1I50I

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I01
3HOUI 2JA7I 2VUMI 4NBGA 2J6AA 2JA8I 2E2II 1Y1VI 2JNYA 3HOVI 4NB9A 3HOZI 1Y1VS 4NBDA 4A3CI 1WCMI 1TWHI 3GTLI 5CM2M 1QYPA 4A3BI 2B63I 3M4OI 2PK7A 1RLYA 5FLMI 5IP9I 3S1RI 2AKLA 3RZDI 3FKII 2E2JI 2BJOA 5C4XI 4NBEA 3EERA 3GKQA 3M3YI 4A3MI 1ZB9A 3LUSA 1I3QI 3S1NI 3ESWA 3I07A 4NBCA 1USPA 2K5RA 3H3VJ 3RZOI 1PFTA 3HOXI 4XX2A 3S2DI 4A93I 3GTPI 1TFIA 2HF1A 3D6WA 1RO4A 3S1QI 4Y52I 5IP7I 3I4NI 3S16I 4A3DI 3GTOI 1I6HI 4BBRI 1N2FA 1LQLA 1ML8A 3GTMI 1TWAI 2JS4A 4NBFA 3I4MI 1K83I 3S15I 4NBBA 4X6AI 2JR6A 3HOWI 2NVYI 4A3II 3Q87A 3GTKI 3GTGI 1Y1WI 4NBAA 2YU9I 1WW9A 2NVTI 1X3ZA 2NVXI 2NVQI 2JA6I 3U50C 3CQZI 4A3JI 2E2HI 2R92I 4Y7NI 5C44I 1X3WA 2KPIA 3VMGA 3VMHA 1TWFI 1L1OC 3S14I 4BY7I 2RBLA 3VMIA 3GTQI 3S17I 4A3FI 2F4OA 4NBHA 1SFOI 2DE5A 4MH4A 1TWGI 3S1MI 2F4MA 4A3EI 4A3LI 1NUIA 1USPB 3S2HI 4BY1I 4BXXI 3PO2I 1YUAA 4A3KI 2R7ZI 3GCFA 3GTMS 3K7AI 3VB9A 3GTJI 1TWCI 4A3GI 1ZB8A 4QTUA 2JA5I 2DE6A 2P3YA 3PO3I 2R93I 4NB8A 1DL6A 4BBSI 4QTTA 1I50I 1R9TI 1VLAA 3H0GI 2DE7A 3PO3S 5C4JI 3HOYI 4NOZA 5C3EI
chains in the Genus database with same CATH superfamily
1QVGY 2J6AA 4CL1A 2YADA 3HOZI 4A3CI 1NP6A 3GTLI 4DK1A 1Q822 2B63I 3KIFA 1Z01A 1Q861 1RLYA 5IP9I 3S1RI 3CCV1 3CCR1 3CC4Z 3NH8A 1Q7Y1 1K732 2OTJ1 1VQ91 2QKDA 1VQ41 4MONA 4HGZA 4A3MI 2Q51A 1KQSZ 1W2BY 1N8R1 1I3QI 4RV9A 3S1NI 1RNIA 2JUBA 3CC7Z 3NH4A 4DGLA 2G2KA 2K3RA 1RO4A 3F3FC 3EEDA 2V45A 4A3DI 3J7A4 2VPXA 3GTMI 1VQ7Z 1K83I 1YI2Z 4NBBA 3HOWI 2NVYI 3CXCY 1Y1WI 2YU9I 1RO2A 2VPWA 1VQP1 1M1K1 3CD6Z 2I3CA 3U50C 5C44I 2OTJZ 2KPIA 2RIQA 2GTIA 1VQ61 2Q4ZA 4E32A 2F4OA 4MH4A 1ZH1A 1S721 1YIJ1 4S1TA 2R6MA 3JAMb 3CC2Z 4E2XA 1S7MA 3NH5A 4MD9A 2QEX1 4A3KI 1Z03A 1YHQZ 3CCS1 1YJWZ 3JAMf 3I56Z 4E30A 3GCFA 3TE5B 3K7AI 3GTJI 3CPWY 2JIOA 2WAQA 1ZB8A 3PO3I 3D9XA 2V8JA 3PO3S 4NH1C 5C4JI 1Q7Y2 3CMA1 3FQMA 4NBGA 2JA8I 1Q811 3CD61 1WCMI 3J80b 1TWHI 3T4NB 5AN9F 2V8IA 5A2Qb 1Q812 2AKLA 1YIT1 4E31A 2JMOA 4RS4A 3M3YI 1JWHC 1ZB9A 3MONA 4NBCA 2OOYB 4EWCA 1VQ71 4E2YA 1VQ5Z 3CCVZ 3IFUA 1K8A1 3CC41 3CCRZ 3CCJ1 1PFTA 2IV2X 2M48A 3I55Z 1NJI2 2AYDA 2IZ3A 3I4NI 2M6NA 1FDIA 2LEXA 1VQPZ 1VQ8Z 2NAPA 