3F3P C;  1VQN Z;  1R9T I;  1YI2 Z;  2J6A A;  2E2I I;  2JUB A;  3GTK I;  2OTL Z;  2QA4 Z;  4BXX I;  3I4M I;  4NBG A;  3M4O I;  2JNY A;  1YIT Z;  1Z01 A;  2DE5 A;  3GKQ A;  3G71 1;  2AKL A;  3S1N I;  3GTJ I;  1WJ2 A;  2IZ3 A;  1M90 1;  1KC8 2;  3J7A 4;  3CPW Y;  3CC7 1;  1VQ7 1;  2E2H I;  1Q86 1;  3S17 I;  4A3F I;  1SIW A;  1X3W A;  5D1O A;  4E2W A;  2QLV B;  1LQL A;  1VQK Z;  2QRE B;  3S2H I;  1QVF Z;  3GTL I;  3EED A;  3JAM b;  4E33 A;  3RZD I;  4AYB A;  2WAQ A;  1VLA A;  3CCJ Z;  4Y52 I;  2QA4 1;  2GTH A;  3EER A;  3CCL 1;  2E9H A;  4HGZ A;  2VPY A;  4NBC A;  1M1K 2;  4NBF A;  4A3K I;  1VQP 1;  2GTI A;  2V8K A;  2JMO A;  2R92 I;  3IX0 A; 
#chains in the Genus database with same CATH homology
 3CC2 Z;  1ZB8 A;  3H0G I;  3ESW A;  1N8R 1;  1VQ4 Z;  1VQ5 1;  1W2B Y;  4A3B I;  1YJW 1;  4XX2 A;  1Q82 1;  3S15 I;  2R93 I;  1K8A 1;  2JS4 A;  1ML8 A;  4E31 A;  4DK1 A;  5LL6 f;  1TWC I;  2F4O A;  3HKZ A;  1VQK 1;  3CPW Z;  1Q7Y 1;  3G4S 1;  2JR6 A;  3VB9 A;  3FQQ A;  1USP B;  3NH4 A;  3U50 C;  3HOU I;  3PO3 S;  4MXU A;  3I56 1;  2ZAE B;  3J81 b;  3NH8 A;  4BY7 I;  1YIJ 1;  1QVF Y;  1YJN 1;  5C3E I;  4NB8 A;  3G71 Z;  3IFU A;  5FLX b;  4E2Y A;  4MD8 A;  1Y1V S;  3CC7 Z;  1VQ7 Z;  2RBL A;  3CCS Z;  4HGY A;  1JJ2 Z;  2PK7 A;  5C44 I;  1RLY A;  3PO2 I;  2KI7 B;  1M90 2;  2HF1 A;  4MH4 A;  3VTN A;  2NVY I;  3HOV I;  3CCJ 1;  2OTL 1;  1KD1 1;  3NDJ A;  4RVH A;  3S14 I;  5T64 A;  1VQL Z;  1W2B Z;  4A3D I;  1YUA A;  4QTU A;  1RO0 A;  1K9M 1;  2E2J I;  2PMZ A;  4NOZ A;  1RNI A;  4NFR A;  3J80 f;  2KPI A;  5CM2 M;  1RO4 A;  2R6M A;  2OOX B;  2QRC B;  4RS4 A;  3CXC Z;  3JAM f;  4MRI A;  5IP7 I;  3OW2 Y;  3TDH B;  3I4N I;  1VQM Z;  2B63 I;  2W03 A;  5IT9 b;  1KQS Y;  2QEX Z;  3CME 1;  2RPR A;  3Q87 A;  1Q82 2;  3QWU A;  1JJ2 Y;  3CCU 1;  1VQ6 1;  2K3R A;  3BG0 B;  3VMH A;  2I3C A;  3H3V J;  3VMG A;  1VQ8 Z;  4BBS I;  2IZ4 A;  3OW2 Z;  1YJ9 1;  1WW9 A;  5C4J I;  1QVG Z;  1NP6 A;  2P3Y A;  4CL1 A;  3CCM 1;  1KD1 2;  2RIQ A;  3CCE 1;  3GTQ I;  2F4M A;  3CCS 1;  1VQO 1;  2RT9 A;  1RQF A;  3I07 A;  3CD6 Z;  2JA7 I;  1S72 1;  2K5R A;  1TWH I;  1ZH1 A;  4NBE A;  4RVF A;  2QRD B;  2NVX I;  1S72 Z;  2GU2 A;  5IP9 I;  2V8J A;  2JA8 I;  5C4X I;  3J81 f;  3CCV Z;  2OOY B;  2G2K A;  3CCQ Z;  1VQO Z;  3GTM I;  1YIJ Z;  3S2D I;  1SFO I;  1VQ8 1;  4HH4 A;  2M6N A;  5FLX f;  1NJI 2;  4BY1 I;  2Q4Z A;  2QR1 B;  2H85 A;  3CC2 1;  1YIT 1;  5AN9 F;  3MZL B;  3GTM S;  1P9N A;  2O4H