1WZNA

Crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
244
Chain Sequence
b'MYELYTLLAEYYDTIYRRRIERVKAEIDFVEEIFKEDAKREVRRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNLKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSKVAEALKPGGVFITDFPCGPVVWNEQKGEEKLVIMDWREVEPAVQKLRFKRLVQILRPNGEVKAFLVDDELNIYTPREVRLLAEKYFEKVKIYGNLKRELSPNDMRYWIVGIAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Crystal Structure of the SAM-dependent methyltransferase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 87
structure length 244
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1wznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1wznA01
4Y30A 3OPNA 3HVJA 4RX1A 2OXTA 2OY0A 1VL5A 4QDJA 5GM1A 5DX8A 4HSGA 3EVEA 3M33A 2IDJA 4AZSA 4RTOA 3O7WA 5EZSA 4GOOD 2HR1A 4HG2A 2NXCA 2NXEA 1UFKA 2P1DA 3CKKA 4HRAA 1RI1A 2QE6A 4RWZA 5CM2Z 1VIDA 5FQOA 3UJ8A 3V97A 5MHTA 3P71T 1PJZA 4V0RA 4RVDA 3SX0A 3V8VA 4GOLD 2UYQA 4OA5A 3EVGA 3K6RA 2G71A 3KQYA 1P1BA 1WS6A 5EMLA 4E30A 4FS8A 2IFTA 2AN3A 1M0EA 2P3OA 4XCXA 1H1DA 1SQGA 3ANXA 3FRHA 1IY9A 3FPEA 3OZTA 4M38A 3HVKA 5JR3A 4DZRA 1WZNA 4GOMD 4ER7A 5FADA 1NBHA 5BXYA 4Z2YA 3NMUF 5DT2A 2PT6A 1YZHA 1KP9A 5GINE 4U7TB 2VP3A 4OX9Y 2HTEA 3M6VA 2O05A 2ZZKA 3GDHA 2UYOA 2ZCJA 2VDVE 3OU7A 1NV8A 4AZWA 2JHAA 2EG5A 5FA8A 5T67A 5ICCA 1SG9A 3PLAE 3O4FA 4X61A 2G8NA 3KPWA 5EQJB 4R6XA 1FP2A 2EX4A 4WXHA 3TLJA 3H2BA 2G72A 3LCUA 1UWVA 3NW9A 3G89A 3DH0A 3S68A 1NW6A 2OKCA 2O06A 4FR0A 4P58A 2BR5A 4QQKA 3T7SA 1JQEA 1NKVA 1O54A 3HCDA 3M4XA 3LHDA 2PXCA 3FUWA 4FT4A 5K05A 3F4KA 1IXKA 5LQKA 3DXZA 2I7CA 3HVIA 5FQNA 5FUBA 2P41A 3TPZA 5K0GA 1R18A 1KPGA 2OO3A 1KPHA 3LDUA 4KIGA 1I4WA 4BLUA 2AOWA 2VS1A 1QANA 3HA7A 5EIWA 2PVCA 3C0KA 5GIPE 1FJXA 3TMAA 3EGVA 4HTFB 4CTKA 2NP7A 4RTKA 5C0OE 3EGIA 4ER6A 2PX5A 3E7PA 2IP2A 3DLCA 1G55A 2AN5A 2UZ4A 3C3PA 3G2MA 2CMHA 3B7PA 5K0BA 3GRUA 3PB3A 1ORIA 3SMQA 2IH5A 5KVAA 1R6AA 5CVJA 5FTWA 2WA2A 5CVVA 3GRYA 1YFLA 2C7PA 4R05A 1FBNA 3TM5A 1MJFA 3DTNA 3TRKA 3FPJA 5M5BA 4K6MA 4OA8A 5FULA 4U7PB 5EMMA 