1I50I

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 13
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i50I01
1USPA 1Y1VI 3HOVI 4NBAA 5C4JI 3GTOI 4A3CI 1YUAA 4A3LI 3VB9A 4Y7NI 1ML8A 4NBEA 2J6AA 2DE6A 4NBDA 4NBBA 1ZB9A 3GTPI 3HOXI 3GTQI 1USPB 3GTJI 3I4MI 2DE5A 2F4MA 4A3JI 2E2JI 2R92I 2R7ZI 3K7AI 4NBFA 1WW9A 4NB8A 5IP7I 2F4OA 1SFOI 2HF1A 3M3YI 1K83I 3FKII 3S15I 4A93I 3ESWA 4XX2A 3D6WA 2NVYI 3S14I 4BXXI 2NVTI 3HOUI 5IP9I 2JA8I 4QTUA 3PO2I 3S1QI 4A3FI 1VLAA 3GTMI 3GCFA 1R9TI 1X3WA 4A3DI 2JA6I 3S1RI 3I07A 4A3BI 1I3QI 1TWAI 1I50I 2AKLA 4NOZA 3U50C 1RO4A 3HOWI 3VMGA 2YU9I 3RZOI 4A3MI 4NB9A 5CM2M 2KPIA 1N2FA 3Q87A 4BBSI 3S1MI 4BBRI 4A3KI 3EERA 3H0GI 2B63I 3S1NI 2DE7A 3S2HI 3S16I 4X6AI 5C4XI 1NUIA 4NBHA 4QTTA 1Y1WI 3PO3I 3RZDI 4A3II 2NVQI 4NBGA 1TWHI 4MH4A 1WCMI 1I6HI 1Y1VS 3HOZI 1X3ZA 1ZB8A 4BY1I 2E2II 2E2HI 3S2DI 2JR6A 1QYPA 2JA5I 3M4OI 3GTGI 1TFIA 2JS4A 1PFTA 4BY7I 3S17I 4A3EI 1L1OC 1RLYA 2P3YA 1TWCI 3GKQA 1LQLA 3HOYI 2K5RA 1DL6A 3CQZI 3LUSA 2RBLA 4A3GI 4NBCA 3I4NI 1TWGI 2R93I 2JNYA 2NVXI 3VMIA 3GTMS 5C44I 5FLMI 2JA7I 1TWFI 2BJOA 4Y52I 2PK7A 3PO3S 3VMHA 3GTKI 5C3EI 3GTLI 3H3VJ 2VUMI
chains in the Genus database with same CATH superfamily
4MD9A 1USPA 1X0TA 1M1K1 2HU9A 3NDJA 3CCMZ 1VQ81 1YJW1 1Q7Y2 3CPWZ 1VQ9Z 1VQNZ 4A3LI 3VB9A 3KIFA 5D1OA 3CCVZ 4Y7NI 1ML8A 1QVGZ 1ZB9A 3GTPI 1YJ9Z 4CL1A 1YIJ1 4A3JI 2F4MA 1QVFY 2R92I 2R7ZI 2QKDA 3S15I 4NH1C 3D6WA 1KRLA 1M1K2 4BXXI 4MD8A 2NVTI 3HOUI 2OOXB 3CCR1 4A3DI 1VQKZ 2OTLZ 4RV9A 3S1RI 1WIIA 4A3BI 2V8IA 1VQ7Z 2AKLA 3CCS1 3VMGA 2YU9I 3RZOI 1Y8CA 3OW2Y 2ZAEB 2GU2A 3NFZA 3IR7A 3NH4A 3EERA 4A3KI 4E30A 3NH8A 1NP6A 1P9NA 2PMZA 2DE7A 3S2HI 1VQ61 3G6EZ 5C4XI 4QTTA 1Y1WI 1VQP1 2NAPA 1RQFA 1WCMI 4MRIA 2RHBA 2I3CA 1Z01A 5T6BA 3OW2Z 2E2HI 1N8R1 1VQ8Z 3S2DI 3CCJ1 3BG1B 3IF8A 1YJWZ 2Y0SA 3GTGI 1TFIA 1PFTA 1M901 4A3EI 1ZH1A 1S721 1KC81 3CCE1 3GKQA 2JIMA 4NFRA 1YIJZ 2KI7B 2RBLA 2QEX1 2JUBA 1VQL1 3I4NI 2PM9A 2JNYA 5T64A 2QRCB 1K9M1 1N8R2 2RT9A 3PO3S 3MONA 3GTKI 2IZ4A 3KIHA 1M902 4E2XA 1KC82 2LIYA 3GTOI 1YJN1 1Q821 1YIT1 2K3RA 3I551 2OZKA 4NBBA 3CCSZ 3CC71 3CPWY 2VF1A 3CC2Z 2VUGA 1QVGY 3GTJI 3D2LA 2VPXA 1K9M2 1QXFA 2VPYA 3K7AI 