1WZNA

Crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
244
Chain Sequence
MYELYTLLAEYYDTIYRRRIERVKAEIDFVEEIFKEDAKREVRRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNLKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSKVAEALKPGGVFITDFPCGPVVWNEQKGEEKLVIMDWREVEPAVQKLRFKRLVQILRPNGEVKAFLVDDELNIYTPREVRLLAEKYFEKVKIYGNLKRELSPNDMRYWIVGIAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the SAM-dependent methyltransferase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
total genus 87
structure length 244
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1wznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1wznA01
1WXXA 5F2NA 4RVFA 4IV8A 4E2XA 5BW5A 1D2GA 3UA4A 3HM2A 2AS0A 5EIWA 4MHTA 5DPMA 3HVKA 1AQIA 3TFWA 3KU1A 4OQDA 5JUWA 5LQNA 2IH2A 4ER6A 1IM8A 1MJFA 5FUBA 3V97A 2XYRA 2XVAA 4RSRA 5CIYA 1G60A 5DTQA 4QQKA 2FCAA 3PB3A 4MIKA 4KWCA 1JQEA 4HGZA 4PIPA 3DMFA 4P7KA 1L3CA 3LCUA 2JHAA 4LECA 2IBTA 2GB4A 3OU7A 3LECA 3L8DA 3P2IA 1NBHA 3KKZA 3OE4A 3RODA 3GXOA 1G38A 4BLUA 1PJZA 3KQYA 5EHIA 3VC1A 5CVDA 2YX1A 3CJTA 2B2CA 2NXEA 1SQGA 3M33A 5LQRA 3R0QA 3GRUA 5T67A 2NXCA 5DX8A 1VP9A 3KPYA 2GAFA 2V7EA 2DULA 3C3YA 5K0NA 5FCDA 4E33A 3M6VA 3PX2A 2H1RA 1FP2A 2ESRA 4DF3A 2HV9A 4ER5A 1FJXA 3BKXA 2HTEA 1RI2A 4C08A 2OPBA 1SKMA 1B42A 3ANXA 3BGIA 5DXAA 1WS6A 3MTIA 3SMQA 1TW2A 1L1EA 1XDSA 2KW5A 2PXXA 3PFHA 4AZTA 4E2ZA 1UIRA 3OFKA 1EAMA 2JH9A 3THSA 1R8XA 2BR5A 2O0LA 1M0EA 3CGGA 3G7UA 3BWCA 3LKDA 4F84A 2YXLA 2G72A 3T7RA 5DX1A 3LDGA 3KPVA 3B3GA 3BUSA 4HSGA 5F2KA 3UZUA 2UYQA 3FTDA 3JWJA 2I6GA 2ZBPA 4PYMA 3U81A 1DCTA 4NECA 4CTJA 1NW8A 3EGEA 2OXTA 4C05A 1DUSA 3OZSA 1P39A 1XJ5A 2XYVA 1F3LA 3LHDA 3KR0A 4X60A 2ZIEA 4RX1A 3HA3A 5EIFA 1N7IA 3F4KA 4GEKA 1ORIA 4RTPA 3LBFA 2Z6UA 3IHTA 2A14A 1I1NA 2AVNA 3HEMA 2AN5A 1YB2A 3P71T 1G6Q1 7MHTA 2BR3A 4FSXA 1NBIA 3MERA 1OR8A 4RVGA 4Y30A 5HFJA 4DMGA 1ZQ9A 4PYIA 4YUZA 2FRXA 4YUYA 2VDWA 2B3TA 1QAMA 4QPPA 2QY6A 5EGSA 4DCMA 3SVZA 3V8VA 5GP1A 4QDJA 4EK9A 3G2QA 3LPMA 3EVZA 4RTJA 3SX0A 2VS1A 2IFTA 5EZQA 4P58A 4RTLA 4KRGA 2UYHA 1I4WA 4HG2A 1NKVA 4WXHA 5FQOA 5K01A 3CJRA 3JWGA 5EMMA 1PRYA 3E23A 1P1CA 2IH5A 5DWQA 3UA3A 1XDUA 1YFJA 1TPYA 2NYUA 4POOA 3M4XA 3TKYA 3ER9A 4QQNA 2FK8A 5EEGA 5EG5A 4E31A 5DRTA 4FS8A 4GC5A 4DZRA 4BP1A 2AR0A 1JG1A 3NVMB 5BW4A 4IWNA 5DM2A 5DRYA 4EQZA 5IKMA 4YV2A 3BGDA 1R74A 4OX9Y 1RJGA 3PFGA 2YVLA 2HWKA 5K03A 5JR3A 5FWAA 2OBFA 3CKKA 3KQVA 3T0IA 4KDRA 2HR1A 2IP2A 3I9FA 2PJDA 1O9HA 3C0KA 4P7GA 2Z6QA 3UJAA 2GLUA 2CMGA 4BP3A 5T6BA 4IV0A 3E8SA 4E32A 2PVCA 2O07A 4YMGA 3ME5A 3P2KA 4XUDA 3DOUA 4GC9A 5K09A 1KPIA 2OB1A 4QVGA 5FA5A 3B5IA 2NNWB 4AZVA 1NT2A 4OA5A 2OZVA 1N7JA 1VE3A 2P3QA 3BWMA 4Y2HA 2N47A 4C06A 2EJUA 2G71A 4BLWA 5MHTA 1QYRA 3BGVA 4ER7A 3P2EA 3TR6A 2E5WA 2ZFUA 3GCZA 4C07A 5K0FA 2C7RA 1YUBA 2AZTA 2I62A 5DX0A 3A26A 3TPZA 4GOMD 2Y1WA 1RI1A 2HNKA 1O9GA 5HIMA 2OYRA 4EKIA 3QV2A 5D1NA 2PLWA 3HVJA 4P7JA 3DXXA 1X1DA 3DULA 1HMYA 1EJ6A 3RIEA 1P91A 2ZTHA 3ELDA 3PVCA 2ADMA 3QOXA 4RWZA 3LDUA 1NW7A 2IDKA 3SM3A 4X1OA 2ZCJA 3PS9A 1VBFA 2P1DA 2VP3A 3DUWA 3FUWA 3G8AA 3BZBA 1XCJA 2K4MA 4PGGA 1EG2A 1R18A 3UWPA 4UOEA 5HOQA 2H00A 1QANA 2P35A 3BKWA 5FHRA 2O05A 3DP7A 3SR4A 4EMSA 2AN4A 3R9XB 3GRVA 2P41A 3B89A 2OKCA 2XBMA 2ONZA 3EVFA 4HTFA 5LQCA 5CUQA 3S68A 2IPXA 3CBGA 3HCDA 2C7OA 4P7FA 2P40A 5IH3A 3OU6A 2BM9A 4E30A 4DA4A 3SGLA 4PCLA 4X63A 2NP6A 3MB5A 3KPUA 4K6MA 5G02A 5ICGA 3M70A 1SUIA 1I9GA 4E2WA 3OU2A 1ZHFA 1L9KA 2G8NA 2AOWA 5CVEA 8MHTA 1JSZA 1EJ0A 3HA5A 3C6MA 4RTOA 1XXLA 5E2BA 5DLYA 5CVUA 3C6KA 5EHGA 3SXJA 2PX4A 4XUEA 4PYJA 5E1OA 1Q0SA 1BHJA 1WZNA 1L3BA 3NW9A 3TQSA 2ORED 5H02A 1JSXA 3G8BA 3REOA 1RI4A 3LSTA 2C7QA 4V0RA 3M6UA 3HCAA 4CKCA 3UJ7A 1XVAA 3NWEA 1KP9A 2EG5A 3GRYA 4QPNA 3HCEA 1G8SA 3IYLW 4AZSA 4PYQA 4PYLA 4CTKA 4DCGA 5HIKA 1YFLA 5KYGA 3HTXA 1BOOA 1JTEA 2OO3A 2YXEA 3AWIA 2UYCA 5HIIA 1EIZA 5DSXA 3SSNA 3A4TA 5CD1A 4FT2A 1VL5A 3FPHA 4GOND 2V74B 3TLJA 5LQAA 3GU3A 5DTMA 4EKGA 1NE2A 3DH0A 5ICCA 3EVCA 4R8RA 1FP1D 4YUVA 1H1DA 3HNRA 3UJBA 1IY9A 3CC8A 3DTNA 3AXSA 3ORHA 4R6WA 3OCJA 4PCAA 2CKDA 1EQAA 2VDVE 2ZIGA 3G88A 5FTWA 1SVUA 3EGIA 4RVHA 1VP3A 4KDCA 2FYTA 3HCFA 5GM1A 2QM3A 3UFBA 1HNNA 2IH4A 1RJFA 2JJQA 3EPPA 1ORHA 5DM0A 3IV6A 4FT4A 2B25A 2ZWAA 3G5TA 3C3PA 2HMYB 1UFKA 3KQPA 3GWZA 3AXTA 3ER8A 5K0LA 2YTZA 2YR0A 3AJDA 4LWOA 5ICEA 1SQFA 2WA2A 4RTQA 3BT7A 5HILA 4AUKA 5FQNA 5CCXA 4MTLA 1ZGAA 2CMHA 3KQQA 3FTFA 2PT9A 4CXMA 4PGHA 2FPOA 3HVHA 3FUXA 3GNLA 2Z6AA 4QVKA 3KQWA 1ZKDA 5C0OE 5E9JA 2NP7A 5EPEA 1KYZA 4XUCA 4U7PB 5E9WA 1X1CA 5ERGB 5GM2A 3UJCA 2PWPA 3EVGA 1SG9A 2EJTA 3P9KA 4ZTBA 4C03A 4BLVA 2JHPA 2IGTA 2O57A 3EMDA 3O31A 3P9NA 4PYNA 3O7WA 5HIJA 2IIPA 2ZLBA 2ZW9A 3E7PA 2QE6A 3GDHA 3M6WA 2PXAA 3P97A 4FR0A 5E8JA 2Y1XA 3BWYA 3NJRA 3I64A 4R05A 2PX5A 1JG2A 3LKZA 5EMJA 2B78A 4PYKA 3UJ6A 2ZZMA 5E2AA 2PBFA 1KPHA 5ICFA 4RTKA 5FWDA 3HA7A 3CCFA 4C04A 1L3IA 3LBYA 4GUAA 5T64A 1KHHA 1KR5A 3DLIA 3A25A 4ATNA 1WG8A 1ZGJA 1N2XA 1SUSA 2R6ZA 5FHQA 2EX4A 4MWZA 4DQ0A 5LR6A 1YF3A 3FPGA 4XCXA 5C1IA 2PSSA 2ZBQA 3T7TA 4PONA 5LQJA 1NW6A 5GOZA 5U4XA 3VSEA 5CCBA 