3MTIA 2HMYB 3QOXA 1RJFA 3UZUA 5H02A 1WXWA 3BT7A 2YXDA 4KDCA 1G60A 1WXXA 1KHHA 1QYRA 4DF3A 4P7KA 1EIZA 3KQTA 4CTJA 5K0FA 2PX2A 4PINA 3AJDA 5E2BA 3SSMA 4RTJA 2KW5A 4E31A 3GCZA 5E9JA 2AOVA 4M7RA 3VYWA 4CKBA 4M36A 1U2ZA 5EVJA 5EOVA 1JQDA 5K0LA 1D2CA 1VQ1A 4RSRA 3NDJA 5DXJA 5DTMA 2AR0A 2QRVB 5HILA 4HGYA 3A7DA 5P8WA 5CCXA 4B17A 3EGEA 4PYLA 2AOTB 3JWGA 4PYMA 3ELYA 4RVHA 1L3BA 3P9IA 5EG5A 5HEKA 3BWMA 1JSZA 3I9FA 3BWCA 5K0EA 4R6WA 5HIMA 3LPMA 3SVZA 2FHPA 2B78A 2UYHA 4GF5A 4GBED 1XDSA 5KQSA 2C7QA 3K0BA 3BGIA 2PXXA 1BOOA 3KR9A 5DWQA 3SM3A 3PT9A 5LQNA 4OQDA 5DM4A 5ICGA 3QOWA 1R8XA 1DL5A 5K09A 2JG3A 4YV2A 3ORHA 2EJTA 5HFJA 4PYIA 3RODA 2IDKA 1QAMA 3OZSA 4RTPA 1ZQ9A 4FZVA 5EKXA 3C3YA 10MHA 2ZSUA 3UWPA 2CL5A 1PRYA 1TW3A 3DMFA 3LL7A 4AZVA 2HV9A 2ZLBA 3HP7A 3GRVA 3QV2A 3UJCA 3P8ZA 1QAQA 5E8JA 3NJRA 4HGZA 3HCFA 3KPYA 3TKYA 2WA1A 3HCCA 5HOQA 3PFGA 3BGDA 4FSDA 4CKCA 3ER9A 5KYGA 2IIPA 2ONZA 1L3IA 3DLIA 1KR5A 3ID6C 1JG4A 3Q87B 1VBFA 3HA5A 3ER8A 2H1RA 3BXOA 3NWBA 3SR4A 1AQJA 1NW3A 4JXJA 3HNRA 3R24A 4MIKA 1RJGA 4FGZA 5E2AA 4UOEA 2PX8A 2NP6A 2ZBPA 4PGHA 1ZKDA 3JWIA 4PIMA 3SXJA 4PNEA 1XVAA 2CMGA 1L1EA 7MHTA 4MWZA 4E32A 4C04A 1F3LA 2EFJA 4OBWA 3EEOA 4ER0A 5EPEA 3RIEA 3NTVA 4KIFA 1R8YA 1TW2A 3KR0A 2R6ZA 3I64A 5G02A 4FP9A 2F8LA 3GWZA 3MTEA 4PWYA 3GJYA 4P7JA 5K03A 3HCAA 2JHPA 3KR1A 2PKWA 3THRA 3PFHA 3SGLA 3ME5A 1INLA 3FTEA 5LSAA 3Q7EA 2AOUB 5EKUA 5GIOE 4WVLA 3U81A 1SUSA 2OB2A 3TR6A 4DCGA 2YR0A 1BHJA 2PGXA 4O29A 2I6GA 2B25A 3KPUA 4BP3A 2ORED 3OZRA 4QQNA 2YVLA 3LDGA 1QZZA 4RTQA 3C6KA 3LCVB 4QTTB 4R8SA 4E2WA 5EGSA 5FWAA 3BKWA 5LQJA 3FZGA 5E8RA 1VE3A 4H0NA 5FHRA 2P40A 1O9HA 1KYWA 1RI5A 2Q41A 5K0JA 3FUUA 2FCAA 2PBFA 3G2OA 3GIWA 5F2OA 3EVCA 2JHCA 3OFKA 4E33A 2ZWAA 1Q0SA 3GNLA 1ZGAA 2ERCA 1WG8A 3P9CA 1AF7A 3TM4A 3LECA 3BGVA 4GC9A 1DCTA 4QVGA 5GP1A 3JWJA 3IHTA 3FTFA 4OQEA 2NXJA 2BM9A 3FTCA 2BM8A 1G38A 3NDIA 2B2CA 5E9QA 2PJDA 3LSTA 3FPFA 5FCDA 5LQAA 3UJDA 2G1PA 1P91A 1EQAA 2IBTA 3M6XA 5CVDA 2C7RA 4PGGA 2PLWA 2YX1A 2ZFUA 1V39A 3P2KA 2DULA 2YQZA 3DULA 5E1BA 