2JIPA 4NBFA 5IP7I 2F4OA 1SFOI 3FKII 3ESWA 1VQ6Z 2NVYI 1FDOA 1Q822 5IP9I 3PO2I 2LFUA 1VQPZ 1VQM1 3GTMI 3GCFA 2E7ZA 1R9TI 2EGTA 3G4S1 4RVGA 2JA6I 3CXCZ 2VPWA 2QRDB 1I3QI 1Z03A 3CCJZ 3U50C 1RO4A 3HOWI 4NB9A 4AYBA 4BBSI 4BBRI 3H0GI 3G711 1K731 2QEXZ 4NBHA 2Q51A 2H85A 2GTIA 1W2BZ 1Y1VS 3NH5A 2IV2X 1Q861 1JJ2Y 1YJNZ 1YITZ 1K8A1 1SIWA 2JA5I 2JS4A 3I55Z 1RLYA 3CC7Z 1KQSZ 3HOYI 4HGZA 1VQO1 3QWUA 1YI21 3LUSA 2M6NA 3FQMA 1JJ2Z 3VMIA 5C44I 2JA7I 1Q862 2PK7A 1VQ51 3TE5B 3VMHA 2WB1A 3CME1 1K8A2 2M48A 2IZ3A 1VQMZ 3GTLI 2E9HA 2VUMI 3G4SZ 3HOVI 4NBAA 3I561 2JIQA 2J6AA 3EEDA 3CCM1 4E2YA 5IT9b 1USPB 2JIRA 3I4MI 2DE5A 2OOYB 2E2JI 1YJ91 1WW9A 4NB8A 3G71Z 1JWHC 2HF1A 3BG0B 1RO0A 4EWCA 3CCRZ 4A3FI 3JAMb 3CC41 3CCL1 5A2Qb 1VQK1 2OTL1 1TWAI 1I50I 2V3VA 3CXCY 2JMOA 2R6MA 1Q16A 2JIOA 2LEXA 5CM2M 2P28A 1N2FA 3VTNA 3IFUA 3CCQ1 3J7A4 2B63I 3MZKB 3S1NI 1Q7Y1 1VQOZ 1YI2Z 3S16I 4X6AI 3TDHB 3T4NB 3RZDI 4NBGA 1TWHI 3HKZA 3CMEZ 1I6HI 3HOZI 2OTJ1 4HH4A 3J81b 4BY1I 4E31A 1WJ2A 2RIQA 1W2BY 3I56Z 4MD7A 3NDIA 2AYDA 1S72Z 3M4OI 3FQQA 1VQ41 3CCEZ 1RO2A 4TNUA 4BY7I 4E33A 2V8KA 2QA41 1AA6A 1VQLZ 2O4HA 1DL6A 3CQZI 4A3GI 4NBCA 1KQSY 4Y52I 1TWFI 1YUKA 1KD11 3CMA1 5FLXb 5C3EI 3CC4Z 3H3VJ 3F3PC 1Y1VI 4MXUA 5IT9f 5C4JI 4A3CI 3CCLZ 1YUAA 4S1TA 1K732 1Q811 2WAQA 4NBEA 3J80f 2DE6A 4NBDA 4MONA 5LL6f 2W04A 3HOXI 2Q4ZA 1QVFZ 3GTQI 5T67A 1QF8A 3CD61 3JAMf 3CC21 3CCQZ 4DQYB 1YHQ1 4DGLA 4HGYA 2O53A 1KD12 3M3YI 1K83I 4A93I 4RVHA 4XX2A 2GTHA 3S14I 5A2Qf 3CCU1 4E2WA 2JA8I 4QTUA 1Q812 2RPRA 3S1QI 1VLAA 1NJI1 1X3WA 2OTJZ 1VQ91 1VQN1 1WZNA 3CCV1 1RNIA 2QR1B 3I07A 3F3FC 4NOZA 1VQ4Z 4A3MI 5D1OB 3J80b 1Z02A 2KPIA 3Q87A 4DK1A 3S1MI 2QA4Z 1NJI2 5D1PA 3J81f 1NUIA 2V8JA 3IX0A 3PO3I 4A3II 2NVQI 2G2KA 4MH4A 4E2ZA 1X3ZA 1ZB8A 3CMAZ 2E2II 3D9XA 1VQ71 2JR6A 4RVFA 3P5JB 1QYPA 2V45A 3MZLB 4RVDA 3S17I 1L1OC 1S7MA 2P3YA 5AN9F 1TWCI 1LQLA 4RS4A 2K5RA 3CD6Z 5FLXf 3G6E1 2QLVB 1YHQZ 1VQ5Z 2R93I 1TWGI 2NVXI 3GTMS 5FLMI 2BJOA 1FDIA 3CCUZ 2W03A 2VPZA 2YADA 4E32A 2QREB
chains in the Genus database with same CATH topology