4R6XA 5EMKA 2JG3A 5EOVA 1Z3CA 1RI3A 3G2MA 3H2BA 4HC4A 3HCBA 2IBSA 1NW3A 3SSOA 2PXCA 2BZGA 3G2OA 5BXYA 5M5BA 3MCZA 2DPMA 3NDJA 4CWAA 1RI5A 1NV9A 4C4AA 2AVDA 3THRA 2JH8A 1UWVA 1VPTA 1G8AA 4OQEA 3DLCA 5CM2Z 4AX8A 2PGXA 2PKWA 2QYOA 3K6RA 4M37A 3FTEA 2GPYA 5LQKA 3FUUA 5EMLA 3BXOA 5C9ZA 1AQJA 2AOUA 2XVMA 3DXZA 1AF7A 3E05A 4PIMA 3EVEA 2PY6A 1NV8A 4F86A 1YZ3A 3EEOA 4IKPA 2WK1A 3MTEA 3KHKA 5GINE 4RVDA 3GRZA 2VZ9A 4QTTB 5DM1A 2GS9A 3SSMA 3HVIA 2I9KA 4RTSA 3B3FA 3GO4A 3O4FA 4HGYA 3A27A 5FA8A 3KPJA 1IXKA 4Z2YA 4AZWA 1RJEA 1FPQA 3EVAA 3FUVA 4M38A 3LCCA 2BH2A 4KIGA 5EKUA 4E2YA 5EVJA 1R00A 1R6AA 3FYCA 4A6EA 4V0QA 4KIFA 3FPJA 3EMBA 5EQJB 2ZULA 5EEHA 4HH4A 1BC5A 2NXJA 4ER3A 1M6YA 2ZWVA 3I53A 3FTCA 4LG1A 1JG3A 5B1SA 2AOVA 3BWBA 5E1BA 5LSAA 3EEYA 3NWBA 3ELUA 3B7PA 3GRRA 1T43A 2G1PA 5E9QA 5CVVA 1G55A 1QAQA 2CL5A 3M6XA 10MHA 3UBTA 3FPEA 1MHTA 3KQTA 3PT9A 3MGGA 1FBNA 1U2ZA 3PLAE 3HP7A 5HEKA 2P8JA 3DXYA 2GH1A 5DM4A 5EC8A 4YV0A 5KQSA 1BKYA 1Q0TA 3FPFA 5K0EA 4PWYA 3JWHA 4BY9E 3A7EA 4GQBA 4DKJA 1VQ1A 5DXJA 5DT2A 2LD4A 4RV9A 3PX3A 1JR4A 2FHPA 4KW7A 5E1MA 2CWWA 3RW9A 2P7IA 1VLMA 2YQZA 3OE5A 3CJQA 3EVDA 4GF5A 2YUIA 5K05A 2ZZNA 4PYOA 1F38A 3OFJA 2ZIFA 2JHCA 3FRHA 2H11A 2BR4A 2WA1A 3KQSA 4G56A 5K0JA 4M36A 2YXDA 4GOOD 4HRAA 3LCVB 2BM8A 4JXJA 4LWPA 2ZBRA 5E8RA 3EGVA 2C7PA 2P3LA 4QDKA 4YUXA 2P3OA 2ZZKA 4YV1A 3OZRA 5HZMA 3FYDA 1INLA 3DR5A 3G2PA 3KPWA 3R3HA 4GBED 5F2OA 3NVKI 1JQDA 5K0GA 4E70A 3QOWA 2QRVB 3G89A 3KR9A 5FULA 1X1BA 3R6TA 3LGAA 3A7DA 4RTNA 1KPGA 4A6DA 4F85A 5KS2A 2AOTB 2P7HA 5E1DA 2IDJA 1JG4A 3Q7EA 1NW5A 4R8SA 2ONYA 2PV0A 4YMHA 1QZZA 2R3SA 3KQMA 2EFJA 5DTRA 3CVOA 1WXWA 5EKXA 5K8VA 1KXZA 2FK7A 3P9IA 4EVIA 2PWYA 4RTRA 4X61A 5CVJA 1D2HA 3B3JA 3KR2A 3UJ8A 5GWXA 3DMHA 4PINA 1AV6A 5GIOE 2AOUB 5D1HA 3ERCA 4MQ4A 2ZSUA 1QAOA 1VIDA 3GGDA 5K0BA 3P8ZA 3LL7A 1DL5A 3ELWA 4O29A 3TRKA 5K0CA 4OA8A 1KIAA 3PTAA 2PX8A 2I7CA 4OBXA 3I58A 1XTPA 1XCLA 2QRVA 1KYWA 4CKBA 3KQOA 1TW3A 1R8YA 4PNEA 1ZG3A 3FUTA 4RTMA 3IEIA 3NTVA 4U7TB 3MHTA 4WVLA 1M6EX 3KR1A 1WY7A 2OB2A 1Y8CA 3JWIA 2AOTA 1X19A 4GOLD 3OPNA 3T7SA 3D2LA 3MCTA 3DMGA 3FRIA 4HTFB 3GIWA 2GA9A 5FADA 3NDIA 3TKAA 2UZ4A 2OY0A 1JTFA 2NXNA 2Q41A 5GIPE 3G5LA 2O06A 4RYLA 3AY0A 1JQ3A 5DSTA 3UJDA 5P8WA 2XYQA 2B9EA 4OBWA 4KVZA 3VYWA 3R24A 4L7VA 3I5UA 9MHTA 3FZGA 4FP9A 1O54A 1D2CA 3EVBA 4X41A 3TMAA 4ER0A 3NMUF 3ELYA 5BP7A 3WSTA 3MAGA 2AN3A 4B17A 4QTUB 1XDZA 3P9CA 3MQ2A 4YUWA 5KVAA 1V39A 2ERCA 3LX6A 2PX2A 3Q87B 2ZVJA 4FGZA 1P1BA 2VDUE 5EZSA 3HCCA 4DM3A 4CKEA 2G70A 3X0DA 1RJDA 3K0BA 4M7RA 3TM5A 1X1AA 5KQRA 3UJ9A 2AOXA 3TM4A 4ISCA 3OZTA 4FZVA 2PT6A 3TOSA 3GJYA 5LQUA 1YZHA 2UYOA 4H0NA 3VC2A 2F8LA 3ID6C 3LDFA 4FSDA
chains in the Genus database with same CATH superfamily
4EELA 2OQRA 3QFHA 2WIKA 5KKNB 3AHHA 1OWLA 4KPGA 1S3SA 3QVUA 4NXMB 5JS2A 5JECA 4ZQCB 4YRJA 5J2UA 1NVVQ 3ZHQA 4OQDA 2OESA 1DXQA 2C4TA 2I8LA 3T3IA 1E2QA 1Y33E 3OETA 1EGQA 1H0HA 1RYFA 2XVAA 2MWMA 4BYMA 5CFRA 2J59A 2IY7A 1NQTA 4UCFA 1ZIPA 4RKYA 4QQKA 3AF0A 3FPAA 3PB3A 1XU4A 2C3OA 5ELMA 2ZXUA 4I8IA 5CW2A 1AKVA 2JJ2D 3HBMA 4MLCA 1EHCA 1UDXA 1DAOA 1FFEA 2R6DA 4WN3A 4G5RA 5AP9A 5G1NA 1G98A 4S0XA 3RIGA 4M8NE 5EI5A 1SWVA 5LP6B 2Z2ZA 1IPEA 2Z83A 3I8XA 3QFCA 4L5IA 5HS6A 5A6SA 2GBGA 3QSYA 2ZYRA 2RGRA 2ZZMA 1ZCJA 4U5QA 3OZVA 5LQRA 3AEKA 3VPHA 3O83A 4ZVQA 2FDCA 3LGXA 1ZU4A 2J5KA 2WLSA 4L75A 5K0NA 3SXUB 3PX2A 1H1TA 4F4HA 5C81A 5FWYB 3M6FA 4MUYA 2X0EA 2IZ1A 2CHEA 3I551 4DF3A 2V7UA 4F5ZA 1MZPA 4TV9A 2HRQA 1NXQA 3M82A 2FOLA 4GLOA 5HKLA 2HW8A 2XNSA 1TE2A 2C84A 5MN5A 3TTSA 1T8WA 4H18A 1M7BA 3SX2A 4YRQA 3SMQA 5KTKA 5FLMI 4F9TA 1OW3B 3HSKA 3MLBA 1S721 3AK4A 4BAZA 2JH9A 4ETNA 1TWGI 1E89A 1QKKA 3MIZA 2GF9A 2BFAA 4G0OA 4C7OB 4COOA 3E70C 3MOIA 3O4VA 1SQ6A 3T7RA 1JNXX 4QUKA 4HNTA 1Z2OX 1P19A 2YZKA 4XJXA 5DOVA 2WHQA 3RK1A 5CITA 2R1VB 2C20A 3B9RA 4OLAA 2N9UA 3IBYA 1LW6E 2H2GA 3RADC 1SUCA 3A4NA 1YHYA 3KR0A 4Y6QA 1IUNA 3OLQA 5EWJB 5EWMA 2BTQB 3D3EA 2R8YA 2BM0A 3PFFA 2FEAA 4IXWA 1G8MA 4ESOA 1TIPA 2O2EA 2B7LA 3GP8A 1KI6B 1DIGA 2BFBA 2I6XA 2MDTA 3WOHA 4JLPA 5DNYB 3DEIA 1QM5A 4FSXA 1EK0A 1SPXA 3U7QA 1X38A 5A9RA 3MFYA 3W04A 5ER9A 2EQBA 1X92A 2FQWA 3IE1A 1Y5IA 1B6SA 2IIBA 3L9WA 3VPSA 4EK9A 4HQ0A 3G2QA 3AI2A 1R64A 5AVOA 4F45A 4RTJA 1Q1AA 3RBVA 3CUTA 2QX7A 5KNDH 1J33A 4JROA 5I7EA 2ZIZA 1C14A 3NFYA 1NJSA 4AF7A 5JNSA 3QWUA 2XDQA 1SD2A 2JA1A 2VAPA 3USCS 2RG7A 3O21A 4PLVA 2XIJA 4IZIA 5A0FA 4MA4A 5D6OA 2AEFA 4Q4JA 3ZHBA 4Q5IA 5LKAA 2P11A 2A9PA 4MGZR 3K35A 1RYYA 1SD5A 3K8YA 3HDJA 2RGUA 4CM4A 2ISSD 4IW3B 5EEGA 1JZSA 2EZ4A 3AUYA 5I7UA 2G0NA 1V6SA 4BP1A 4WJLA 1ISFA 3HI4A 2DE0X 2JGLA 4GDFA 1ZH1A 4GOXA 1H0KA 2Z57A 2FHSA 3GLVA 2PM8A 3H2SA 4NZOA 5IRCD 3F3FC 1O4WA 3IILA 3T8YA 3R0JA 1IMOA 3QK7A 2RHWA 1T2EA 1ORVA 3H5LA 4RIIA 4OQXA 2REBA 1Q0QA 2ZT5A 4FXOA 1IPHA 2RJOA 5C7OO 2E82A 5KDLA 2Y0EA 1X1EA 2CMGA 2JAWA 3DOJA 3FYUB 3L6CA 4MKHA 2X5NA 4MRNA 4WNIA 3SS7X 3TFOA 3V46A 2HF8A 4HNAA 3ZKWA 5CA1B 4B87A 4RAQA 4GU5A 1DRWA 1GRQA 3BICA 3E4CA 4PRYA 3L40A 3UT5B 3CCJZ 3LUPA 4B6RA 1JIVA 4DNFA 2GESA 2O4CA 4XASA 2BC9A 5AVQA 1BCSB 1FNCA 3E3AA 4EX7A 1DIOB 1Q91A 