1WZNA 3TDHB 2LFUA 1JJ2Z 1P9NA 1VQOZ 1TWAI 3OW2Y 3I4MI 3S15I 2JR6A 4A3II 4RVDA 2PMZA 3GTGI 3CXCZ 3G4SZ 1YIJZ 1WW9A 1QXFA 2WB1A 2JIQA 1X3ZA 2H85A 3G6E1 4MRIA 2NVQI 2JIRA 4A3JI 2E2HI 4Y7NI 2O4HA 1X3WA 3VMHA 2E7ZA 3GTQI 1KC81 1QF8A 3I561 2DE5A 3S1MI 4A3EI 3KIHA 3MZKB 1USPB 3S2HI 1X0TA 1K8A2 5A2Qf 2VPYA 3MZLB 2HU9A 1VQ81 4TNUA 2V8KA 1VQM1 3NDJA 1VQNZ 3IR7A 4BXXI 1TWCI 4MXUA 2P3YA 1S72Z 1VLAA 3CCUZ 2DE7A 1M902 3HOYI 2PM9A 2QR1B 1YJ91 1K9M1 3HOUI 3G4S1 2JA7I 3HOVI 2E2II 4NB9A 2QRDB 1Q862 1Y1VS 1Q821 3CCSZ 1YJW1 4RVHA 1YI21 1QVGZ 4A3BI 3M4OI 2PK7A 1SIWA 1VQL1 5D1PA 5FLMI 2OTLZ 1Z02A 2JIPA 3FKII 3CCJZ 1K9M2 3I551 1Y8CA 3CCQZ 1M901 2BJOA 4NBEA 3EERA 3GKQA 4DQYB 2LIYA 3LUSA 4MD7A 3ESWA 2OOXB 1VQK1 4HH4A 2JIMA 2K5RA 3CMEZ 1KQSY 3VTNA 3H3VJ 3RZOI 2W04A 2VUGA 4XX2A 3HOXI 3S2DI 2HF1A 3S1QI 4Y52I 5IP7I 2W03A 3S16I 1WJ2A 5D1OA 3CCM1 1KD12 2KI7B 1N2FA 1KRLA 1LQLA 1WIIA 1ML8A 2GU2A 3NFZA 2RHBA 3J80f 4X6AI 3Q87A 1M1K2 3GTKI 4E33A 4NBAA 3CMAZ 1RQFA 3J81f 2NVTI 5FLXf 3F3PC 2NVXI 2VF1A 3CCQ1 1YJNZ 1YUKA 3VMGA 1L1OC 4BY7I 4E2WA 3D2LA 3VMIA 1VQO1 3S17I 1KD11 2QLVB 3G711 3CME1 2F4MA 3CCU1 4A3LI 1NJI1 1NUIA 2V3VA 5FLXb 3G6EZ 3J81b 1FDOA 3BG0B 5IT9b 1N8R2 3GTMS 2OZKA 4QTUA 2JA5I 2DE6A 2IZ4A 4NB8A 2OTL1 1R9TI 1I50I 4BBSI 2GTHA 3CPWZ 2VUMI 1Y1VI 2JNYA 2QREB 2O53A 4NBDA 5CM2M 1QYPA 3CCLZ 2P28A 3RZDI 3BG1B 2E2JI 1YJ9Z 5C4XI 4AYBA 1W2BZ 2QA41 3I07A 1USPA 1VQLZ 1YHQ1 3IX0A 3FQQA 4RVFA 4A93I 3GTPI 1TFIA 3D6WA 2RT9A 1VQ9Z 1VQ4Z 5T67A 5T6BA 2VPZA 1YJN1 3CCE1 3GTOI 1KC82 1I6HI 4BBRI 1VQMZ 5IT9f 1VQKZ 1VQN1 1RO0A 3NDIA 2QRCB 3CC71 2JS4A 4NBFA 5LL6f 3HKZA 3CCL1 3G71Z 3IF8A 1JJ2Y 2EGTA 3QWUA 2E9HA 2JA6I 2RPRA 3CQZI 3CCMZ 4E2ZA 2R92I 3CC21 5D1OB 1TWFI 3S14I 2QEXZ 3P5JB 2RBLA 2ZAEB 4A3FI 1Q16A 2QA4Z 4NBHA 1SFOI 1QVFZ 2Y0SA 4NFRA 1TWGI 1VQ51 4BY1I 1QVFY 4MD8A 3PO2I 1YUAA 5T64A 1VQ6Z 3OW2Z 3CCEZ 2R7ZI 4RVGA 3VB9A 4A3GI 1AA6A 4HGYA 2R93I 1DL6A 4QTTA 1K731 3H0GI 1YITZ 4NOZA 5C3EI
chains in the Genus database with same CATH topology