4MD9A 1USPA 1X0TA 1M1K1 2HU9A 3NDJA 3CCMZ 1VQ81 1YJW1 1Q7Y2 3CPWZ 1VQ9Z 1VQNZ 4A3LI 3VB9A 3KIFA 5D1OA 3CCVZ 4Y7NI 1ML8A 1QVGZ 1ZB9A 3GTPI 1YJ9Z 4CL1A 1YIJ1 4A3JI 2F4MA 1QVFY 2R92I 2R7ZI 2QKDA 3S15I 4NH1C 3D6WA 1KRLA 1M1K2 4BXXI 4MD8A 2NVTI 3HOUI 2OOXB 3CCR1 4A3DI 1VQKZ 2OTLZ 4RV9A 3S1RI 1WIIA 4A3BI 2V8IA 1VQ7Z 2AKLA 3CCS1 3VMGA 2YU9I 3RZOI 3OW2Y 2ZAEB 2GU2A 3NFZA 4A3KI 3NH4A 3EERA 4E30A 3NH8A 1NP6A 1P9NA 2PMZA 2DE7A 3S2HI 1VQ61 3G6EZ 5C4XI 4QTTA 1Y1WI 1VQP1 1RQFA 1WCMI 4MRIA 2RHBA 2I3CA 1Z01A 5T6BA 3OW2Z 2E2HI 1N8R1 1VQ8Z 3S2DI 3CCJ1 3BG1B 3IF8A 1YJWZ 2Y0SA 3GTGI 1TFIA 1PFTA 1M901 4A3EI 1ZH1A 1S721 1KC81 3CCE1 3GKQA 4NFRA 1YIJZ 2KI7B 2RBLA 2QEX1 2JUBA 1VQL1 3I4NI 2PM9A 2JNYA 5T64A 2QRCB 1K9M1 1N8R2 2RT9A 3PO3S 3MONA 3GTKI 2IZ4A 3KIHA 1M902 4E2XA 1KC82 2LIYA 3GTOI 1YJN1 1Q821 1YIT1 2K3RA 3I551 2OZKA 4NBBA 3CCSZ 3CC71 3CPWY 2VF1A 3CC2Z 2VUGA 1QVGY 3GTJI 1K9M2 3K7AI 4NBFA 5IP7I 2F4OA 1SFOI 3FKII 3ESWA 1VQ6Z 2NVYI 1Q822 5IP9I 3PO2I 2LFUA 1VQPZ 1VQM1 3GTMI 3GCFA 1R9TI 2EGTA 3G4S1 4RVGA 2JA6I 3CXCZ 2QRDB 1I3QI 1Z03A 3CCJZ 3U50C 1RO4A 3HOWI 4NB9A 4AYBA 4BBSI 4BBRI 3H0GI 3G711 1K731 2QEXZ 4NBHA 2Q51A 2H85A 2GTIA 1W2BZ 1Y1VS 3NH5A 1Q861 1JJ2Y 1YJNZ 1YITZ 1K8A1 2JA5I 2JS4A 3I55Z 1RLYA 3CC7Z 1KQSZ 3HOYI 4HGZA 1VQO1 3QWUA 1YI21 3LUSA 2M6NA 3FQMA 1JJ2Z 3VMIA 5C44I 2JA7I 1Q862 2PK7A 1VQ51 3TE5B 3VMHA 2WB1A 3CME1 1K8A2 2M48A 2IZ3A 1VQMZ 3GTLI 2E9HA 2VUMI 3G4SZ 3HOVI 4NBAA 3I561 2J6AA 3EEDA 3CCM1 4E2YA 5IT9b 1USPB 3I4MI 2DE5A 2OOYB 2E2JI 1YJ91 1WW9A 4NB8A 3G71Z 1JWHC 2HF1A 3BG0B 1RO0A 4EWCA 3CCRZ 4A3FI 3JAMb 3CC41 3CCL1 5A2Qb 1VQK1 2OTL1 1TWAI 1I50I 3CXCY 2JMOA 2R6MA 5CM2M 2P28A 1N2FA 3VTNA 3IFUA 3CCQ1 3J7A4 2B63I 3MZKB 3S1NI 1Q7Y1 1VQOZ 1YI2Z 3S16I 4X6AI 3TDHB 3T4NB 3RZDI 4NBGA 1TWHI 3HKZA 3CMEZ 1I6HI 3HOZI 2OTJ1 4HH4A 3J81b 4BY1I 4E31A 2RIQA 1W2BY 3I56Z 4MD7A 3NDIA 1S72Z 3M4OI 3FQQA 1VQ41 3CCEZ 1RO2A 4TNUA 4BY7I 4E33A 2V8KA 2QA41 1VQLZ 2O4HA 1DL6A 3CQZI 4A3GI 4NBCA 1KQSY 4Y52I 1TWFI 1YUKA 1KD11 3CMA1 5FLXb 5C3EI 3CC4Z 3H3VJ 3F3PC 1Y1VI 4MXUA 5IT9f 5C4JI 4A3CI 3CCLZ 1YUAA 4S1TA 1K732 1Q811 2WAQA 4NBEA 3J80f 2DE6A 4NBDA 4MONA 5LL6f 2W04A 3HOXI 2Q4ZA 1QVFZ 3GTQI 5T67A 1QF8A 3CD61 3JAMf 3CC21 3CCQZ 4DQYB 1YHQ1 4DGLA 4HGYA 2O53A 1KD12 3M3YI 1K83I 4A93I 4RVHA 4XX2A 2GTHA 3S14I 5A2Qf 