A;  1N8R 2;  2LFU A;  1VQM 1;  1VQ9 Z;  1X3Z A;  3I56 Z;  3IF8 A;  1Z02 A;  1Y1W I;  2OTJ 1;  3CCQ 1;  5A2Q f;  2VF1 A;  2V8I A;  3CCR Z;  1I50 I;  2NVQ I;  2VUM I;  4DGL A;  1TWF I;  5T6B A;  3P5J B;  3GTO I;  2QKD A;  1K73 2;  5T67 A;  3F3F C;  4A3C I;  1WCM I;  1VQP Z;  2Y0S A;  4Y7N I;  3HOY I;  2OTJ Z;  2O53 A;  1NUI A;  4NBB A;  3S16 I;  4RVD A;  2M48 A;  3G6E 1;  3KIF A;  1YHQ Z;  1YI2 1;  2DE7 A;  1I6H I;  2JA5 I;  1ZB9 A;  1YUK A;  4A3J I;  1M1K 1;  2QEX 1;  3CD6 1;  3CC4 Z;  1YJN Z;  4S1T A;  4E30 A;  1Q81 2;  3TE5 B;  2LIY A;  1NJI 1;  1PFT A;  3HOZ I;  3CCU Z;  1VQ6 Z;  5FLM I;  3G4S Z;  2YU9 I;  3CCM Z;  2VUG A;  1K8A 2;  1K9M 2;  5D1P A;  2BJO A;  3RZO I;  3NDI A;  3CMA 1;  1Y1V I;  3D6W A;  4RV9 A;  3D9X A;  3GTP I;  4A3M I;  3CME Z;  1X0T A;  3I55 1;  3G6E Z;  4BBR I;  1Q81 1;  4A3G I;  2OZK A;  4MD7 A;  1WII A;  4X6A I;  3CCR 1;  2YAD A;  4MD9 A;  3S1M I;  2PM9 A;  1JWH C;  3HOX I;  3MON A;  3NH5 A;  2P28 A;  1DL6 A;  1S7M A;  3CXC Y;  1L1O C;  3GCF A;  3J80 b;  4A3I I;  1YJ9 Z;  1Q86 2;  1K73 1;  1N2F A;  1USP A;  1YHQ 1;  3FKI I;  4NB9 A;  4NBA A;  5A2Q b;  1YJW Z;  1K83 I;  3K7A I;  2HU9 A;  2Q51 A;  3MZK B;  3CCV 1;  3T4N B;  3CCL Z;  3BG1 B;  3VMI A;  2DE6 A;  3CQZ I;  4A93 I;  3HOW I;  3I55 Z;  4E2X A;  1QYP A;  1QVG Y;  4E2Z A;  2R7Z I;  4TNU A;  1VQ4 1;  3GTG I;  5IT9 f;  1TWA I;  3LUS A;  3CMA Z;  1TFI A;  4MON A;  3PO3 I;  1KC8 1;  2JA6 I;  4RVG A;  3S1R I;  1VQN 1;  4E32 A;  1QF8 A;  3NFZ A;  1KQS Z;  3S1Q I;  1VQL 1;  4NBD A;  4A3E I;  1VQ9 1;  2NVT I;  3CCE Z;  2EGT A;  3FQM A;  1Q7Y 2;  2WB1 A;  4NH1 C;  4DQY B;  4NBH A;  1VQ5 Z;  3KIH A;  3M3Y I;  1RO2 A;  5D1O B;  2W04 A;  4A3L I;  4EWC A;  1I3Q I;  2RHB A;  3CC4 1;  1TWG I;  1Z03 A;  4QTT A;  1KRL A;  3F3P C;  1VQN Z;  1R9T I;  1YI2 Z;  2J6A A;  2E2I I;  2JUB A;  3GTK I;  2OTL Z;  2QA4 Z;  4BXX I;  3I4M I;  4NBG A;  3M4O I;  2JNY A;  1YIT Z;  1Z01 A;  2DE5 A;  3GKQ A;  3G71 1;  2AKL A;  3S1N I;  3GTJ I;  2IZ3 A;  1M90 1;  1KC8 2;  3J7A 4;  3CPW Y;  3CC7 1;  1VQ7 1;  2E2H I;  1Q86 1;  3S17 I;  4A3F I;  1X3W A;  5D1O A;  4E2W A;  2QLV B;  1LQL A;  1VQK Z;  2QRE B;  3S2H I;  1QVF Z;  3GTL I;  3EED A;  3JAM b;  4E33 A;  3RZD I;  4AYB A;  2WAQ A;  1VLA A;  3CCJ Z;  4Y52 I;  2QA4 1;  2GTH A;  3EER A;  3CCL 1;  2E9H A;  4HGZ A;  4NBC A;  1M1K 2;  4NBF A;  4A3K I;  1VQP 1;  2GTI A;  2V8K A;  2JMO A;  2R92 I;  3IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...