1QVGY 2J6AA 4CL1A 2YADA 3HOZI 4A3CI 1NP6A 3GTLI 4DK1A 1Q822 2B63I 3KIFA 1Z01A 1Q861 1RLYA 5IP9I 3S1RI 3CCV1 3CCR1 3CC4Z 3NH8A 1Q7Y1 1K732 2OTJ1 1VQ91 2QKDA 1VQ41 4MONA 4HGZA 4A3MI 2Q51A 1KQSZ 1W2BY 1N8R1 1I3QI 4RV9A 3S1NI 1RNIA 2JUBA 3CC7Z 3NH4A 4DGLA 2G2KA 2K3RA 1RO4A 3F3FC 3EEDA 4A3DI 3J7A4 3GTMI 1VQ7Z 1K83I 1YI2Z 4NBBA 3HOWI 2NVYI 3CXCY 1Y1WI 2YU9I 1RO2A 1VQP1 1M1K1 3CD6Z 2I3CA 3U50C 5C44I 2OTJZ 2KPIA 2RIQA 2GTIA 1VQ61 2Q4ZA 4E32A 2F4OA 4MH4A 1ZH1A 1S721 1YIJ1 4S1TA 2R6MA 3JAMb 3CC2Z 4E2XA 1S7MA 3NH5A 4MD9A 2QEX1 4A3KI 1Z03A 1YHQZ 3CCS1 1YJWZ 3JAMf 3I56Z 4E30A 3GCFA 3TE5B 3K7AI 3GTJI 3CPWY 2WAQA 1ZB8A 3PO3I 3D9XA 2V8JA 3PO3S 4NH1C 5C4JI 1Q7Y2 3CMA1 3FQMA 4NBGA 2JA8I 1Q811 3CD61 1WCMI 3J80b 1TWHI 3T4NB 5AN9F 2V8IA 5A2Qb 1Q812 2AKLA 1YIT1 4E31A 2JMOA 4RS4A 3M3YI 1JWHC 1ZB9A 3MONA 4NBCA 2OOYB 4EWCA 1VQ71 4E2YA 1VQ5Z 3CCVZ 3IFUA 1K8A1 3CC41 3CCRZ 3CCJ1 1PFTA 2M48A 3I55Z 1NJI2 2IZ3A 3I4NI 2M6NA 1VQPZ 1VQ8Z 3TDHB 2LFUA 1JJ2Z 1P9NA 1VQOZ 1TWAI 3OW2Y 3I4MI 3S15I 2JR6A 4A3II 4RVDA 2PMZA 3GTGI 3CXCZ 3G4SZ 1YIJZ 1WW9A 2WB1A 1X3ZA 2H85A 3G6E1 4MRIA 2NVQI 4A3JI 2E2HI 4Y7NI 2O4HA 1X3WA 3VMHA 3GTQI 1KC81 1QF8A 3I561 2DE5A 3S1MI 4A3EI 3KIHA 3MZKB 1USPB 3S2HI 1X0TA 1K8A2 5A2Qf 3MZLB 2HU9A 1VQ81 4TNUA 2V8KA 1VQM1 3NDJA 1VQNZ 4BXXI 1TWCI 4MXUA 2P3YA 1S72Z 1VLAA 3CCUZ 2DE7A 1M902 3HOYI 2PM9A 2QR1B 1YJ91 1K9M1 3HOUI 3G4S1 2JA7I 3HOVI 2E2II 4NB9A 2QRDB 1Q862 1Y1VS 1Q821 3CCSZ 1YJW1 4RVHA 1YI21 1QVGZ 4A3BI 3M4OI 2PK7A 1VQL1 5D1PA 5FLMI 2OTLZ 1Z02A 3FKII 3CCJZ 1K9M2 3I551 3CCQZ 1M901 2BJOA 4NBEA 3EERA 3GKQA 4DQYB 2LIYA 3LUSA 4MD7A 3ESWA 2OOXB 1VQK1 4HH4A 1KQSY 2K5RA 3CMEZ 3VTNA 3H3VJ 3RZOI 2W04A 2VUGA 4XX2A 3HOXI 3S2DI 2HF1A 3S1QI 4Y52I 5IP7I 2W03A 3S16I 5D1OA 3CCM1 1KD12 1N2FA 2KI7B 1KRLA 1LQLA 1WIIA 1ML8A 2GU2A 3NFZA 2RHBA 3J80f 4X6AI 3Q87A 1M1K2 3GTKI 4E33A 4NBAA 3CMAZ 1RQFA 3J81f 2NVTI 5FLXf 3F3PC 2NVXI 2VF1A 3CCQ1 1YJNZ 1YUKA 3VMGA 1L1OC 4BY7I 4E2WA 3VMIA 1VQO1 3S17I 1KD11 2QLVB 3G711 3CME1 2F4MA 3CCU1 4A3LI 1NJI1 1NUIA 5FLXb 3G6EZ 3J81b 3BG0B 5IT9b 1N8R2 3GTMS 2OZKA 4QTUA 2JA5I 2DE6A 2IZ4A 4NB8A 2OTL1 1R9TI 1I50I 4BBSI 2GTHA 3CPWZ 2VUMI 1Y1VI 2JNYA 2QREB 2O53A 4NBDA 5CM2M 1QYPA 3CCLZ 2P28A 3RZDI 3BG1B 2E2JI 1YJ9Z 5C4XI 4AYBA 1W2BZ 2QA41 3I07A 1USPA 1VQLZ 1YHQ1 3IX0A 3FQQA 4RVFA 4A93I 3GTPI 1TFIA 3D6WA 2RT9A 1VQ9Z 1VQ4Z 