3CCU1 4E2WA 2JA8I 4QTUA 1Q812 2RPRA 3S1QI 1VLAA 1NJI1 1X3WA 2OTJZ 1VQ91 1VQN1 3CCV1 1RNIA 2QR1B 3I07A 3F3FC 4NOZA 1VQ4Z 4A3MI 5D1OB 3J80b 1Z02A 2KPIA 3Q87A 4DK1A 3S1MI 2QA4Z 1NJI2 5D1PA 3J81f 1NUIA 2V8JA 3IX0A 3PO3I 4A3II 2NVQI 2G2KA 4MH4A 4E2ZA 1X3ZA 1ZB8A 3CMAZ 2E2II 3D9XA 1VQ71 2JR6A 4RVFA 3P5JB 1QYPA 3MZLB 4RVDA 3S17I 1L1OC 1S7MA 2P3YA 5AN9F 1TWCI 1LQLA 4RS4A 2K5RA 3CD6Z 5FLXf 3G6E1 2QLVB 1YHQZ 1VQ5Z 2R93I 1TWGI 2NVXI 3GTMS 5FLMI 2BJOA 3CCUZ 2W03A 2YADA 4E32A 2QREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  1Y1V I;  3HOV I;  4NBA A;  5C4J I;  3GTO I;  4A3C I;  1YUA A;  4A3L I;  3VB9 A;  4Y7N I;  1ML8 A;  4NBE A;  2J6A A;  2DE6 A;  4NBD A;  4NBB A;  1ZB9 A;  3GTP I;  3HOX I;  3GTQ I;  1USP B;  3GTJ I;  3I4M I;  2DE5 A;  2F4M A;  4A3J I;  2E2J I;  2R92 I;  2R7Z I;  3K7A I;  4NBF A;  1WW9 A;  4NB8 A;  5IP7 I;  2F4O A;  1SFO I;  2HF1 A;  3M3Y I;  1K83 I;  3FKI I;  3S15 I;  4A93 I;  3ESW A;  4XX2 A;  3D6W A;  2NVY I;  3S14 I;  4BXX I;  2NVT I;  3HOU I;  5IP9 I;  2JA8 I;  4QTU A;  3PO2 I;  3S1Q I;  4A3F I;  1VLA A;  3GTM I;  3GCF A;  1R9T I;  1X3W A;  4A3D I;  2JA6 I;  3S1R I;  3I07 A;  4A3B I;  1I3Q I;  1TWA I;  1I50 I;  2AKL A;  4NOZ A;  3U50 C;  1RO4 A;  3HOW I;  3VMG A;  2YU9 I;  3RZO I;  4A3M I;  4NB9 A;  5CM2 M;  2KPI A;  1N2F A;  3Q87 A;  4BBS I;  3S1M I;  4BBR I;  4A3K I;  3EER A;  3H0G I;  2B63 I;  3S1N I;  2DE7 A;  3S2H I;  3S16 I;  4X6A I;  5C4X I;  1NUI A;  4NBH A;  4QTT A;  1Y1W I;  3PO3 I;  3RZD I;  4A3I I;  2NVQ I;  4NBG A;  1TWH I;  4MH4 A;  1WCM I;  1I6H I;  1Y1V S;  3HOZ I;  1X3Z A;  1ZB8 A;  4BY1 I;  2E2I I;  2E2H I;  3S2D I;  2JR6 A;  1QYP A;  2JA5 I;  3M4O I;  3GTG I;  1TFI A;  2JS4 A;  1PFT A;  4BY7 I;  3S17 I;  4A3E I;  1L1O C;  1RLY A;  2P3Y A;  1TWC I;  3GKQ A;  1LQL A;  3HOY I;  2K5R A;  1DL6 A;  3CQZ I;  3LUS A;  2RBL A;  4A3G I;  4NBC A;  3I4N I;  1TWG I;  2R93 I;  2JNY A;  2NVX I;  3VMI A;  3GTM S;  5C44 I;  5FLM I;  2JA7 I;  1TWF I;  2BJO A;  4Y52 I;  2PK7 A;  3PO3 S;  3VMH A;  3GTK I;  5C3E I;  3GTL I;  3H3V J;  2VUM I; 
#chains in the Genus database with same CATH topology