2PCLA 3EXHA 3OIFA 1M33A 3ZWOA 4LHZA 4WY5A 3TZLA 2QIPA 3P0EA 3W6NA 1JEYA 3RVBA 4TL8A 3PQ2A 2QUIA 3FFAA 1L5HA 1OI7A 3A26A 4HUTA 4MUEA 4B44A 2D5IA 2OK7A 2G3YA 2GCNA 3AR4A 3K09A 1XALA 4MITA 5HDBB 1I6WA 4F5WA 2NQ8A 1O9GA 3RVKA 4AWXA 3IAAA 3S2DI 3SIXA 3QV2A 5E7QA 1ZI9A 3OTWA 2UUCB 3RYHB 1B1CA 2VQ3A 3V2HA 1U2QA 4GKBA 4NHEA 1A04A 4A92A 3OCCA 5KJ6A 5L7WA 1X1QA 4F5DA 4P0QB 4ND6A 1R4NB 2VNKA 3RFTA 5BSVA 3WV5A 3LIPA 1XT6A 2HFJA 4TTRA 2GPJA 4FYVA 3K8ZA 4ZK6A 3ASVA 1PEDA 2L69A 3TINA 4A36A 3BFXA 3EEDA 2V7QA 4EMSA 4LDQA 2Y4OA 4YONB 4CODB 2DUNA 3QEJA 1WUJS 3HP1A 4EPTA 5CFNA 3AVTA 3DG9A 3U1BA 3LQKA 4XOUA 4Z1MD 2MJLA 1HYQA 5EZ5A 2DHEA 4S0ZA 4Z0NA 3U9TA 1YMVA 1YHNA 2QSYA 3EGCA 4KQ6A 3S7TA 2V5UA 2P9EA 2AKLA 5AJVB 4MARA 4DQDA 2QVBA 4FOTA 1F6DA 2AOWA 2JCGA 2ERXA 1HT2E 2ENUA 2MSNA 4JK3A 4MPTA 1V1MA 1I36A 1TRKA 3MVEA 4G0NA 4H27A 4Q4HB 2PZKA 4NULA 1XJ0A 3KXLA 3FLMA 2G5TA 1KMCA 2WQ6A 1NG1A 1VDMA 4LNAA 5AW6A 1WJGA 4JBGA 3ZJUA 3JR7A 3NHWA 4TSRA 4YRDA 5EQFA 2EVWX 4HLDA 3HOUI 1OFVA 1RLIA 2REQA 2ZSIA 4Q4AB 5KSWB 2PSHA 2P6UA 3L1IA 2GK3A 2H3HA 5IAJA 3SR4A 3RRJA 3UJ7A 2EG5A 3F5QA 2RKBA 4GXNA 2RIQA 2KE5A 6GPBA 2YQ5A 4QC2A 1JTEA 4QREA 3UAVA 2BFPA 2EKDA 3N53A 3RLIA 4IBOA 2VPYA 1HDZA 3ICPA 1C9MA 3CTMA 4UASA 3A4TA 3VNQA 4ZYUA 2BYTA 1JIQA 4WESB 4MVJE 2O3TA 1NNUA 3QMMA 3BWEA 4R7GA 5DTMA 5EWMB 5EWJA 4ZOLB 5HCNA 3UWKA 4B4VA 2EU8A 1OTYA 1RADA 4IEFB 4YHHB 1FP6A 1M1YE 2G9ZA 1H1DA 1QG2A 4YUVA 4CM3A 2QW8A 3ROXA 4YYEA 1LF5A 1N6OA 3KIPA 2R7NA 1IQRA 3B38A 3FJYA 2RIPA 1XTBA 3FMFA 3PHCA 4PCAA 2J7PA 4E6EA 3UMRA 1NJGA 3UFBA 3X1WA 3R44A 3KVYA 3W5IA 4AX4A 1GEGA 2Y6UA 1EFAA 2JJQA 1JL3A 4UVGA 1T3TA 2VPZA 1T5LA 1HMPA 3E7DA 3N2NA 2X3FA 3IV6A 3OJLA 3OLVA 3PC2A 4Y0NA 3TX6A 2QLLA 3TRFA 1EVKA 3VU1A 4ZC1A 3UT6A 4OFXA 5KMGB 2HY7A 4CIDA 2HRCA 3R5JA 3PFCA 4BLQA 1GDDA 1KA9H 2KQUA 3BRWA 1V6AA 3PUKA 2PX0A 4RTQA 2AC7A 3DW3X 4OMUA 3RG2A 5HZHA 3DDWA 3JQ7A 3U7HB 3TJMA 4YX9A 4DUGD 2GTHA 1C5KA 1Z25A 1P1FA 1P5FA 2CW5A 5A2Qb 2R8OA 3L1UA 5FLXA 4MR7B 4X6LA 1HETA 4IRMA 3DNMA 3D3KA 2GPAA 2Q1TA 4EB0A 2CBGA 3VFDA 2QPTA 1TYAE 5GM2A 2AE1A 4DLLA 3ZLVA 2ODQA 1JYFA 1MU0A 1WE2A 2CNWD 3QX7A 4MTCA 3DO8A 4KIJA 5I4CA 1NJ2A 3JYPA 4C0QC 1JDPA 3NHJA 3LQ1A 1IATA 1Z22A 5HIJA 3PL1A 1OXSC 1YDGA 1FFHA 2PUJA 3CF0A 3IB3A 4P4TA 1TWFI 3GGPA 2IHZA 3UPDA 3QIAA 4DY6A 1WW2A 2NX2A 2F4NA 3EIUA 4XEHA 1H1LA 1CR4A 1HF3A 2OT3B 4NC9A 3TLCA 3VU3A 4BJ1A 3DB2A 4LE2A 3PFWO 3SHFA 4N03A 1A7JA 2IXFA 5B30A 4EM6A 5B3LA 1SXJC 1ODJA 3ZDAA 4GX2A 2ZVDA 2QR1B 4HO1X 3RAGA 1CS0B 1PFQA 3GKQA 2DPXA 2F9LA 3OC0A 3V6MA 2AHRA 1ODKA 2VDQB 3S55A 4ATNA 1EQUA 2YKGA 1ZGJA 3UUWA 1YF3A 2Q7DA 3I4NI 4HQOA 3KVNA 1XEWX 4P2BA 4H1WA 2YOFA 3CIOA 2I2AA 3T1OA 5JSZB 1TTQB 1V2GA 5F5XA 4C4YA 4EW6A 4Z7QB 1YI21 4ANFA 4EGSA 1N2IA 4UTRA 1TU0A 5A71A 1U2PA 1N0VC 2NPOA 3G0DA 3LX4A 3HUDA 1U2DC 1ZH0A 2UZ3A 2WAYA 3PZRA 4HDKB 1RKBA 3OZBA 5FO1A 4X1KB 3E0XA 3W77A 3ZIUA 5B36A 4YALA 5BXYA 1PX2A 4BX0A 2JBHA 1K27A 1ARZA 1ULTA 4OUKX 5IAKA 4AMZA 2XNCA 3L1KA 3Q7RA 5ALIA 2GK7A 1IYZA 1Z5UA 2YHIB 4AX8A 3PKZA 4HPWA 4LVCA 1LSJA 3D6WA 2ORWA 4KQKA 2CF6A 2WIJA 2NSYA 3C3WA 3LJKA 3N8GA 4XM0A 4ZGWA 3BXOA 2BGMA 3NT5A 3G2JA 3I8SA 2AOUA 1C7IA 1T8YA 1KR2A 3O6VA 4OSPA 4TV8B 5T3UA 3WLNA 1PGQA 1U98A 4TNUA 2BEWB 2XLBA 3M4JA 4L08A 4IKPA 3L8MA 4TXJA 4F86A 3MTEA 2JFQA 1E5VA 4CF6A 2QTFA 4CCWA 4CT5A 4TVKA 1UC8A 2YYAA 1OBFO 3STTA 2HGZA 3A6PC 4AS2A 2JRLA 2P9HA 4HH3C 3GO4A 4M83A 5G1OA 4BO1A 5H9WA 3FOEC 4N8DA 3PNMA 3I5XA 2AG1A 3ADOA 3WK6A 1WUKS 1KJ9A 1XAGA 2FN3A 1MV5A 3G1TA 3GFVA 4DJJA 1EVYA 1S89A 1XNGA 4FS3A 4HLQB 2XUHA 4G6ZA 4HWGA 4TWRA 4YPFA 3R7BA 4OGFA 2JEOA 3VNRA 4BO0A 3KX2A 1C30A 2ZYUX 4IV5A 5AHOA 3ZY4A 2NXJA 1FS4A 5I7AA 1OD6A 5KTSA 4LG1A 1A5BB 1IB0A 3AJRA 1EX6A 4YAJA 3RTEA 3HYTA 3PGXA 3R41A 4X5OA 2BKEA 2G40A 3DDHA 4O4LA 3L49A 1DWUA 3B7PA 1A9SA 3NWJA 5CLGA 3BXEA 5D7NA 5LA6B 3CCL1 4BDSA 3EZGA 4TT8A 4HQFA 4IZOA 4YS6A 3LT1A 3HBAA 10MHA 2QEXZ 3C14C 2QJRA 2QJTA 5JVDB 1PEKE 3BHIA 3D2BA 3CMMA 1MIHA 1P9RA 3DEHA 1AZWA 3G8DA 5EXPA 4PAQA 4WPGA 4URXR 4YCLA 2ILVA 2PK3A 3NH6A 3RB8A 3MYYA 4Q0MA 5FJJA 3TTWA 3WAKA 4EHIA 4EO7A 1K2WA 3A7EA 5IMSA 1N1DA 4QTUA 2J0UA 4O6VA 1J9ZA 1S9HA 4Z51A 4LZLA 2Q99A 2R6FA 4P7BA 1WQ3A 2ZJ6A 2XWBF 1RZRA 2UV8A 3HJGA 2MOKA 3L8HA 1THTA 2P2LA 1V8DA 2HRZA 2IEDA 2OV3A 2V96A 4EA8A 4EEXA 1R6XA 3ZV7A 3UYKA 5K0JA 1J07A 1MB2A 2YXDA 5DO9A 1TF7A 1X7WB 4IDHA 3BE8A 1ST2A 1YBAA 1XNRB 3C7CB 4Y6LA 2XOXA 5LDGA 4TGLA 5JO9A 2QZJA 4PF1A 1JPVA 3OWXA 1BAPA 4RELA 4S24A 3FYUC 5PGMA 3QU9A 1V25A 3T34A 5FI5A 3G2PA 4BVKA 1BYUA 4OXYA 4CE6A 2FE1A 6REQA 2HJVA 821PA 5HHTA 3NX4A 3E2IA 3QOWA 3RUCA 4ARAA 1X1BA 3GJ0A 2VDWB 4GGPA 1PFTA 2Z3ZA 3UWDA 4GSKA 4JI4B 3R7WA 3ICCA 1ITZA 3IV7A 3SS9X 4OH7A 1O9BA 1G7SA 4EYQA 1B2RA 3F7NA 3W7AA 4CV2A 3QY9A 3OEHA 4B3JA 4MAAA 3G1UA 2I76A 2PKQO 3EDOA 4D74A 3W5BA 1RYZA 4J76A 4C3OB 1Q7RA 3AWDA 3PUVA 2TYSB 3DBLB 2GFQA 3OJXA 1VIDA 3IUQA 3ERCA 3P8ZA 3LL7A 3CR8A 1JEEA 1KNXA 2J32A 3WLRA 4Q1FA 4D8YA 2H1HA 3ZI0A 3PQFA 2J5BA 2AFIA 2ETXA 3DWEX 1XCLA 3L2OB 1OB5A 2XQIA 1YITZ 1M7GA 4B6GA 1KZ4A 3IPXA 2XMDA 2ET6A 3I1IA 3IS3A 3K0CA 4KXNA 4YMLA 