5T67A 5T6BA 1YJN1 3CCE1 3GTOI 1KC82 1I6HI 4BBRI 1VQMZ 5IT9f 1VQKZ 1VQN1 1RO0A 3NDIA 2QRCB 3CC71 2JS4A 4NBFA 5LL6f 3HKZA 3CCL1 3G71Z 3IF8A 1JJ2Y 2EGTA 3QWUA 2E9HA 2JA6I 2RPRA 3CQZI 3CCMZ 4E2ZA 2R92I 3CC21 5D1OB 1TWFI 3S14I 2QEXZ 3P5JB 2RBLA 2ZAEB 4A3FI 2QA4Z 4NBHA 1SFOI 1QVFZ 2Y0SA 4NFRA 1TWGI 1VQ51 4BY1I 1QVFY 4MD8A 3PO2I 1YUAA 5T64A 1VQ6Z 3OW2Z 3CCEZ 2R7ZI 4RVGA 3VB9A 4A3GI 4HGYA 2R93I 1DL6A 4QTTA 1K731 3H0GI 1YITZ 4NOZA 5C3EI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU I;  2JA7 I;  2VUM I;  4NBG A;  2J6A A;  2JA8 I;  2E2I I;  1Y1V I;  2JNY A;  3HOV I;  4NB9 A;  3HOZ I;  1Y1V S;  4NBD A;  4A3C I;  1WCM I;  1TWH I;  3GTL I;  5CM2 M;  1QYP A;  4A3B I;  2B63 I;  3M4O I;  2PK7 A;  1RLY A;  5FLM I;  5IP9 I;  3S1R I;  2AKL A;  3RZD I;  3FKI I;  2E2J I;  2BJO A;  5C4X I;  4NBE A;  3EER A;  3GKQ A;  3M3Y I;  4A3M I;  1ZB9 A;  3LUS A;  1I3Q I;  3S1N I;  3ESW A;  3I07 A;  4NBC A;  1USP A;  2K5R A;  3H3V J;  3RZO I;  1PFT A;  3HOX I;  4XX2 A;  3S2D I;  4A93 I;  3GTP I;  1TFI A;  2HF1 A;  3D6W A;  1RO4 A;  3S1Q I;  4Y52 I;  5IP7 I;  3I4N I;  3S16 I;  4A3D I;  3GTO I;  1I6H I;  4BBR I;  1N2F A;  1LQL A;  1ML8 A;  3GTM I;  1TWA I;  2JS4 A;  4NBF A;  3I4M I;  1K83 I;  3S15 I;  4NBB A;  4X6A I;  2JR6 A;  3HOW I;  2NVY I;  4A3I I;  3Q87 A;  3GTK I;  3GTG I;  1Y1W I;  4NBA A;  2YU9 I;  1WW9 A;  2NVT I;  1X3Z A;  2NVX I;  2NVQ I;  2JA6 I;  3U50 C;  3CQZ I;  4A3J I;  2E2H I;  2R92 I;  4Y7N I;  5C44 I;  1X3W A;  2KPI A;  3VMG A;  3VMH A;  1TWF I;  1L1O C;  3S14 I;  4BY7 I;  2RBL A;  3VMI A;  3GTQ I;  3S17 I;  4A3F I;  2F4O A;  4NBH A;  1SFO I;  2DE5 A;  4MH4 A;  1TWG I;  3S1M I;  2F4M A;  4A3E I;  4A3L I;  1NUI A;  1USP B;  3S2H I;  4BY1 I;  4BXX I;  3PO2 I;  1YUA A;  4A3K I;  2R7Z I;  3GCF A;  3GTM S;  3K7A I;  3VB9 A;  3GTJ I;  1TWC I;  4A3G I;  1ZB8 A;  4QTU A;  2JA5 I;  2DE6 A;  2P3Y A;  3PO3 I;  2R93 I;  4NB8 A;  1DL6 A;  4BBS I;  4QTT A;  1I50 I;  1R9T I;  1VLA A;  3H0G I;  2DE7 A;  3PO3 S;  5C4J I;  3HOY I;  4NOZ A;  5C3E I; 
#chains in the Genus database with same CATH topology