 4MD9 A;  1USP A;  1X0T A;  1M1K 1;  2HU9 A;  3NDJ A;  3CCM Z;  1VQ8 1;  1YJW 1;  1Q7Y 2;  3CPW Z;  1VQ9 Z;  1VQN Z;  4A3L I;  3VB9 A;  3KIF A;  5D1O A;  3CCV Z;  4Y7N I;  1ML8 A;  1QVG Z;  1ZB9 A;  3GTP I;  1YJ9 Z;  4CL1 A;  1YIJ 1;  4A3J I;  2F4M A;  1QVF Y;  2R92 I;  2R7Z I;  2QKD A;  3S15 I;  4NH1 C;  3D6W A;  1KRL A;  1M1K 2;  4BXX I;  4MD8 A;  2NVT I;  3HOU I;  2OOX B;  3CCR 1;  4A3D I;  1VQK Z;  2OTL Z;  4RV9 A;  3S1R I;  1WII A;  4A3B I;  2V8I A;  1VQ7 Z;  2AKL A;  3CCS 1;  3VMG A;  2YU9 I;  3RZO I;  1Y8C A;  3OW2 Y;  2ZAE B;  2GU2 A;  3NFZ A;  3IR7 A;  3NH4 A;  3EER A;  4A3K I;  4E30 A;  3NH8 A;  1NP6 A;  1P9N A;  2PMZ A;  2DE7 A;  3S2H I;  1VQ6 1;  3G6E Z;  5C4X I;  4QTT A;  1Y1W I;  1VQP 1;  2NAP A;  1RQF A;  1WCM I;  4MRI A;  2RHB A;  2I3C A;  1Z01 A;  5T6B A;  3OW2 Z;  2E2H I;  1N8R 1;  1VQ8 Z;  3S2D I;  3CCJ 1;  3BG1 B;  3IF8 A;  1YJW Z;  2Y0S A;  3GTG I;  1TFI A;  1PFT A;  1M90 1;  4A3E I;  1ZH1 A;  1S72 1;  1KC8 1;  3CCE 1;  3GKQ A;  2JIM A;  4NFR A;  1YIJ Z;  2KI7 B;  2RBL A;  2QEX 1;  2JUB A;  1VQL 1;  3I4N I;  2PM9 A;  2JNY A;  5T64 A;  2QRC B;  1K9M 1;  1N8R 2;  2RT9 A;  3PO3 S;  3MON A;  3GTK I;  2IZ4 A;  3KIH A;  1M90 2;  4E2X A;  1KC8 2;  2LIY A;  3GTO I;  1YJN 1;  1Q82 1;  1YIT 1;  2K3R A;  3I55 1;  2OZK A;  4NBB A;  3CCS Z;  3CC7 1;  3CPW Y;  2VF1 A;  3CC2 Z;  2VUG A;  1QVG Y;  3GTJ I;  3D2L A;  2VPX A;  1K9M 2;  1QXF A;  2VPY A;  3K7A I;  2JIP A;  4NBF A;  5IP7 I;  2F4O A;  1SFO I;  3FKI I;  3ESW A;  1VQ6 Z;  2NVY I;  1FDO A;  1Q82 2;  5IP9 I;  3PO2 I;  2LFU A;  1VQP Z;  1VQM 1;  3GTM I;  3GCF A;  2E7Z A;  1R9T I;  2EGT A;  3G4S 1;  4RVG A;  2JA6 I;  3CXC Z;  2VPW A;  2QRD B;  1I3Q I;  1Z03 A;  3CCJ Z;  3U50 C;  1RO4 A;  3HOW I;  4NB9 A;  4AYB A;  4BBS I;  4BBR I;  3H0G I;  3G71 1;  1K73 1;  2QEX Z;  4NBH A;  2Q51 A;  2H85 A;  2GTI A;  1W2B Z;  1Y1V S;  3NH5 A;  2IV2 X;  1Q86 1;  1JJ2 Y;  1YJN Z;  1YIT Z;  1K8A 1;  1SIW A;  2JA5 I;  2JS4 A;  3I55 Z;  1RLY A;  3CC7 Z;  1KQS Z;  3HOY I;  4HGZ A;  1VQO 1;  3QWU A;  1YI2 1;  3LUS A;  2M6N A;  3FQM A;  1JJ2 Z;  3VMI A;  5C44 I;  2JA7 I;  1Q86 2;  2PK7 A;  1VQ5 1;  3TE5 B;  3VMH A;  2WB1 A;  3CME 1;  1K8A 2;  2M48 