2PS9A 4YC7A 3SFZA 1Q6YA 3S2ZA 4YT5A 1X19A 2VT2A 2ISCA 2NWQA 3EZYA 1H66A 3NRCA 3R40A 1M5TA 3OW2Z 4Z8YA 1QMGA 3VZBA 3THXB 5FADA 4AIRA 4GMDA 1K63A 4MI3A 3AVUA 3WWDA 2W58A 1K97A 1XQYA 2BTEA 4LNHA 4JI5B 3VISA 5FXMA 3X2SA 2WYVA 1E1YA 4WIAA 2NZWA 3NYRA 1RM5A 3P5SA 4A10A 2X1VA 3M5DA 1R37A 3GRCA 3VVMA 4E3WA 1W75A 3OLZA 1HL7A 3LA8A 4B17A 5C3EI 1F2TA 4KE6A 3RJ5A 5BVGA 5J1SB 3RS9A 5KVAA 4Q7EA 1VSTA 4I1RA 3DE5X 1SMKA 3I76A 2QNRA 3DDSA 5C4MA 3C6BA 4UBMA 4D46A 3PC4A 4D02A 1G21E 5C31A 2BMDA 2OCYC 2Q1UA 2WFLB 2IKSA 3SJUA 3A36A 1W581 3OUUA 2EGHA 3T7AA 2P6OA 1CHNA 2VR1A 4OXRA 1GTJ1 1F2VA 3K1AB 3UMCA 1T0UA 1AGXA 1M66A 2J3LA 3DHNA 4JJZA 3A1EA 1FC0A 3OTHA 4O1IA 4OMFG 4H77A 3L79A 1JEQB 2E3JA 4LDAA 4YDSA 4AMYA 4KUGA 2XYRA 2AXEA 1KY5A 3KUCA 4GUDA 2F3QA 2PRYA 3MXOA 5DTQA 5LLSA 1JHAA 4NFHA 2Y68A 4X85A 4YFYA 1COWA 3ZUPA 1HLPA 2JHAA 1W19A 3TTTA 3LECA 1Q50A 3L8DA 1YFKA 1JYSA 3HZRA 3IDFA 4FLMA 4FFSA 3W4IA 4UD6A 2P27A 2EQ5A 4J7XA 1TA0A 1QB7A 3KB2A 3VC1A 3JATB 3BGSA 4ETWA 1QIMA 3LAWA 5C5CA 3HOVI 1DVRA 1U9IA 1Z2CA 3CCE1 2BKLA 3EDYA 4A0FA 5JYBA 4MEJA 2DULA 2XEDA 1GZ3A 1WZUA 2X5JO 1ADBA 3H9GA 3X1DA 2ZJ5A 4DYDA 1Y8RA 1REQA 9LDBA 1U9YA 2D1FA 5LJLA 2XXBA 4B4WA 3I3OA 3QZUA 1HDIA 2GO1A 3C4QA 2OPBA 3Q5DA 3LQ4A 4YLGA 4FD3A 1QGOA 2XKBA 3ANXA 3LY7A 4NAVA 1JHQA 3OZIA 4LC1A 4LJ7A 4UUAA 1E8NA 2UYYA 1TJ3A 4NB8A 1UJCA 3CZRA 3V48A 3YASA 4DA7A 5KX5F 1DLJA 4DMCA 4KDFA 1YVDA 2Z95A 5BNWA 2ZXFA 2BR5A 3A1CA 1A4IA 1GU1A 2WZBA 2Y76A 3DDNA 3G7UA 4R69A 1TDJA 2D74A 2VYND 4HAUA 1PR1A 2IS2A 1XK7A 3LDGA 4LYJA 2OPHA 3D3WB 1CYDA 4TKMA 4HGOA 3T3EA 1VQ4Z 1QQ7A 3FTDA 4MVJM 2I6GA 5B2EA 2Z6UA 3M2TA 1WXFA 2E4VA 2ZAGA 1MQ9A 4QRIA 3WO1A 4QQFA 4C05A 1P39A 3A0RB 1RZUA 2XEXA 1UMBA 3E82A 5A6VA 3BFPA 5I7WA 1Y37A 1QVRA 2C82A 4I4TA 5LU9A 4X60A 3VMHA 1CUGA 2R93I 2X9LA 3E48A 5AR1A 1N7IA 3EIXA 3MRVA 3SR3A 1AG9A 4E5NA 1A82A 1CZKA 1S2IA 2XNJA 2A14A 3WL3A 2ZR9A 5CHYA 3N8KA 1HDYA 1FX0A 1ZK2A 4L5BA 3BG5A 3LC1O 3IOEA 3CZAA 1HFEL 4QG3A 4OYHA 5JU6A 4YUZA 1ZQ9A 1EZ1A 4DR1B 2YDYA 1QK5A 4QRHA 3DEKA 1Q822 2F3PA 4JC4A 1CX9B 1AUPA 1GZDA 3ICEA 4W6QA 4YB8A 5KDDA 3SBDA 2H7YA 3IIEA 3K94A 1E8DA 2O3SA 4ED9A 2NYRA 1JFVA 2VPPA 3A11A 1DAHA 3SX0A 3IR7A 2VS1A 4RK1A 4GVXA 4PZUA 2N3ZA 4R2WA 4WNCA 5EZQA 5C5DA 4ZCPA 2FJUA 4LRXA 6PFKA 4RL6A 1PFWA 1Y7TA 3HO6A 1JEOA 1RWBA 2JFFA 4LWZA 3SDZA 2ZAMA 3FTPA 3HYCA 3LRPA 4UFOA 3J7A4 3EW9A 3C3EA 1J49A 2XUFA 1TZCA 5IT4A 2FW1A 5IANA 1IHDA 1SVMA 4ZOBA 1XRQA 2EIXA 4BHTA 1Q0LA 2WJ3A 2M6RA 4JT4A 1E1QD 4C5BA 4JBXA 1W94A 4KXLA 4F9EA 3AIOA 1N7GA 2IODA 1CDZA 4TX1A 3G2KA 3U48A 4EJSB 4PO8A 3A1DA 4HDSB 3ZJ5A 4C0KA 2AA3A 3AR8A 4ND4A 4QPZA 1QLJA 2OBFA 4JUFA 3SEZA 3ZIAA 2FUEA 2DB3A 1O9HA 3O26A 9ABPA 2HCFA 1Z02A 1T8RA 1XMPA 2G1KA 3NALA 1N36B 2BFFA 2ZUSA 4V3BA 2GXSA 4FOOA 3STWA 4C4XA 2JLAA 1LPSA 3F6SA 1T1EA 3X1XA 3BBPA 2VJQA 4Y1RB 3P2KA 2PQ6A 1SEPA 3WOVA 3H17A 3KLMX 4GC9A 1C0LA 3T9CA 2QSUA 2RGYA 4EA6A 1HURA 1CZNA 1Y1TA 4MB2A 3RSHA 2JK1A 5AW8A 2HU5A 4EHAA 2N47A 1MDBA 2OBXA 4UEWA 4C06A 4NZ9A 4QPDA 4D79A 5DULA 4IVPA 1NSYA 4LMBA 3WLAA 3I9MA 4PFQA 4X7PA 4K86A 5JMTA 4EKYA 5TARA 3ZWKA 4B3CA 3D43A 4EENA 1L9XA 3C48A 3HU3A 3IKVA 2VJBA 3OO1A 4ZT5A 5AK0A 2GWHA 1KDVA 4B79A 4TKLA 4UTZA 5ESDA 3ZV3A 2CHFA 2WM2A 3GEMA 1C4OA 2HQSA 2DG2A 2WDPA 1VQMZ 5A3VA 2PLWA 1Y0BA 5AKZA 2WJGA 3NHPA 2O8EB 3DV2A 1DWPA 4ZO7A 1P91A 1POXA 1ZEJA 2X0JA 4L73A 4BGDA 4TTPA 5KIAA 1Y48E 4WFJA 3GTMS 5HK9A 4D25A 4MQLA 3F6CA 1NUQA 5HP4A 3DHVA 4I81A 2EJVA 5D3QA 4CM5A 4MIOA 2J5RA 5EXEA 5DIFA 1Q83A 1ZD1A 3OT1B 1PL8A 2BHLA 3Q1KA 3I4LA 1Q77A 2Z2JA 3AO0B 4Z3OA 1QFZA 4HN4B 2PRKA 2FWBA 1S2DA 1FFAA 3FD8A 1OZ0A 5DNUA 3FYHA 3MWYW 5EWLB 4FE4A 1P6XA 4HTFA 4DB2A 3F0TA 4BGIA 2C7OA 1RIIA 3JAMb 3BSYA 2J48A 4MD8A 3IQHX 4OXQA 1NVUQ 1JDNA 4GYWA 1IY2A 1I5RA 1Q821 5E38A 2YNMD 3GLIA 4JBLA 3EGXB 1NDUA 1CQPA 2G8NA 2GCGA 5IUKC 2FPSA 3UJ3X 3K5IA 3L8CA 4ZEWA 2V7XA 2FW8A 3DO5A 1VQPZ 2ID9A 3AB7A 4RQUA 1WPGA 5DLYA 5J5CA 3FOWA 1CW2B 3EQ6A 4QM6A 2Z2IA 2PX4A 4QOSA 2M6LA 2TS1A 2P69A 5T41A 2V0GA 1R16A 4CL8A 1ODIA 5K2MA 1KH3A 1FUIA 3P9RA 4K9LA 2AR7A 2C2MA 5EMNA 4MGEA 5H02A 5K3EA 4NU5A 3O8CA 3TS1A 1D6SA 2VWPA 2JHGA 3MS2A 4GWKA 5DGXA 4RYDA 4MH0R 1FMTA 2DHRA 1SBZA 1PUXA 3GNTA 3RYCA 1SC4A 1VPLA 1XZFA 2CCJA 4P3KA 2Q9BA 3DOIA 3KOXA 1R0LA 1DE0A 2C94A 4KAFA 5H3CA 4CMKA 4IYRA 2PMCA 2F4VB 5DBOA 5JE8A 1VKRA 3SPXA 4UULA 4BO9A 3MZ0A 4LWQA 5HQTA 2CFSA 2HXYA 4K9OA 4OU4A 3D0KA 3FCUB 1OHHD 3P2JA 3SZ3A 2GXUA 2FFQA 1OGYA 1JEYB 4UREA 3ROMA 4J2TA 1F4LA 3EULA 4DWWA 2JFZA 1BOFA 2GK6A 2Y1DA 4MV5A 3DVQX 2UZ0A 1I7SB 5DGHA 1NFRA 1K0FA 2I34A 4G37A 4AJ9A 1PR5A 1R9NA 1T3LA 1M9NA 1G1MA 4MKGA 1DMSA 3HE3A 2WWYA 3IX7A 2HA7A 2JNWA 5AKHA 3ZWQA 1V5WA 3OA2A 3GWZA 3QVGA 4TUYA 1P4JA 2X8JB 2IPAB 3GWGA 5EMHA 5U1PA 1VIYA 4QOFA 1NM5A 1IQUA 2HRBA 4NDZA 2UVPB 2VXOA 1PIWA 2WJVA 1NBWB 1Q20A 4NBNA 4TMFA 4XKJA 3G6EZ 2JVJA 3CD61 4YRZA 1V5GA 1R9JA 2A3RA 1VIMA 3CY6A 9ATCA 1TUBB 3G711 2QQEA 5JATA 5HRUA 2Z6AA 4WD3A 3IAEA 1EB8A 5HM8A 1HDXA 4JYAB 3A9WA 1S9DA 3M49A 4NMWA 3NM5A 5FUQA 1H3FA 5KYTA 5IT9f 3GZ4A 1E1DA 2GN0A 3JPYA 1CZHA 1ODSA 3ENZA 1H2BA 2VT6A 2W4QA 3Q11A 4OK3A 