 1QVG Y;  2J6A A;  4CL1 A;  2YAD A;  3HOZ I;  4A3C I;  1NP6 A;  3GTL I;  4DK1 A;  1Q82 2;  2B63 I;  3KIF A;  1Z01 A;  1Q86 1;  1RLY A;  5IP9 I;  3S1R I;  3CCV 1;  3CCR 1;  3CC4 Z;  3NH8 A;  1Q7Y 1;  1K73 2;  2OTJ 1;  1VQ9 1;  2QKD A;  1VQ4 1;  4MON A;  4HGZ A;  4A3M I;  2Q51 A;  1KQS Z;  1W2B Y;  1N8R 1;  1I3Q I;  4RV9 A;  3S1N I;  1RNI A;  2JUB A;  3CC7 Z;  3NH4 A;  4DGL A;  2G2K A;  2K3R A;  1RO4 A;  3F3F C;  3EED A;  2V45 A;  4A3D I;  3J7A 4;  2VPX A;  3GTM I;  1VQ7 Z;  1K83 I;  1YI2 Z;  4NBB A;  3HOW I;  2NVY I;  3CXC Y;  1Y1W I;  2YU9 I;  1RO2 A;  2VPW A;  1VQP 1;  1M1K 1;  3CD6 Z;  2I3C A;  3U50 C;  5C44 I;  2OTJ Z;  2KPI A;  2RIQ A;  2GTI A;  1VQ6 1;  2Q4Z A;  4E32 A;  2F4O A;  4MH4 A;  1ZH1 A;  1S72 1;  1YIJ 1;  4S1T A;  2R6M A;  3JAM b;  3CC2 Z;  4E2X A;  1S7M A;  3NH5 A;  4MD9 A;  2QEX 1;  4A3K I;  1Z03 A;  1YHQ Z;  3CCS 1;  1YJW Z;  3JAM f;  3I56 Z;  4E30 A;  3GCF A;  3TE5 B;  3K7A I;  3GTJ I;  3CPW Y;  2JIO A;  2WAQ A;  1ZB8 A;  3PO3 I;  3D9X A;  2V8J A;  3PO3 S;  4NH1 C;  5C4J I;  1Q7Y 2;  3CMA 1;  3FQM A;  4NBG A;  2JA8 I;  1Q81 1;  3CD6 1;  1WCM I;  3J80 b;  1TWH I;  3T4N B;  5AN9 F;  2V8I A;  5A2Q b;  1Q81 2;  2AKL A;  1YIT 1;  4E31 A;  2JMO A;  4RS4 A;  3M3Y I;  1JWH C;  1ZB9 A;  3MON A;  4NBC A;  2OOY B;  4EWC A;  1VQ7 1;  4E2Y A;  1VQ5 Z;  3CCV Z;  3IFU A;  1K8A 1;  3CC4 1;  3CCR Z;  3CCJ 1;  1PFT A;  2IV2 X;  2M48 A;  3I55 Z;  1NJI 2;  2AYD A;  2IZ3 A;  3I4N I;  2M6N A;  1FDI A;  2LEX A;  1VQP Z;  1VQ8 Z;  2NAP A;  1WZN A;  3TDH B;  2LFU A;  1JJ2 Z;  1P9N A;  1VQO Z;  1TWA I;  3OW2 Y;  3I4M I;  3S15 I;  2JR6 A;  4A3I I;  4RVD A;  2PMZ A;  3GTG I;  3CXC Z;  3G4S Z;  1YIJ Z;  1WW9 A;  1QXF A;  2WB1 A;  2JIQ A;  1X3Z A;  2H85 A;  3G6E 1;  4MRI A;  2NVQ I;  2JIR A;  4A3J I;  2E2H I;  4Y7N I;  2O4H A;  1X3W A;  3VMH A;  2E7Z A;  3GTQ I;  1KC8 1;  1QF8 A;  3I56 1;  2DE5 A;  3S1M I;  4A3E I;  3KIH A;  3MZK B;  1USP B;  3S2H I;  1X0T A;  1K8A 2;  5A2Q f;  2VPY A;  3MZL B;  2HU9 A;  1VQ8 1;  4TNU A;  2V8K A;  1VQM 1;  3NDJ A;  1VQN Z;  3IR7 A;  4BXX I;  1TWC I;  4MXU A;  2P3Y A;  1S72 Z;  1VLA A;  3CCU Z;  2DE7 A;  1M90 2;  3HOY I;  2PM9 A;  2QR1 B;  1YJ9 1;  1K9M 1;  3HOU I;  3G4S 1;  2JA7 I;  