A;  2IZ3 A;  1VQM Z;  3GTL I;  2E9H A;  2VUM I;  3G4S Z;  3HOV I;  4NBA A;  3I56 1;  2JIQ A;  2J6A A;  3EED A;  3CCM 1;  4E2Y A;  5IT9 b;  1USP B;  2JIR A;  3I4M I;  2DE5 A;  2OOY B;  2E2J I;  1YJ9 1;  1WW9 A;  4NB8 A;  3G71 Z;  1JWH C;  2HF1 A;  3BG0 B;  1RO0 A;  4EWC A;  3CCR Z;  4A3F I;  3JAM b;  3CC4 1;  3CCL 1;  5A2Q b;  1VQK 1;  2OTL 1;  1TWA I;  1I50 I;  2V3V A;  3CXC Y;  2JMO A;  2R6M A;  1Q16 A;  2JIO A;  2LEX A;  5CM2 M;  2P28 A;  1N2F A;  3VTN A;  3IFU A;  3CCQ 1;  3J7A 4;  2B63 I;  3MZK B;  3S1N I;  1Q7Y 1;  1VQO Z;  1YI2 Z;  3S16 I;  4X6A I;  3TDH B;  3T4N B;  3RZD I;  4NBG A;  1TWH I;  3HKZ A;  3CME Z;  1I6H I;  3HOZ I;  2OTJ 1;  4HH4 A;  3J81 b;  4BY1 I;  4E31 A;  1WJ2 A;  2RIQ A;  1W2B Y;  3I56 Z;  4MD7 A;  3NDI A;  2AYD A;  1S72 Z;  3M4O I;  3FQQ A;  1VQ4 1;  3CCE Z;  1RO2 A;  4TNU A;  4BY7 I;  4E33 A;  2V8K A;  2QA4 1;  1AA6 A;  1VQL Z;  2O4H A;  1DL6 A;  3CQZ I;  4A3G I;  4NBC A;  1KQS Y;  4Y52 I;  1TWF I;  1YUK A;  1KD1 1;  3CMA 1;  5FLX b;  5C3E I;  3CC4 Z;  3H3V J;  3F3P C;  1Y1V I;  4MXU A;  5IT9 f;  5C4J I;  4A3C I;  3CCL Z;  1YUA A;  4S1T A;  1K73 2;  1Q81 1;  2WAQ A;  4NBE A;  3J80 f;  2DE6 A;  4NBD A;  4MON A;  5LL6 f;  2W04 A;  3HOX I;  2Q4Z A;  1QVF Z;  3GTQ I;  5T67 A;  1QF8 A;  3CD6 1;  3JAM f;  3CC2 1;  3CCQ Z;  4DQY B;  1YHQ 1;  4DGL A;  4HGY A;  2O53 A;  1KD1 2;  3M3Y I;  1K83 I;  4A93 I;  4RVH A;  4XX2 A;  2GTH A;  3S14 I;  5A2Q f;  3CCU 1;  4E2W A;  2JA8 I;  4QTU A;  1Q81 2;  2RPR A;  3S1Q I;  1VLA A;  1NJI 1;  1X3W A;  2OTJ Z;  1VQ9 1;  1VQN 1;  1WZN A;  3CCV 1;  1RNI A;  2QR1 B;  3I07 A;  3F3F C;  4NOZ A;  1VQ4 Z;  4A3M I;  5D1O B;  3J80 b;  1Z02 A;  2KPI A;  3Q87 A;  4DK1 A;  3S1M I;  2QA4 Z;  1NJI 2;  5D1P A;  3J81 f;  1NUI A;  2V8J A;  3IX0 A;  3PO3 I;  4A3I I;  2NVQ I;  2G2K A;  4MH4 A;  4E2Z A;  1X3Z A;  1ZB8 A;  3CMA Z;  2E2I I;  3D9X A;  1VQ7 1;  2JR6 A;  4RVF A;  3P5J B;  1QYP A;  2V45 A;  3MZL B;  4RVD A;  3S17 I;  1L1O C;  1S7M A;  2P3Y A;  5AN9 F;  1TWC I;  1LQL A;  4RS4 A;  2K5R A;  3CD6 Z;  5FLX f;  3G6E 1;  2QLV B;  1YHQ Z;  1VQ5 Z;  2R93 I;  1TWG I;  2NVX I;  3GTM S;  5FLM I;  2BJO A;  1FDI A;  3CCU Z;  2W03 A;  2VPZ A;  2YAD A;  4E32 A;  2QRE B; 