3UJ7A 3GXOA 3HCEA 2BZGA 3G5LA 3PS9A 2OZVA 4RYLA 5KS2A 4FSXA 1O9GA 3E23A 5GOZA 4C07A 4GUAA 2I62A 4ZTBA 1I9GA 2ZULA 4C08A 4DQ0A 3OE5A 2ZZNA 2HWKA 4ER5A 2NYUA 1UIRA 1L3CA 1R00A 3P9KA 2IBSA 3HCBA 3CBGA 1G8SA 5E1DA 4BY9E 4OBXA 3B89A 2BR3A 3UFBA 1X1CA 2JH8A 5CUQA 2H11A 3ELWA 2P3QA 2PV0A 2FK7A 4M37A 1SQFA 1NBIA 3KU1A 4MQ4A 1L9KA 4FT2A 4AX8A 5E1OA 3KR2A 4Y2HA 1KXZA 2QYOA 1RJDA 2ZBRA 4E2XA 1VPTA 1X1BA 2PY6A 3E05A 4P7FA 3UJBA 2ADMA 3EVAA 2V7EA 3D2LA 4XUCA 5KQRA 1JSXA 3GGDA 3P2EA 3CGGA 3EVDA 4QVKA 3P2IA 4QTUB 1HNNA 1NW8A 3PTAA 3KPVA 5DM2A 5CD1A 1P39A 3DMHA 4BLWA 3OE4A 3B5IA 3G8AA 3FYDA 4HTFA 5DTRA 3UBTA 3L8DA 3LBFA 1M6EX 2ZIGA 3FPGA 2VDUE 2XVAA 3T0IA 4X60A 5LQRA 5ICFA 3OU2A 4KDRA 5DSXA 1JR4A 4QPPA 4G56A 4LG1A 1ZHFA 5DTQA 1N2XA 1B42A 1ZGJA 3MCZA 5F2NA 1KIAA 4RTRA 1XCLA 3R3HA 3TKAA 3X0DA 5EIFA 4PYKA 1X1AA 5T64A 3OFJA 4IV0A 3NVKI 5DM1A 1KYZA 1JTEA 3BKXA 3KQWA 2ONYA 3B3JA 3HEMA 5U4XA 4RVGA 5FHQA 5HIJA 3GO4A 3R9XB 2ZVJA 4V0QA 5K0CA 2WK1A 4GEKA 4X41A 3NWEA 3G2PA 3DOUA 3PX2A 3LKZA 3T7TA 3VC2A 5K8VA 2AOXA 1YB2A 3DP7A 2I9KA 1NT2A 3GU3A 5DX1A 1R74A 4DCMA 2ESRA 3OU6A 3DXXA 4YUWA 5CIYA 2QRVA 3SSOA 4IV8A 5K0NA 4YV0A 5BW4A 3ERCA 1NW5A 2AOTA 2P8JA 4P7GA 3KHKA 3DUWA 3P9NA 4LWOA 1EJ6A 4X1OA 1WY7A 1I1NA 4C4AA 2AN4A 1M6YA 5GM2A 2FK8A 2XVMA 4C06A 4RV9A 2NNWB 5EHIA 5DX0A 1RI3A 2XYQA 1XDZA 1VP9A 4YUXA 2UYCA 2JH9A 1Y8CA 4YUVA 4RTLA 1RJEA 2YTZA 4IKPA 5EC8A 1QAOA 1VP3A 2GB4A 1IM8A 4KRGA 4XUDA 5DXAA 4PCLA 4DM3A 2AZTA 4AUKA 3AWIA 1OR8A 4RTMA 1YZ3A 3VSEA 3KKZA 5K01A 1AV6A 5FWDA 5ICEA 1XTPA 4GC5A 3HM2A 1F38A 3E8SA 2Y1WA 3ELUA 3MAGA 3OCJA 4PYNA 2QY6A 2HNKA 3IYLW 2NXNA 2ZWVA 2ZTHA 3KQMA 2OB1A 3T7RA 1XXLA 1AQIA 4PIPA 5B1SA 3LGAA 1KPIA 5HIIA 3VC1A 1YF3A 9MHTA 3LCCA 4HH4A 1Z3CA 3G2QA 3SSNA 4GOND 3FUVA 4CWAA 2LD4A 3M6UA 3A26A 4E2ZA 5IH3A 5EMJA 3MCTA 3EMDA 2EJUA 2VZ9A 5LQUA 1N7JA 4KVZA 2FRXA 2A14A 3R0QA 1EG2A 3UA4A 3FTDA 3EVBA 3G8BA 3CCFA 2ZZMA 3WSTA 4QDKA 4MTLA 5T6BA 4F86A 1XJ5A 1SUIA 3HTXA 5LR6A 4BLVA 2AVNA 2CKDA 2FPOA 1TPYA 5JUWA 4A6DA 5EEGA 2YXEA 5HZMA 4PYOA 2PT9A 