3HOV I;  2E2I I;  4NB9 A;  2QRD B;  1Q86 2;  1Y1V S;  1Q82 1;  3CCS Z;  1YJW 1;  4RVH A;  1YI2 1;  1QVG Z;  4A3B I;  3M4O I;  2PK7 A;  1SIW A;  1VQL 1;  5D1P A;  5FLM I;  2OTL Z;  1Z02 A;  2JIP A;  3FKI I;  3CCJ Z;  1K9M 2;  3I55 1;  1Y8C A;  3CCQ Z;  1M90 1;  2BJO A;  4NBE A;  3EER A;  3GKQ A;  4DQY B;  2LIY A;  3LUS A;  4MD7 A;  3ESW A;  2OOX B;  1VQK 1;  4HH4 A;  2JIM A;  2K5R A;  3CME Z;  1KQS Y;  3VTN A;  3H3V J;  3RZO I;  2W04 A;  2VUG A;  4XX2 A;  3HOX I;  3S2D I;  2HF1 A;  3S1Q I;  4Y52 I;  5IP7 I;  2W03 A;  3S16 I;  1WJ2 A;  5D1O A;  3CCM 1;  1KD1 2;  2KI7 B;  1N2F A;  1KRL A;  1LQL A;  1WII A;  1ML8 A;  2GU2 A;  3NFZ A;  2RHB A;  3J80 f;  4X6A I;  3Q87 A;  1M1K 2;  3GTK I;  4E33 A;  4NBA A;  3CMA Z;  1RQF A;  3J81 f;  2NVT I;  5FLX f;  3F3P C;  2NVX I;  2VF1 A;  3CCQ 1;  1YJN Z;  1YUK A;  3VMG A;  1L1O C;  4BY7 I;  4E2W A;  3D2L A;  3VMI A;  1VQO 1;  3S17 I;  1KD1 1;  2QLV B;  3G71 1;  3CME 1;  2F4M A;  3CCU 1;  4A3L I;  1NJI 1;  1NUI A;  2V3V A;  5FLX b;  3G6E Z;  3J81 b;  1FDO A;  3BG0 B;  5IT9 b;  1N8R 2;  3GTM S;  2OZK A;  4QTU A;  2JA5 I;  2DE6 A;  2IZ4 A;  4NB8 A;  2OTL 1;  1R9T I;  1I50 I;  4BBS I;  2GTH A;  3CPW Z;  2VUM I;  1Y1V I;  2JNY A;  2QRE B;  2O53 A;  4NBD A;  5CM2 M;  1QYP A;  3CCL Z;  2P28 A;  3RZD I;  3BG1 B;  2E2J I;  1YJ9 Z;  5C4X I;  4AYB A;  1W2B Z;  2QA4 1;  3I07 A;  1USP A;  1VQL Z;  1YHQ 1;  3IX0 A;  3FQQ A;  4RVF A;  4A93 I;  3GTP I;  1TFI A;  3D6W A;  2RT9 A;  1VQ9 Z;  1VQ4 Z;  5T67 A;  5T6B A;  2VPZ A;  1YJN 1;  3CCE 1;  3GTO I;  1KC8 2;  1I6H I;  4BBR I;  1VQM Z;  5IT9 f;  1VQK Z;  1VQN 1;  1RO0 A;  3NDI A;  2QRC B;  3CC7 1;  2JS4 A;  4NBF A;  5LL6 f;  3HKZ A;  3CCL 1;  3G71 Z;  3IF8 A;  1JJ2 Y;  2EGT A;  3QWU A;  2E9H A;  2JA6 I;  2RPR A;  3CQZ I;  3CCM Z;  4E2Z A;  2R92 I;  3CC2 1;  5D1O B;  1TWF I;  3S14 I;  2QEX Z;  3P5J B;  2RBL A;  2ZAE B;  4A3F I;  1Q16 A;  2QA4 Z;  4NBH A;  1SFO I;  1QVF Z;  2Y0S A;  4NFR A;  1TWG I;  1VQ5 1;  4BY1 I;  1QVF Y;  4MD8 A;  3PO2 I;  1YUA A;  5T64 A;  1VQ6 Z;  3OW2 Z;  3CCE Z;  2R7Z I;  4RVG A;  3VB9 A;  4A3G I;  1AA6 A;  4HGY A;  2R93 I;  1DL6 A;  4QTT A;  1K73 1;  3H0G I;  1YIT Z;  4NOZ A;  5C3E I; 