5AICA 5ALKA 3UH0A 5AVTA 4AY3A 3FDXA 4NJOA 4F2PA 5L45A 2ZW9A 3GG9A 4AO6A 4RLHA 1JJ2Y 2O8FB 3PO3S 1Q0PA 4NBHA 4D2IA 2G6BA 4YHBA 2WV7A 1XJQA 1TFRA 2J3DA 1GNPA 2VLIA 3R5FA 3IBGA 4PYKA 4UBIA 1VQKZ 4JMLA 5JFGA 4K9KA 5ICFA 3UN1A 1W1IA 2YQ4A 1L3IA 3A6FA 4ND5A 1ORRA 3C8UA 3DJFA 3L6BA 3O82A 4M8SA 1GFZA 2HXSA 2QTVA 1KHHA 1J1IA 1WSBA 2RHGB 5JEDA 5EXSA 3F78A 1OBOA 3IPRA 4DFDA 5FHQA 4JQCA 2RC6A 5C1IA 3KJIA 3EXAA 2J5QA 4IAOA 1F1JA 3DL4A 4XD7D 3IMGA 3BF8A 2PMZA 1HQDA 4J0IA 1RJ9B 3GROA 3INRA 1CPYA 2ACVA 2XQVA 1Z4JA 1T0HB 4HC4A 4JB3A 4BJ6A 3QEKA 2DBYA 1E0SA 3SX4A 1NW3A 3GLRA 2HBYA 1OH7A 1K3TA 2ZJ4A 4BBJA 1MJGA 3OLXA 2CB0A 5KNBD 3CCV1 2VTBA 1SOUA 3IDZA 2AVDA 2Q8QA 3QFRA 2HFKA 2OC9A 3LSYA 4OUDB 1Y8QB 1UC4B 2JLQA 2ZSEA 1Q2UA 5LQKA 2ZCUA 2V8JA 2V7QD 4KN5A 1RQGA 3WRWA 3PQ7A 3WWCA 1ISRA 2WJHA 3LX8A 1NONA 2IVFA 3LI2A 3WE7A 2ODTX 3MWEB 1U0TA 4JOQA 2JLRA 2QM8A 4C4PA 3EEOA 1N6HA 4ZCRA 1CULC 3KKPA 3TZ6A 5DVZA 4TUYB 5DM1A 2GS9A 1M2HA 3IP8A 1JU4A 4UXHA 1PK7A 4ZICA 3BMNA 3MJEA 4BQIA 5EXXA 1JALA 4UZFA 1H5NA 1NXVA 3NP9A 1ZO8A 2XNHA 3NH9A 1Z47A 3OP1A 4Z2YA 5C53B 4YJKA 4D0SA 3SHTA 3FUVA 1YQTA 2PM9A 3LCCA 1DBWA 4KQGA 1P17A 3KTFA 2DHQA 2W90A 3R5KA 2QUZA 1V3UA 4JYBA 1JA1A 4FBGA 5LIPA 1QTQA 4DLUA 4J0HA 5AW1A 1VL0A 3EFEA 3ZY6A 2G80A 1BXGA 4DV4B 2H6EA 1GTVA 3I9V6 1LJUA 4A8JB 4ZP1A 4WECA 2WHPB 4I1SA 5B7PA 2BGLA 2GLTA 3MUEA 5GGYA 2WKWA 3CLHA 1XTUA 3GDWA 4KXFB 2VH2A 4BU1A 1A7AA 2AB0A 2Y2VA 3WLTA 2BDEA 2ZUWA 2UDPA 4YWHA 3WLFA 2GYVA 4DLBA 2YIMA 5TJHA 4MUBA 5JC8A 4L8LA 3UB2A 4I9HA 4UAJA 1WDLA 4WCVA 4WXRA 1C7JA 3QEBZ 1M34A 1HFWA 2RE8A 4A03A 3AQ4A 3CMAZ 1CRWG 1GKKA 4DNQA 1Z03A 3ZGZA 1JMKC 1NBAA 5F1YA 2PGAA 4IY1A 3ZE8A 3GJ6A 4DKJA 4EFMA 3D81A 4RV5A 2AYZA 4J1QA 2FHPA 2IZZA 4GF5A 3EVDA 4PCUA 4PYOA 3GTLI 4DV3B 5H8WA 1T8TA 1YV9A 4DA9A 4V2IA 1SZPA 4BLPA 3K9CA 5A04A 4G8JA 2NUTA 4M36A 4RXMA 1CJKC 2H4XA 1OI4A 3EC2A 2XRZA 5FOSA 1M1K2 1AGYA 4KMRA 3ZDXB 2R92I 4AMVA 5AJZA 5BSTA 5FWNA 3LY5A 5T57A 5E8RA 3FKSA 2XF2A 4KBFA 3HPQA 3T9EA 4IDPA 4B09A 2ZRAA 4UE6A 4YV1A 5EPOA 4HBGA 1INLA 3DR5A 2GARA 3OY2A 4REOA 5F2OA 3C5EA 1TIBA 3O3OB 4GGMX 1DO2A 1K75A 1N32B 2GN9A 2JD1A 2XB4A 1PD1A 1KD12 2OENG 3FIJA 2DE7A 1PHPA 3NG1A 3R09A 4TXHA 2AOTB 3UMJA 4D3YA 2O7QA 4X64B 1GLGA 2Z08A 3IPYA 4EHDA 2ODNA 1TTTA 5CM8B 3GZNB 2D0DA 4EY6A 1HX7A 4C1BA 4F3KA 4KQMA 1HWYA 3GNQA 3M6MD 3O0DA 4Z3DA 1WWKA 1RLTA 3WLOA 2G4LA 1Y1PA 3LKVA 3V6LA 2MR6A 3PENA 2BMJA 3V3TA 4YAGA 3DT9A 1FVFA 4NBWA 4ITVA 3ELWA 3LL4A 4EH1A 3NBFA 4BFUA 3A31A 2V9CA 4AJHA 3R7LA 3PTAA 4DGLA 3IA2A 5M04A 1LDEA 3LNCA 1ENOA 4PNEA 3FSEA 4J9VA 1FFYA 2VVTA 3IEIA 4QGBA 5FBVB 4YRLA 1A1VA 3N7UA 3JWIA 1M902 3EZXA 4DRZA 3LUCA 4KPUB 5KTMA 3RYIA 4PWZA 3HXLA 5JC1A 4C7BA 1TJ5A 2QD3A 1VQM1 1I6MA 1UXOA 1ZD5A 4RZUA 3WLEA 3HXOA 1MORA 2B34A 3PQ4A 1S2GA 3D3WA 4ZYYA 1BW9B 2QUKA 5HIAA 1NMEA 2AKAB 3QE4A 2VP4A 1CQIA 5D3MA 3PC8A 2XYQA 2O1EA 2XADA 4FYIA 1D6MA 4L7VA 4WCFA 4J6FA 5CR9A 1FZTA 4ER0A 5TMPA 3LLSA 3WSTA 5JMOA 3MAGA 4B3BA 4L28A 1DHTA 2J0UB 4QTUB 1RZ3A 1YQUA 4KQEA 3K31A 1CUJA 1GQOA 2XSZA 3MINA 2H4WA 3HK2A 4OHYA 4OATA 1KJWA 5ITWA 1ZSYA 5CHEA 3RUAA 2GZMA 4XWGA 1A72A 1C1XB 2Q2QA 4UEJA 1U5BA 4Y2RA 5FEMA 4BCBA 2JS7A 1FQJA 1WUYA 1XFDA 2AQ8A 1FSZA 1PLJA 4NH4A 2O8VA 5F51A 5LQUA 4HAZA 3UUFA 2ZXEA 3O8NA 1G2OA 2AMFA 3N8NA 3O47A 5K0TA 4CLRA 5JLAA 4A3SA 3JATA 3T5TA 4WY8A 2WJYA 5AHRA 4BKQA 2M32A 2I4TA 5A3QA 4GMGA 1TMGE 1JE1A 2MMCA 3DOEA 3G59A 4CUZA 3C2QA 1L7DA 3TGPA 3CCJ1 2ACWA 3O94A 1K732 4LXXA 2B20A 1G3UA 2PUWA 3V4RA 1YR1A 2CFRA 1Q3KA 3W78A 5K20A 2XT6A 1Q1GA 1GPYA 1OYVA 2EERA 1YS4A 4C22A 3ICOA 4AJKA 1L5OA 1NBHA 4I55F 4KQIA 4R9UC 4B35A 2I2WA 4JBHA 2CNDA 1Q1EA 3OPQA 3IELA 4BLUA 3AYZB 2RT9A 3FSRA 4HZUA 1IEVA 4CG2A 4I7EA 1SQGA 2YVAA 3ETNA 5B6JA 3ZTWA 4UUMA 5DX8A 5F1OA 2FMXA 3LK6A 1YTLA 4BE7B 1M10A 4I1YA 2X19A 5ECYA 3VGPA 1GCUA 4LYGA 4QEZA 5FBKA 2DOKA 3WLHA 4RS4A 1QHYA 1Z0FA 4O59O 4X1IB 1ACMA 1O08A 2J6IA 4UFPA 2INGX 5AUOB 3FWNA 1LLUA 2CDRA 2ZTLA 2A1TS 2ORIA 2E5FA 3AR6A 3HKEB 1JR2A 3MTIA 4H7KA 1GGVA 4EW1A 4I55B 1VKNA 5C1OA 3B70A 2DRIA 5BRNA 3NEJA 2Q5HA 4Z4QA 3NAGA 3A1VA 4CKBB 2NNLD 3EIQA 2BGKA 2IZ0A 1RQNA 2QE7A 1E3DA 4GPBA 5I7SA 3TTUA 4CIWA 2ZBPA 4HZIA 1WHTA 4UDOA 3SXPA 5LOVA 1PNRA 4R2IA 2JLVA 4O25A 2QP3A 1XJ5A 2EAUA 2ZJ0A 3PEVA 1EFHA 3DWGA 1SC1A 4M9CA 3ZEIA 4BTLA 4N41A 3A2LA 3OX4A 4M60A 2JFHA 5COAA 3FKII 2F3SA 1L7BA 4JL5A 3T4PA 5IVPA 2IZ5A 2P9JA 3ULKA 4GMFA 4ZAWA 2BDTA 2WU8A 4Y2PA 4Y6GB 1P9OA 1Z2DA 2HXGA 3AC0A 3DKPA 4IIYA 3UCXA 3V1YA 1P4SA 2GZ2A 3WAJA 1R10A 2PRZA 3VPFA 2WTXA 5JROA 2CLDX 1G6Q1 2XE4A 1FNSA 1UMDB 2NN3C 3ZNOA 4DMGA 1DRJA 4Z7JA 3K2IA 3WGTA 5FLEX 1QAMA 4CQMB 3AUSA 4WRRA 3VU9A 2EFCB 5FRDA 3EXFB 3QWIA 4X1IA 3VJMA 3HXPA 2JUBA 1ECFA 5GP1A 4O3MA 1KDPA 5CB4F 2IP1A 1F48A 4Q24A 4INAA 2IFTA 1KBQA 3NHUA 4LYHA 3K1ZA 2ZRIA 1HBJA 3DGEC 4GM4A 4LI3X 4RPGA 3JWPA 5SZJA 2PKEA 5DI3A 5EMMA 3SR0A 4KREA 4FTWA 4TLAA 2D8AA 4B32A 2IH5A 1LNQA 1XDUA 2BMFA 1GITA 3CGWA 3N5CA 2VTKA 3MUFA 4Y2QA 2P0EA 2O2GA 1WXEA 3FDJA 3F46A 2AKYA 4XRRA 4JVLA 4ALNA 4YYZA 3INNA 4MR7A 2BMVA 2J9RA 2OLEA 1W48A 1WTCA 1YCDA 3P2MA 4N5MA 5TGTA 4BVAA 2JAOA 