#chains in the Genus database with same CATH homology
 4MD9 A;  1USP A;  1X0T A;  1M1K 1;  2HU9 A;  3NDJ A;  3CCM Z;  1VQ8 1;  1YJW 1;  1Q7Y 2;  3CPW Z;  1VQ9 Z;  1VQN Z;  4A3L I;  3VB9 A;  3KIF A;  5D1O A;  3CCV Z;  4Y7N I;  1ML8 A;  1QVG Z;  1ZB9 A;  3GTP I;  1YJ9 Z;  4CL1 A;  1YIJ 1;  4A3J I;  2F4M A;  1QVF Y;  2R92 I;  2R7Z I;  2QKD A;  3S15 I;  4NH1 C;  3D6W A;  1KRL A;  1M1K 2;  4BXX I;  4MD8 A;  2NVT I;  3HOU I;  2OOX B;  3CCR 1;  4A3D I;  1VQK Z;  2OTL Z;  4RV9 A;  3S1R I;  1WII A;  4A3B I;  2V8I A;  1VQ7 Z;  2AKL A;  3CCS 1;  3VMG A;  2YU9 I;  3RZO I;  3OW2 Y;  2ZAE B;  2GU2 A;  3NFZ A;  4A3K I;  3NH4 A;  3EER A;  4E30 A;  3NH8 A;  1NP6 A;  1P9N A;  2PMZ A;  2DE7 A;  3S2H I;  1VQ6 1;  3G6E Z;  5C4X I;  4QTT A;  1Y1W I;  1VQP 1;  1RQF A;  1WCM I;  4MRI A;  2RHB A;  2I3C A;  1Z01 A;  5T6B A;  3OW2 Z;  2E2H I;  1N8R 1;  1VQ8 Z;  3S2D I;  3CCJ 1;  3BG1 B;  3IF8 A;  1YJW Z;  2Y0S A;  3GTG I;  1TFI A;  1PFT A;  1M90 1;  4A3E I;  1ZH1 A;  1S72 1;  1KC8 1;  3CCE 1;  3GKQ A;  4NFR A;  1YIJ Z;  2KI7 B;  2RBL A;  2QEX 1;  2JUB A;  1VQL 1;  3I4N I;  2PM9 A;  2JNY A;  5T64 A;  2QRC B;  1K9M 1;  1N8R 2;  2RT9 A;  3PO3 S;  3MON A;  3GTK I;  2IZ4 A;  3KIH A;  1M90 2;  4E2X A;  1KC8 2;  2LIY A;  3GTO I;  1YJN 1;  1Q82 1;  1YIT 1;  2K3R A;  3I55 1;  2OZK A;  4NBB A;  3CCS Z;  3CC7 1;  3CPW Y;  2VF1 A;  3CC2 Z;  2VUG A;  1QVG Y;  3GTJ I;  1K9M 2;  3K7A I;  4NBF A;  5IP7 I;  2F4O A;  1SFO I;  3FKI I;  3ESW A;  1VQ6 Z;  2NVY I;  1Q82 2;  5IP9 I;  3PO2 I;  2LFU A;  1VQP Z;  1VQM 1;  3GTM I;  3GCF A;  1R9T I;  2EGT A;  3G4S 1;  4RVG A;  2JA6 I;  3CXC Z;  2QRD B;  1I3Q I;  1Z03 A;  3CCJ Z;  3U50 C;  1RO4 A;  3HOW I;  4NB9 A;  4AYB A;  4BBS I;  4BBR I;  3H0G I;  3G71 1;  1K73 1;  2QEX Z;  4NBH A;  2Q51 A;  2H85 A;  2GTI A;  1W2B Z;  1Y1V S;  3NH5 A;  1Q86 1;  1JJ2 Y;  1YJN Z;  1YIT Z;  1K8A 1;  2JA5 I;  2JS4 A;  3I55 Z;  1RLY A;  3CC7 Z;  1KQS Z;  3HOY I;  4HGZ A;  1VQO 1;  3QWU A;  1YI2 1;  3LUS A;  2M6N A;  3FQM A;  1JJ2 Z;  3VMI A;  5C44 I;  2JA7 I;  1Q86 2;  2PK7 A;  1VQ5 1;  3TE5 B;  3VMH A;  2WB1 A;  3CME 1;  