#chains in the Genus database with same CATH homology
 1QVG Y;  2J6A A;  4CL1 A;  2YAD A;  3HOZ I;  4A3C I;  1NP6 A;  3GTL I;  4DK1 A;  1Q82 2;  2B63 I;  3KIF A;  1Z01 A;  1Q86 1;  1RLY A;  5IP9 I;  3S1R I;  3CCV 1;  3CCR 1;  3CC4 Z;  3NH8 A;  1Q7Y 1;  1K73 2;  2OTJ 1;  1VQ9 1;  2QKD A;  1VQ4 1;  4MON A;  4HGZ A;  4A3M I;  2Q51 A;  1KQS Z;  1W2B Y;  1N8R 1;  1I3Q I;  4RV9 A;  3S1N I;  1RNI A;  2JUB A;  3CC7 Z;  3NH4 A;  4DGL A;  2G2K A;  2K3R A;  1RO4 A;  3F3F C;  3EED A;  4A3D I;  3J7A 4;  3GTM I;  1VQ7 Z;  1K83 I;  1YI2 Z;  4NBB A;  3HOW I;  2NVY I;  3CXC Y;  1Y1W I;  2YU9 I;  1RO2 A;  1VQP 1;  1M1K 1;  3CD6 Z;  2I3C A;  3U50 C;  5C44 I;  2OTJ Z;  2KPI A;  2RIQ A;  2GTI A;  1VQ6 1;  2Q4Z A;  4E32 A;  2F4O A;  4MH4 A;  1ZH1 A;  1S72 1;  1YIJ 1;  4S1T A;  2R6M A;  3JAM b;  3CC2 Z;  4E2X A;  1S7M A;  3NH5 A;  4MD9 A;  2QEX 1;  4A3K I;  1Z03 A;  1YHQ Z;  3CCS 1;  1YJW Z;  3JAM f;  3I56 Z;  4E30 A;  3GCF A;  3TE5 B;  3K7A I;  3GTJ I;  3CPW Y;  2WAQ A;  1ZB8 A;  3PO3 I;  3D9X A;  2V8J A;  3PO3 S;  4NH1 C;  5C4J I;  1Q7Y 2;  3CMA 1;  3FQM A;  4NBG A;  2JA8 I;  1Q81 1;  3CD6 1;  1WCM I;  3J80 b;  1TWH I;  3T4N B;  5AN9 F;  2V8I A;  5A2Q b;  1Q81 2;  2AKL A;  1YIT 1;  4E31 A;  2JMO A;  4RS4 A;  3M3Y I;  1JWH C;  1ZB9 A;  3MON A;  4NBC A;  2OOY B;  4EWC A;  1VQ7 1;  4E2Y A;  1VQ5 Z;  3CCV Z;  3IFU A;  1K8A 1;  3CC4 1;  3CCR Z;  3CCJ 1;  1PFT A;  2M48 A;  3I55 Z;  1NJI 2;  2IZ3 A;  3I4N I;  2M6N A;  1VQP Z;  1VQ8 Z;  3TDH B;  2LFU A;  1JJ2 Z;  1P9N A;  1VQO Z;  1TWA I;  3OW2 Y;  3I4M I;  3S15 I;  2JR6 A;  4A3I I;  4RVD A;  2PMZ A;  3GTG I;  3CXC Z;  3G4S Z;  1YIJ Z;  1WW9 A;  2WB1 A;  1X3Z A;  2H85 A;  3G6E 1;  4MRI A;  2NVQ I;  4A3J I;  2E2H I;  4Y7N I;  2O4H A;  1X3W A;  3VMH A;  3GTQ I;  1KC8 1;  1QF8 A;  3I56 1;  2DE5 A;  3S1M I;  4A3E I;  3KIH A;  3MZK B;  1USP B;  3S2H I;  1X0T A;  1K8A 2;  5A2Q f;  3MZL B;  2HU9 A;  1VQ8 1;  4TNU A;  2V8K A;  1VQM 1;  3NDJ A;  1VQN Z;  4BXX I;  1TWC I;  4MXU A;  2P3Y A;  1S72 Z;  1VLA A;  3CCU Z;  2DE7 A;  1M90 2;  3HOY I;  2PM9 A;  2QR1 B;  1YJ9 1;  1K9M 1;  3HOU I;  3G4S 1;  