4CQNA 2JFUA 2R8XA 4RJJA 1LLQA 3N6VA 2WVGA 5IKMA 2YW9A 1SKAA 3NJ4A 4MVJH 4D9EA 1BMTA 2R1UA 1XWWA 2FUNB 4MR8A 5D85A 2P68A 3FPSA 2HI0A 4OHUA 1M5RA 1B6TA 3V1TC 5JR3A 4M7WA 2P0AA 3KQVA 4MVJG 1JF8A 1T6NA 1W52X 2X76A 2CEKA 2OCXA 1B6GA 4TYPA 2B3DA 2GEBA 3LDAA 4E32A 3E8SA 1IBKB 2BI8A 7YASA 1RWNA 2NVQI 3WR5A 3HU1A 3H9QA 1V7PC 4JENA 1TF2A 4EG6A 1BA3A 3STVA 2NNWB 1MG5A 1FYWA 2IXAA 3LBNA 5BOSB 2IJGX 1L4LA 1AZTA 4FJ2A 2XCTB 1TEZA 1GAWA 3NOXA 4AFNA 4LDNA 3NYQA 1QU3A 4IUBS 3RFVA 4UNQA 1GAJA 2VJMB 2XUOA 3S5UA 2PSDA 1RKXA 4V1CI 4MXDA 2WSBA 1K08A 4EUHA 1YJ91 1KAGA 2A9QA 2NO5A 4R01A 1T91A 4X3PA 2FEWB 2AFVA 3ZJ4A 1GTZA 4UHBA 1WB6A 1J0EA 4Q48A 3A3YA 3GJQA 3HVJA 3W5HA 3CVXA 4A3BI 1LGYA 1MOSA 5E0OA 5GV8A 1MTOA 1IZ0A 3ELDA 5HJ2A 5IJXA 5AVYA 4YH1A 1E59A 2G67A 5AVSA 2H4ZA 2Q7OE 1TCAA 2I3CA 1VBFA 1R6UA 2AJ8A 2ZRCA 4HDRA 3KEQA 3CXCZ 1E6UA 2ONKA 1XCJA 2R47A 3D9QX 2MT9A 4MYDA 1T0JB 3PDWA 4G0XA 4PO1A 3DE2X 4DY4A 2FR0A 3IE2A 4D9KA 5AVZA 2G06A 3BKWA 2WAAA 1TO6A 2AN4A 4BBAA 1WO8A 1F8YA 3GRVA 2V03A 1GOTA 1KMMA 2OKCA 3KKOA 4RFSB 1XDDA 2E4AA 3A3OA 3S2YA 4AY4A 3RRMA 3CE9A 2BFMA 1DKUA 3NWOA 4OK5A 3OU6A 1H9BA 1VJ5A 4KRYA 2XDYA 3U4CA 4DMUB 4PCLA 5A1TA 5KSOA 2GN6A 4PBSA 2I7DA 1T2CA 1ODFA 1ONSA 3EAFA 4R7ZA 3T7EA 5LM3A 3AR2A 4N6OA 1VCNA 4LI0A 2P5SA 4MQEA 1G21A 1V7ZA 1QH1A 1WM1A 1MBZA 3GRAA 3OIWA 3GBSA 4JEMA 4KSYA 3VDRA 1KQNA 1RMQA 2C5SA 2VF4X 3RS4A 3ZWDA 1SK8A 3WZMA 4EI9A 4MDFA 3KKNA 3KYIB 1A97A 1CE8B 1FUYB 1YKSA 2QM7A 2OP0A 2Z1MA 4AQDA 4ZDKA 1UXIA 4LV8B 2AYXA 3GUHA 1P1JA 2UUPA 3CB4A 3MS7A 4IIFA 3T54A 3K73O 1S72Z 3PJRA 1RYEA 2I2BA 4MIYA 3ZWWA 1C4XA 4F8JA 1DNPA 4ZAFA 1SCUB 5H68A 2DFVA 1R0KA 2G1JA 4MULA 4TWBA 4B31A 2VA9A 4PAMA 4O33A 5FNVA 4JXZA 2AF3C 3Q3VA 4TWIA 3WP0A 1YFLA 1R6DA 2A1IA 4IDCA 4JGBA 3ZWYA 3AUXA 3V9PA 4XWOA 1J09A 4OLHA 4NVRA 4O4LB 2AN1A 4IIUA 4HYYA 2CZQA 1HYBA 2HPHA 3H11B 3NHAA 5DMXA 2CE7A 3GJXC 3P32A 3B1JA 1H8ED 4ZOAA 3H04A 4LK3A 1YQXA 5G3YA 3C7KA 1H8HA 3DH0A 1FTQA 2PFSA 3GUZA 1W76A 4HATA 4H4EA 2J0SA 1Z3IX 5GADl 4YDRA 2J9XB 3ONDA 4G86A 4RK0A 4IX1A 1V41E 3V8RA 1FSPA 1J90A 3TX2A 3VYTB 3DV0A 2CLHB 1MMFB 3MTQA 1SVUA 3EGIA 1JLLA 2ZI7A 1J70A 1OQAA 3MAJA 4D82A 1IM5A 3H86A 1Z37A 4QBFA 3TQCA 1TJYA 1Z5OA 4CQMA 4U7DA 1WMFA 1PO7A 2J67A 2R62A 4X91A 1YS7A 3TYXA 5B2FA 1PCXA 2YVUA 2ZR8A 1UFKA 1FFXA 3NORA 5EY5B 1JDVA 3VVCA 3COWA 2OXEA 2ZPAA 3A1WA 4CLOA 3OX3A 3GUVA 4FHZA 3BG0B 3HB9A 1NUTA 1X0VA 2WHPA 4AUKA 2HA2A 2IBMA 1XI2A 3EFHA 4A8JA 3ECSA 3W06A 2YV4A 1RHRA 3DDUA 5G4KB 3TE5B 3VPGA 2PMDA 3G8CA 4M88A 4M9SA 1ZKDA 3MUNA 3VZPA 4KGZA 1GL7A 5MN6A 1H0SA 2NP7A 4D8VA 1N77A 4V02A 1LCIA 4F60A 5ITZB 4X8MA 5IX8A 1KRWA 1PQPA 5ALVA 5D2CA 3GPCA 4KMSA 2W0MA 3OF3A 1Z4QA 1R4NA 2L0XA 4H6VA 5CX1A 1YJNZ 2A0XA 2O57A 5TE9A 1AMOA 3IHLA 3EMDA 3O31A 4LJ5A 4AXBA 2IIPA 1Z4IA 4FR0A 2VHEA 3LWDA 4H7JA 3KUKA 2EZUA 4HDMA 4JQSA 4V24A 5HQJA 4IHQA 4OJMX 5ITVA 2KX7A 1PK9A 2ZRLA 1R8SA 4JA0A 4UEOA 4WK2B 1ZNYA 4JI6B 3KL2A 4J7CA 3W8NA 2D2XA 4UOZA 3D4OA 1CR2A 4Y7DA 3UPTA 2IQIA 1W47A 3HN7A 3LBYA 3V2IA 2VF5X 3NWPA 5TC4A 3QVGB 2XHZA 1HE1C 1LWOA 1KRLA 2ZIAA 4O8CA 1SUSA 2FPRA 1R0WA 2F1RA 1NUPA 2ZT8A 4FHCA 4LJLA 3ZE9A 2FPGA 2HCRA 4J4BA 5LR6A 5F7JA 3QI7A 3BRQA 2XI4A 3TLEA 5JJLA 5U4XA 1AKEA 1U9IC 5HA5A 4N3CA 1Q7TA 4O0MA 1TA4A 2CYCA 4WT7A 4P82A 3P0JA 1GYQA 4QJ4A 2WE7A 3K53A 4GM1A 3OCZA 1N2GA 5ICSA 2FZ4A 1QF6A 3ZU4A 1PJLA 4Q9LA 3V1KA 4QSHA 5JT1A 1EBUA 3B20A 4KAXA 4EYOA 3QU2A 1GRRA 1DC8A 2F3UA 2HX1A 3K6RA 3AOEC 3NHKA 4CT4B 4HOYA 3DNPA 1XKQA 1Z0AA 2HRDA 1F4PA 1MXHA 4LY9A 2CYBA 4U2EA 2YV1A 3Q5EA 3CNQS 1IN4A 4B3XA 2FRVA 1YS2X 4KO4S 1Y80A 3E3NA 4BRZA 1P7WA 2Q2VA 4FFBB 4LGCA 1OIXA 2J87A 3IAFA 4U9HS 2YDXA 2ZDGA 2GAJA 2VZ9A 3PTZA 1T5IA 4WZAB 2NU7A 4NMMA 4BXOB 3W8RA 5HSGA 2H4HA 2DCUA 3G6WA 4IEEA 1VI6A 3R2JA 1IXKA 1ZL0A 5FIUA 3FPCA 1KP2A 1RWQA 2OCIA 3CYFA 3GLUA 5IJZA 1A9ZA 3FI0A 1AQYA 3IQFA 4ZEMA 1DKRA 3ES9A 4DIDA 1UEJA 2BH2A 4E2YA 1L6RA 1VGQA 4IFIA 3RAEC 1VCHA 2BWJA 2WHYA 4X45A 1QE5A 1R9MA 2WFZA 3A32A 3C6XA 4HDCA 4IFTA 2Y6VA 2JH3A 4XSHA 4A73A 3RC3A 5B1YA 4ER3A 1ZJ5A 4JJEA 4YRAA 4A3EI 1E2BA 2B98A 2XCIA 4N0DA 4GZMA 1VB3A 2HH9A 1P4GA 1PVVA 3N74A 3GNSA 3S2HI 2D59A 4ZVTA 2IXBA 1GZ5A 3BWBA 3IT1A 4HDMB 3VNAA 1EK1A 2J33A 1EE9A 1F17A 2YYYA 3OPXA 1KI6A 4DBLE 4J0KA 4Y9SA 3GTGI 4POAA 4RKWA 4XYGA 4BBZA 6CHYA 2G04A 3DFMA 4EUFA 1QAQA 5A7GA 5JW6A 5CT9A 1U3VA 1UBTS 3BB4A 1IOZA 1T25A 2YFHA 1YCFA 3F5SA 3I6QA 4KACA 3TL3A 4EGQA 3HZZA 4R51A 5AQ1A 1FDVA 3HDGA 1R27A 3C39A 1QS0A 3GGOA 3CLUC 3WWPA 3JWEA 4P36A 4TN5A 2AZMA 3RYTC 4YRKA 3IT3A 1TUIA 1DIHA 1XZCA 2VT3A 2UVQA 3D7LA 3OEHD 3OZEA 3QJ5A 4FMPA 3TZEA 2QDXA 4EOGA 5B3JA 2ZUFA 2COEA 3CPHA 2Q49A 3PX3A 4M8IA 4BWYA 3ILSA 4FILA 4M7PA 3O4RA 3ZEAA 4IDBA 5B1EA 3CF6R 4JOBA 3QE9Y 1XRMA 2C07A 4HEHA 2B4KA 3UNXA 1C9NA 4XJSA 4G25A 4K1LA 3SHVA 1OAKA 4GOOD 1XKXA 4B1FA 3H1FA 2IHBA 5TX7A 1OZFA 1W35A 4XVRA 1RQ7A 4P32A 1YJCA 3TMYA 5K8IA 2OLJA 4Q02A 3R3HA 3UO8B 4Z99A 2IX3A 3NVKI 4NIMA 3IDQA 3SZUA 2FOIA 1E1KA 2HPAA 4E03A 2AD5A 4B7CA 2BW0A 1KQSZ 1GG2A 2V0CA 1XK6A 1QQBA 3L4BC 2JBAA 4UHHA 4Y0VA 1UBLS 4LRTB 3IUEA 1PWZA 4QO8A 3TZKA 1QBKC 2NZJA 2PVPA 