1K8A 2;  2M48 A;  2IZ3 A;  1VQM Z;  3GTL I;  2E9H A;  2VUM I;  3G4S Z;  3HOV I;  4NBA A;  3I56 1;  2J6A A;  3EED A;  3CCM 1;  4E2Y A;  5IT9 b;  1USP B;  3I4M I;  2DE5 A;  2OOY B;  2E2J I;  1YJ9 1;  1WW9 A;  4NB8 A;  3G71 Z;  1JWH C;  2HF1 A;  3BG0 B;  1RO0 A;  4EWC A;  3CCR Z;  4A3F I;  3JAM b;  3CC4 1;  3CCL 1;  5A2Q b;  1VQK 1;  2OTL 1;  1TWA I;  1I50 I;  3CXC Y;  2JMO A;  2R6M A;  5CM2 M;  2P28 A;  1N2F A;  3VTN A;  3IFU A;  3CCQ 1;  3J7A 4;  2B63 I;  3MZK B;  3S1N I;  1Q7Y 1;  1VQO Z;  1YI2 Z;  3S16 I;  4X6A I;  3TDH B;  3T4N B;  3RZD I;  4NBG A;  1TWH I;  3HKZ A;  3CME Z;  1I6H I;  3HOZ I;  2OTJ 1;  4HH4 A;  3J81 b;  4BY1 I;  4E31 A;  2RIQ A;  1W2B Y;  3I56 Z;  4MD7 A;  3NDI A;  1S72 Z;  3M4O I;  3FQQ A;  1VQ4 1;  3CCE Z;  1RO2 A;  4TNU A;  4BY7 I;  4E33 A;  2V8K A;  2QA4 1;  1VQL Z;  2O4H A;  1DL6 A;  3CQZ I;  4A3G I;  4NBC A;  1KQS Y;  4Y52 I;  1TWF I;  1YUK A;  1KD1 1;  3CMA 1;  5FLX b;  5C3E I;  3CC4 Z;  3H3V J;  3F3P C;  1Y1V I;  4MXU A;  5IT9 f;  5C4J I;  4A3C I;  3CCL Z;  1YUA A;  4S1T A;  1K73 2;  1Q81 1;  2WAQ A;  4NBE A;  3J80 f;  2DE6 A;  4NBD A;  4MON A;  5LL6 f;  2W04 A;  3HOX I;  2Q4Z A;  1QVF Z;  3GTQ I;  5T67 A;  1QF8 A;  3CD6 1;  3JAM f;  3CC2 1;  3CCQ Z;  4DQY B;  1YHQ 1;  4DGL A;  4HGY A;  2O53 A;  1KD1 2;  3M3Y I;  1K83 I;  4A93 I;  4RVH A;  4XX2 A;  2GTH A;  3S14 I;  5A2Q f;  3CCU 1;  4E2W A;  2JA8 I;  4QTU A;  1Q81 2;  2RPR A;  3S1Q I;  1VLA A;  1NJI 1;  1X3W A;  2OTJ Z;  1VQ9 1;  1VQN 1;  3CCV 1;  1RNI A;  2QR1 B;  3I07 A;  3F3F C;  4NOZ A;  1VQ4 Z;  4A3M I;  5D1O B;  3J80 b;  1Z02 A;  2KPI A;  3Q87 A;  4DK1 A;  3S1M I;  2QA4 Z;  1NJI 2;  5D1P A;  3J81 f;  1NUI A;  2V8J A;  3IX0 A;  3PO3 I;  4A3I I;  2NVQ I;  2G2K A;  4MH4 A;  4E2Z A;  1X3Z A;  1ZB8 A;  3CMA Z;  2E2I I;  3D9X A;  1VQ7 1;  2JR6 A;  4RVF A;  3P5J B;  1QYP A;  3MZL B;  4RVD A;  3S17 I;  1L1O C;  1S7M A;  2P3Y A;  5AN9 F;  1TWC I;  1LQL A;  4RS4 A;  2K5R A;  3CD6 Z;  5FLX f;  3G6E 1;  2QLV B;  1YHQ Z;  1VQ5 Z;  2R93 I;  1TWG I;  2NVX I;  3GTM S;  5FLM I;  2BJO A;  3CCU Z;  2W03 A;  2YAD A;  4E32 A;  2QRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...