2JA7 I;  3HOV I;  2E2I I;  4NB9 A;  2QRD B;  1Q86 2;  1Y1V S;  1Q82 1;  3CCS Z;  1YJW 1;  4RVH A;  1YI2 1;  1QVG Z;  4A3B I;  3M4O I;  2PK7 A;  1VQL 1;  5D1P A;  5FLM I;  2OTL Z;  1Z02 A;  3FKI I;  3CCJ Z;  1K9M 2;  3I55 1;  3CCQ Z;  1M90 1;  2BJO A;  4NBE A;  3EER A;  3GKQ A;  4DQY B;  2LIY A;  3LUS A;  4MD7 A;  3ESW A;  2OOX B;  1VQK 1;  4HH4 A;  1KQS Y;  2K5R A;  3CME Z;  3VTN A;  3H3V J;  3RZO I;  2W04 A;  2VUG A;  4XX2 A;  3HOX I;  3S2D I;  2HF1 A;  3S1Q I;  4Y52 I;  5IP7 I;  2W03 A;  3S16 I;  5D1O A;  3CCM 1;  1KD1 2;  1N2F A;  2KI7 B;  1KRL A;  1LQL A;  1WII A;  1ML8 A;  2GU2 A;  3NFZ A;  2RHB A;  3J80 f;  4X6A I;  3Q87 A;  1M1K 2;  3GTK I;  4E33 A;  4NBA A;  3CMA Z;  1RQF A;  3J81 f;  2NVT I;  5FLX f;  3F3P C;  2NVX I;  2VF1 A;  3CCQ 1;  1YJN Z;  1YUK A;  3VMG A;  1L1O C;  4BY7 I;  4E2W A;  3VMI A;  1VQO 1;  3S17 I;  1KD1 1;  2QLV B;  3G71 1;  3CME 1;  2F4M A;  3CCU 1;  4A3L I;  1NJI 1;  1NUI A;  5FLX b;  3G6E Z;  3J81 b;  3BG0 B;  5IT9 b;  1N8R 2;  3GTM S;  2OZK A;  4QTU A;  2JA5 I;  2DE6 A;  2IZ4 A;  4NB8 A;  2OTL 1;  1R9T I;  1I50 I;  4BBS I;  2GTH A;  3CPW Z;  2VUM I;  1Y1V I;  2JNY A;  2QRE B;  2O53 A;  4NBD A;  5CM2 M;  1QYP A;  3CCL Z;  2P28 A;  3RZD I;  3BG1 B;  2E2J I;  1YJ9 Z;  5C4X I;  4AYB A;  1W2B Z;  2QA4 1;  3I07 A;  1USP A;  1VQL Z;  1YHQ 1;  3IX0 A;  3FQQ A;  4RVF A;  4A93 I;  3GTP I;  1TFI A;  3D6W A;  2RT9 A;  1VQ9 Z;  1VQ4 Z;  5T67 A;  5T6B A;  1YJN 1;  3CCE 1;  3GTO I;  1KC8 2;  1I6H I;  4BBR I;  1VQM Z;  5IT9 f;  1VQK Z;  1VQN 1;  1RO0 A;  3NDI A;  2QRC B;  3CC7 1;  2JS4 A;  4NBF A;  5LL6 f;  3HKZ A;  3CCL 1;  3G71 Z;  3IF8 A;  1JJ2 Y;  2EGT A;  3QWU A;  2E9H A;  2JA6 I;  2RPR A;  3CQZ I;  3CCM Z;  4E2Z A;  2R92 I;  3CC2 1;  5D1O B;  1TWF I;  3S14 I;  2QEX Z;  3P5J B;  2RBL A;  2ZAE B;  4A3F I;  2QA4 Z;  4NBH A;  1SFO I;  1QVF Z;  2Y0S A;  4NFR A;  1TWG I;  1VQ5 1;  4BY1 I;  1QVF Y;  4MD8 A;  3PO2 I;  1YUA A;  5T64 A;  1VQ6 Z;  3OW2 Z;  3CCE Z;  2R7Z I;  4RVG A;  3VB9 A;  4A3G I;  4HGY A;  2R93 I;  1DL6 A;  4QTT A;  1K73 1;  3H0G I;  1YIT Z;  4NOZ A;  5C3E I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...