3R0VA 3F74A 2H0QA 3HHPA 2VUGA 3GEIA 4PPGA 4Y18A 1SXPA 1DRKA 5EP1A 1AGRA 2PXHA 3I2IA 3P9IA 4BQSA 4EY7A 1EU1A 1KRHA 4IIBA 3KSZO 4F1WA 1ZD9A 3H9JA 5JDCA 2GBFA 1AK9A 4YMVA 2XCQA 4CM6A 2XWQA 1HRKA 1NPYA 1G5IA 3CPEA 4G01B 4TS4A 2PNJA 1TIKA 5EIXA 3WTCA 1FS5A 2Q8PA 3UHAA 3L8ZA 3N07A 5I9SA 3OOJA 1M6VA 1YRAA 2PZBA 3IR6A 3Q9NA 4PC7A 1TVEA 1PP4A 1NFFA 2E4UA 4YFVA 2C2GA 4KH1A 1ESEA 1HT3A 3GYGA 4M8LA 3P1JA 3H1GA 3WIVA 4I1PA 1C7ZA 5BV1A 4S35A 4KQJA 4NE7A 4AN0A 5F35A 1A96A 4F97A 2OB2A 2JLYA 2F62A 3T7SA 1XPOA 1MNQA 3GIWA 1YA8A 5EWLA 1A88A 3GLKA 3GL9A 3QX3A 4M1KA 3V1MA 4HNAB 4GNRA 3ZKWB 1KQFA 4BQRA 3ZWVA 3KC2A 3AUKA 3RF6A 3S70A 1NURA 4BV2A 1Y5LA 3REGA 4EJ0A 2H1IA 4J1TA 5ES4B 1U8XX 3U80A 2VYVD 1U3FA 3B5JA 3HHEA 3I5UA 4HJRA 2ADOA 1OUMA 1FFXB 3DOCA 3ELYA 4IXTA 5JH7F 4O2AF 5BYAA 2OHGA 2HDHA 1TLLA 2JGDA 4MR9B 5J1TB 4BAGA 4DLXA 4EWCA 4JLSA 5EZSA 2C4VA 1JIIA 3UXHA 3SEAA 1W5AA 1NXSA 1IN1A 3JRNA 4RPIA 1C81A 2JAUA 4XE5A 2RBLA 2AG6A 3EH1A 1U7OA 1RVV1 2VC2B 4MGHA 3VKUA 1OFUX 1T15A 3BWYA 2CGEA 5BT8A 2W00A 3VOSA 1C1DB 1Z6YA 1RP7A 4CIXA 4OLBA 4BX9A 1MKYA 1NWCA 1TCUA 2X6TA 5DPMA 4AVYA 2JLUA 3GG2A 2FP3A 3U5TA 3JU3A 4D4KA 3I39X 2IH2A 1H4VB 1DPFA 3H9UA 3CVWA 4ZI3A 1G60A 5DTJA 3HFGA 1GILA 3ZBQA 4XQ0A 4UJ3A 2FCAA 2IDMA 3WIBA 5TT1A 5BMVF 2XW6A 4GXTA 4P7KA 3WYNA 1EP3B 1L3CA 3NBQA 3QNMA 4PSAA 4BVEA 4C7KA 2OD9A 4G1MB 5CIQA 1G38A 3H2HA 1RXIA 2D3TA 1MHPA 4CQLA 2YWCA 2C57A 2QXUA 2RHOA 2VSXA 4GQAA 2D2FA 4QG7A 5CGZA 5CVDA 2B2CA 3ZBPA 3L7BA 4Q9HA 1I7QB 1CJUC 2AFIE 2IYOA 2NXCA 3BTUA 2H31A 3OX2A 5B3AA 2AMLA 3CPWY 2GAFA 3ITEA 3ZWPA 4E33A 2FWNA 5IVKA 1YZTA 4DDVA 1AJEA 1PG0A 2ESRA 1KC3A 1QVWA 2YINC 4JUIA 3KZOA 4J2HA 4LRSB 4KXQA 4E88A 4OFBA 3ZDRA 1W36C 2FMFA 1PZNA 3SYNA 1DCFA 3OLWA 2V3CC 3SG0A 2F1KA 4ARSA 5EHXA 1R5BA 2LDXA 4LJ8A 5BW6B 3CCVZ 2JNYA 3IKLA 3VYRB 4CMCA 4C2TA 1E9BA 5LQDA 1V11A 1GSIA 5G0TA 4ZTZB 1AGPA 1C1YA 2R1TA 1EUQA 1X7ZA 3LPDA 3J81f 2X2OA 3LQRA 1JKMA 3HMQA 1Q2XA 3I92A 3LUDA 4HDRB 4PANA 4CEHB 3PEEA 1R4MB 5DV9A 1W73A 5IW8A 1YASA 3IL2A 5EJ8A 3VYVA 1QTRA 1KD11 5TS3A 2XD9A 1OLUA 1RXSA 4QLAA 4DDUA 1L4YA 4Z4GA 1GQFA 2E6UX 1CP2A 2IT1A 4RA9A 4BCDA 2VJAA 1Y9JA 4NH0A 2PJRA 4H7HA 1V3TA 1EKXA 4V3CA 2A35A 1X87A 3P71T 4ZVSA 1FOEB 3KSAC 4Z9YA 2A1UA 5TR9A 4UCWA 1HDRA 3OIVA 3OZDA 4XM1A 5COBA 3U0VA 3UJNA 2AZXA 5T6MA 2JB9A 3V8BA 2O4HA 5C7YA 2AFHB 2PPVA 1P0FA 4Q4DA 4M86A 4HWKA 5A4DA 3EEBA 5DISB 1Y9ZA 3BDIA 4KNVA 4MAMA 3WGMA 5ERXA 2W7TA 4L85A 1RPTA 5BT9A 3IOYA 1RHKA 3NBYC 3E5MA 4DT1A 1YB6A 3C5CA 5JY1A 3NZEA 3UB3A 3P4YA 1K6EA 2LKCA 2WJZB 1EPUA 1KOLA 2WSYB 3VKFA 7GPBA 2FEMA 2H18A 3GB9A 3IUBA 5JADA 4POOA 2XMZA 1NNEA 3O9VA 4TLLB 2Q51A 2IIQA 3KB8A 4NCKA 5ALFA 3MEQA 5EG5A 2ABWA 3U3JA 3DMNA 1BMFA 3GK3A 1A3CA 5DHRA 4K9MA 4ZAZA 2YYSA 1VGVA 4D6XA 3WDLA 1WCYA 2JCBA 3CPSA 4F12A 3BGDA 3D54D 5CT4A 3MG9A 2NLOA 5G4LA 2IYRA 3PXEA 3AJAA 3VDMA 5A5FA 4N4AA 1ILWA 4G5HA 2IP2A 2XRMA 3C0KA 3G13A 3RYCB 1L1FA 1K2VN 3UJAA 4ENVA 1ZBDA 5LLDA 3D0QA 1DFIA 2QN6A 3COPA 2XJ4A 1E2HA 4KBGA 2QE7D 5C8YA 3TE6A 4OPMA 3R5HA 4IUCS 3OQPA 1YHQZ 1WA5A 5JAOA 4UUOA 4XUDA 1BW9A 4ILKA 4RVSA 2XR1A 2XOEA 4Z5XA 1FF9A 3JAWA 1ZW6A 5AM4A 3VPDA 1YNSA 1BDBA 3LCRA 1F51E 4D4LA 4K40A 4M1YA 1T1SA 2V4ZA 2JAHA 2QAGA 1XU9A 3B2QA 5EFZA 4OHCA 5MDHA 2DR3A 4KEAA 4Q9DA 1G291 4X8HA 1EB9A 1BN7A 1Y7PA 3IVAA 1WOMA 1D07A 1NQVA 3KD3A 1MB9A 1NSTA 2C97A 2POCA 4FX5A 2XAUA 3RWMB 4C07A 4V39A 3K15A 1GKLA 3EBPA 2W2PA 3D2AA 1IBSA 4HY3A 4RENA 3LHKA 4ZT7A 5K0ZA 1M2VB 1R1DA 3IDAA 3W34A 4KQHA 1T9GS 3LT5A 4PG4A 1S8AA 4A3JI 1WXHA 3B1XA 3DULA 1N3BA 4MWTA 2ZTHA 2XMCA 1BRMA 1IG0A 2WT4A 3KQHA 2HO5A 4HUQB 2Y8EA 2R2AA 4LF7B 3SM3A 4WLNA 1IXYA 3UQYS 3SFVA 3N6RA 5DYWA 4HF7A 4P4GA 4P53A 3G8AA 3IAS6 3HXTA 4R2LA 2XMRA 2O3QA 4N5HX 2WTBA 4TXNA 2VCEA 1Z6TA 1I24A 1J99A 1CU1A 1HSZA 1OLXB 1OWOA 2ISQA 3LIIA 1JTVA 3MMNA 1QJ4A 2J85A 1QHGA 3PC8C 1WF3A 4YPOA 4B47A 1WBDA 2FI1A 3EVFA 4F6CA 2EFDB 4OHRA 4BPRA 5BN4A 4P7FA 4RLQA 1YIJ1 4RCYA 3SLKA 4FFLA 4ND3A 4AWAA 1U0HC 1WV1A 5LL6f 1JPJA 3M3YI 1TQ8A 4QGAA 1KO5A 3PLNA 5G02A 3W3AH 2HCBA 3HJBA 1I9GA 1V43A 5LXTF 3W9SA 1II9A 1C30B 2YY7A 3PXXA 4A26A 1F2UB 1EGVB 5ELXA 1EJ0A 2DPGA 1DUIA 2QY9A 3AKCA 5B1HA 3KZMA 5DNEA 3LVRE 5HF8A 1JLRA 3HEAA 5J4KA 1E3JA 1N33B 1JDSA 3E35A 3PFNA 5EHGA 5SV2A 4E5VA 1DEOA 1ECJA 3H9CA 4XUEA 5NLLA 1Q19A 3LT2A 4EIWA 4CN9A 1WZNA 4DEXA 4ZOCA 3EDQA 1XPRA 1XMSA 4HEJA 1JSXA 4XX0B 3IOCA 4H3VA 4L16A 1CJTC 5DEIA 2WC1A 4LW8A 1GCGA 4HFJA 4JNCA 1PDWA 2GM3A 3NWEA 2J9ZB 3F73A 2Q50A 5ENVA 1EVEA 1A2OA 3MJRA 3P45A 4JJ7A 5L7YA 4N65A 1LZLA 1TYEB 4AZSA 2D1TA 4C20A 2WBLC 3WYGA 1CVLA 1TWHI 4WXPA 2YHAA 3RTGA 2QF7A 3DWIA 3GJ7A 4QUAA 5DGIA 4XEUA 4PC2A 2Y77A 1UUFA 4ZIRB 1CUWA 4HEQA 1N6KA 4RDXA 1IY8A 1TLTA 3UY4A 2IYFA 4RY0A 2FG6C 4V2UA 4C0HA 2QJOA 1CHDA 4NBCA 3GT3A 4ZREA 1DKQA 1U94A 3QU7A 3SI7A 4KNYA 4PFJA 1DEKA 1Y3HA 1GTG1 1DQSA 3A6DA 4HGNA 2H7CA 5K8LA 4LF4B 3DC7A 4KO2S 4KV9A 1ADJA 5AKIA 2UXBB 1XNHA 1EH5A 2CKDA 5JHHB 1TM4E 3D5QA 1Z82A 2CVZA 1P81A 2PS0A 1H2RS 3NHLA 2FYTA 1T1JA 5IP7I 1E99A 4BNYA 1GGKA 2R44A 4A16A 1KI2A 5C44I 1M75A 3UK0A 5J2UF 1O95D 3H5WA 1DRVA 4DSUA 4G9EA 1W5TA 1CLUA 5K0LA 1E2EA 1HGXA 2JARA 3OWOA 3KEGA 4E1BA 3KZXA 3RRYA 2B35A 3BTVA 3FTFA 5AW3A 5EERA 1N9GA 5LOVB 1NR1A 1EUYA 3AILA 3BRCA 3L7JA 2WD8A 3WBKA 3PNKA 1W0CA 5GGXA 4OHPA 5CG2A 2C2HA 2GKOA 3GGJA 1YRWA 4E2FA 2GBCA 4L4YA 4I9GA 2ZR7A 1DEHA 1P3DA 3PFIA 2C7VA 3JQRA 5G40A 1G6KA 5KOHB 5BQOA 2ZRNA 2NACA 4H16A 3GJTA 4X95A 1I01A 1X39A 1JN0A 4URHA 4TKVA 8ABPA 1KTIA 2FFJA 1EWQA 3O7WA 5C5IA 4XIFA 4YJ2A 2VPQA 5KKAA 1CQXA 1OLUB 2WIDA 4NK5A 2JJ1A 1ES9A 1BU8A 3H05A 3LKZA 4MUHA 2I8CA 1TTHA 1U7UA 2E4YA 2V7VA 2QRDB 2B78A 1T13A 2JD0A 2GO7A 3HRIA 3REFA 3OY7A 3WS7A 2XTMA 3EXEB 2AG0A 3LLUA 4PM4A 4ZJUA 3GUYA 5H4GA 2EQAA 4C9BA 3GJ5A 3WLJA 3K96A 3PEUA 1DMRA 1YT5A 1TZBA 1XDBA 3KJGA 1Q7Y1 4LVUA 2XA1A 1BS1A 3H2ZA 4XDHA 4DPLA 1RYDA 1SHZA 2XGMA 3CNNA 3O90A 4Q1AA 5GJCA 2GJSA 1EEHA 2EX4A 3IQDB 2OG1A 3C1OA 2F1IA 3FB1A 2VEOA 2WNIA 4M1MA 2PSSA 2ZE8A 1I4LD 3CSSA 2ZSJA 1L4GA 2FG7C 3QKWA 1Z0IA 4QAJA 2IP4A 2XXJA 2FLKA 4Z2AA 2FUG1 4MDEA 1C29B 3TLKA 3BL8A 4YI5A 2CFIA 1PV4A 1FFCA 4Q01A 5IVHA 3G2OA 5DSZA 4JGGA 5TMBA 1V26A 4CWAA 4H17A 4A6PA 1EGHA 1OBVA 4TROA 4JXXA 1PTJC 1HE3A 3L7IA 4F7DA 2BUCA 1UWVA 1VPTA 3PCTA 2ZDHA 1R4ZA 4ON9A 4ZWNA 4DAOA 3B6IA 3FZNA 2GU2A 4ABYA 3ZNNA 1ODCA 2F6RA 2HNBA 3KKKA 4ETMA 4MDYA 3RNLA 1XMQB 1H65A 2HJSA 3TQOA 3IH5A 2XVMA 1Q861 1T9KA 1PR2A 1TMYA 3EVEA 4HBZA 3TL2A 1YZ3A 1DS6A 1B3BA 4GI5A 4GBGA 4QTTB 3HL4A 3KZNA 1VGRA 1L7AA 1FMFA 1EXNA 5K3FA 5A2Qf 1THGA 3AI7A 4HB3A 4F1KA 4HGYA 1IVSA 1CS4C 1SKBA 3A4YA 4H7DA 3STHA 4AY2A 3G71Z 1K4MA 1RXUA 1H6BA 4XM2A 1C1DA 1E7QA 2E6KA 4R1NA 3RI3A 2HT1A 2JIZD 4LBZA 1NLMA 1W30A 1Q3HA 2DUJA 2GD2A 3EMBA 4KIFA 4TV9F 3MWKA 4O4HA 3QP9A 5E6UA 5L3RA 1M6YA 4Z4CA 4HXYA 3BGWA 4MB6A 4XIIA 1FYXA 2NU8A 4F72A 5I8ZA 4LC9A 2N0SA 5E1BA 2H8KA 3TAXA 1EWVA 5H5JA 4RHCA 3KCNA 3L7CA 5ES3A 4B3IA 1RBMA 2ZJFA 4UBJA 4D0GA 3KIHA 1O5IA 4PY2A 2O2YA 2O7SA 1YE5A 3JASB 1A5ZA 2CVPA 4NNJA 2F67A 2HDNB 3TMKA 5DHTA 4RHUA 1YKGA 1N7HA 5FV4A 1RJWA 5ECDA 721PA 1CEYA 1CRZA 3C87A 1K86A 1NQOA 1N92A 2JGDB 4MR9A 3DWFA 5K0EA 4UEQA 2VTEA 2XB8A 4UPEA 1FE8A 1Z62A 5DXJA 2NMVA 3ETLA 3DLAA 4BVHA 2UVDA 2JG3A 1HC7A 4MV6A 4TYYA 1VLMA 4UHFA 2JFOA 1SUAA 3A37A 2ZRJA 4CQMD 3T95A 2ZKIA 2E87A 2JI7A 1II8B 2VRWA 2WA1A 4AN4A 5HS4A 3A05A 3CZMA 2BM8A 5TQJA 1YIJZ 4FDLA 2N46A 4TWZA 1SHJA 4LZNA 2C7PA 1KO4A 5KNDA 4PZZA 5HZMA 1Y7LA 3OZRA 4NCJA 4NICA 3AKYA 4S2EA 3QEOA 4M9XA 2HM7A 3EN0A 3R6LA 1QPZA 3G89A 1ZL2A 2B69A 4RTNA 2BHTA 1H2WA 1JZQA 2P7HA 3HACA 5E1DA 2CBZA 1I32A 1DG9A 2J07A 4WV3A 4HNHA 4I46A 2NU6B 2NUAB 4A0RA 1M2NA 2VP0A 3ASUA 3A6ZA 5CA0A 4LBVA 2REQB 2QPAA 3AHJA 4AYWA 4EVIA 1O7JA 1QHXA 5CG1A 1BGVA 3SYKA 2LNDA 3UJ8A 5GWXA 3DMHA 2X1MA 3PQCA 2O50A 1YIDA 2CK3A 4QTYA 3K9QO 3DZGA 1N5IA 3GGDA 2AQIA 1UPUA 1FMJA 2LW7A 3AI3A 1RE1A 3CNEA 3R3ZA 3USES 2V65A 3M4OI 5K0CA 1UZUA 4IINA 1O8BA 2I7CA 3WY9A 2EKLA 3V33A 4R3UC 5JXJA 2QRVA 4B0PA 1QQAA 2PMKA 1A8QA 5B2ZA 5BWMA 1Z06A 2UZIR 3V7FA 1TZ2A 4BO7A 5DNVA 1XTIA 4Q82A 3D8HA 1B26A 1AE1A 3W1EA 4LMAA 3RHZA 4CEIB 3TIXB 4K0KB 2W22A 3ZVLA 4EFLA 4ILEA 5FFNA 3ZWAA 2I99A 3V55A 1BQ3A 3BIXA 3NDIA 1RS0A 4EYGA 5MFPA 1D2NA 2PIAA 4Q1DA 5IM4F 2QA4Z 4FGKA 3ZIDA 4H6PA 5CFMA 1TKAA 3V8EA 4DAEA 1OI3A 4K26A 1TECE 1U9JA 4OB8A 1VI2A 1HNXB 3K9BA 3R7DA 4OYLA 3F5DA 4KWIA 2OZEA 4JWKA 5AM0A 3I05A 4WZ6A 1NF9A 4Z0HO 1K7SN 3KYBA 4LRUA 1WHSB 2QG6A 3BG1B 4QWWA 4A93I 3IUYA 3S1AA 1YHZA 2YY5A 1P1RA 3D3JA 3UVEA 3TNLA 2C2ZA 1RHQA 3KL4A 1G7RA 1EGAA 4KN6A 3I45A 4PC1A 5FP0A 3ZHZA 3X0DA 5JYEA 4GR4A 2RFLA 3TM4A 4EGAA 2YWEA 5ALUA 1OF1A 5E3IA 3TOSA 2FPWA 3GMSA 3VC2A 3VQTA 3HJUA 2VA8A 4WBNF 1JH9A 3VR4A 5TVKA 3SK0A 2DU8A 2IYWA 4LQDA 3HGQA 1G9SA 1QCCA 3IQZA 4G0PA 3SJZA 4JUDX 2EDAA 4QQ8A 2Q4ZA 2R6MA 3FDZB 4GIBA 1A71A 1L6IA 4F3CA 5GVRA 2P75A 2WF6A 2X0NA 3QLJA 5CIYA 5I4BA 2I67A 4D4GA 3FOBA 3Q9SA 2OQ2A 4KWCA 4UBKA 4BZXA 1YH3A 4MPPA 5DB4A 2GYWA 1AHHA 3ZCRA 5CCEA 2IBTA 4ZGBA 1Y89A 3BBLA 2ZVQX 4REMA 3D8UA 1EWYA 2BFOA 4KJXA 4OB6A 2YWRA 3GXOA 1BSVA 3CX3A 1JXMA 1L8OA 3EQ8A 1OOEA 1SBHA 2WW8A 1ZJ4A 1SUFA 5EHIA 3FOFC 3U6KA 3B1VA 2NPIA 3G6KA 3C7TA 3PC7A 4AT1A 1TPZA 2XQJA 3AESB 2D1RA 2Z3WA 3FGNA 3FJ1A 1HXHA 4ZAGA 1KMNA 1VP9A 1A98A 1FPMA 1UODA 4TOIA 1U1CA 3UENA 3QY0A 2AJDA 4HLUC 5CJPA 1MVNA 1DKLA 2YNMA 4B7XA 4UBNA 5CH5A 5FI0B 4MEBA 4NPCA 1J6UA 5IDVA 5CBKA 3BTOA 2PJUA 4MA5A 2H4JA 3CCBA 5D5QA 1FMLA 2KW5A 3LYHA 3QXHA 4I4IA 3QELB 5CLQA 3UMSA 3UJHA 4CW7A 2NVXI 1ZS9A 4OAQA 5JD5A 3BWCA 1Q0RA 4NQZA 5P21A 4R31A 4RLSA 3CCS1 3P5BA 4O8ZA 3N2GA 4PSKA 3L4SO 4GECA 2W83A 1VFNA 2ZIVB 3PUHA 3KYDA 4EP1A 1DKNA 5ALYA 3ROTA 4IHAA 1BVHA 1IN5A 2QMHA 3NTUA 3F6RA 4AUNA 4P84A 1QO0A 4IJMA 3GI1A 1P2BA 3VM6A 4GSYA 1Z2NX 1OI2A 1G8JA 2ZUBA 3Q8WA 4WERA 3EXIB 4UD2A 5G53C 3SBEA 1YCHA 4OF4A 3SBXA 3CH4B 4YCMA 1RLMA 2FN4A 4DPMA 1T8SA 2X2EA 1T10A 4HDAA 2BR3A 3BXXA 1JVBA 4GVPA 1OR8A 5HFJA 3SJBA 1CBUA 2CDCA 4J75A 1PN3A 1OLSB 1E2DA 3BZWA 5EE3A 5EHZA 2UUOA 4MQEB 1TYBE 3ETHA 1YQEA 5CRIA 2QRCB 3X1KA 3ROEA 5CFQA 1V16B 1V96A 2RH8A 5IDWA 3QVVA 3TDHB 1AUVA 1U2GA 2VJNA 1K66A 3IXQA 4LE1A 2JLSA 1NXWA 3L6RA 3QUAA 5IT5A 4JC5A 1I4WA 3T41A 1E1RD 1XA0A 3P9QA 2DVMA 2GZRA 2OC4A 2ZPUA 1TK2A <