5GWXA 3MHTA 4MHTA 3KQSA 3AXSA 4CKEA 2P7IA 4RTNA 2CWWA 3HA3A 5F2KA 4RVFA 2GA9A 2XYRA 3TQSA 1BKYA 3TFWA 4YUYA 3G7UA 3RW9A 4RTSA 3FUTA 5ERGB 2AOUA 2QM3A 3CJQA 3UJ6A 2AS0A 1RI4A 1YUBA 4KWCA 1FPQA 3DMGA 4ER3A 4POOA 3THSA 2OBFA 4EVIA 2GAFA 5EHGA 1X19A 2O57A 4YV1A 1NW7A 2Y1XA 8MHTA 3A7EA 2PWPA 4PYQA 3DR5A 2XBMA 3KQQA 4NECA 3PX3A 2B3TA 3I5UA 3A25A 1NV9A 2GS9A 3C6MA 1VLMA 2B9EA 2K4MA 3LKDA 3A4TA 3B3GA 3CC8A 4YUZA 1JQ3A 4PCAA 1G6Q1 3M70A 2IH2A 5IKMA 1HMYA 3NVMB 2IH4A 3BUSA 2FYTA 1D2GA 1T43A 4EK9A 1ZG3A 2O07A 3HVHA 1YFJA 4R8RA 3EVFA 2YXLA 1EJ0A 2ZW9A 4ATNA 4C03A 4BP1A 3MB5A 2ZIEA 3I58A 5CVEA 5DM0A 5CVUA 5HIKA 1XCJA 3REOA 2ZBQA 5BW5A 2BH2A 3KQVA 2YUIA 5EEHA 3DXYA 4HC4A 2VDWA 2AVDA 3EMBA 2BR4A 3KQPA 5DSTA 5EMKA 1BC5A 5C9ZA 2PSSA 3EVZA 4F84A 1N7IA 1RI2A 2GPYA 2G70A 4ISCA 4C05A 4QPNA 5DLYA 3EEYA 4YMHA 3ELDA 1JG1A 4X63A 2PX4A 3B3FA 4LWPA 1G8AA 2C7OA 2PWYA 3M6WA 3FYCA 2OYRA 1Q0TA 5FA5A 1XDUA 2O0LA 1DUSA 4E70A 5LQCA 4KW7A 2XYVA 4LECA 3A27A 1ORHA 3CVOA 3FPHA 1JTFA 4EQZA 1P1CA 1D2HA 3EPPA 2P3LA 5D1NA 2JJQA 3UJAA 3BWBA 1SVUA 3G5TA 3MQ2A 4DKJA 2P35A 3LBYA 2PXAA 4GQBA 3FUXA 3G88A 4L7VA 4F85A 2Z6AA 4DA4A 3IV6A 1JG2A 3GRZA 4CXMA 1MHTA 3KQOA 3CJRA 3I53A 4EKGA 4XUEA 5DPMA 2N47A 3FRIA 3IEIA 2H00A 3MGGA 2V74B 3AY0A 2IGTA 3AXTA 1SKMA 3R6TA 4PONA 5EZQA 3TOSA 4PYJA 2Z6QA 5DRYA 2GLUA 4EKIA 3KPJA 3BWYA 5CCBA 3O31A 2ZIFA 3PVCA 5E9WA 1X1DA 5DRTA 4A6EA 4EMSA 4AZTA 1JG3A 3MERA 2Z6UA 3CJTA 3JWHA 5C1IA 2DPMA 3UA3A 5BP7A 2GH1A 4E2YA 3LX6A 3UJ9A 3P97A 4DMGA 2IPXA 1EAMA 4YMGA 2OPBA 2P7HA 5D1HA 1FP1D 3BZBA 4IWNA 3LDFA 5E1MA 2E5WA 1NE2A 3GRRA 2R3SA
chains in the Genus database with same CATH superfamily
4EO9A 1JPJA 1RQ7A 3R1IA 3OWOA 2M1XA 2C7VA 3TPFA 5ITWA 5A3JA 4RKRA 4IHJB 4G25A 1Q92A 5G3ZA 1IZZA 4JI1B 2POQX 5IX8A 3X1DA 1RACA 5IASA 2Q9UA 4Z4CA 3FDJA 3NHPA 4D46A 1KZYC 2NZJA 1JR3D 2WHXA 1FU8A 1HZZC 2DCMA 3AEZA 4UHJA 4AJPA 2OV6A 1QBGA 4QJ3A 1U65A 1HEYA 4CMIB 1WB4A 1OPXA 3EVGA 5J4YA 1Q7BA 4IXDA 2QMZA 1IQPA 3GLHE 4BFYA 4XLTA 1E1LA 4NE9A 2B0JA 1NJGA 1KFBB 5IT9A 1J9ZA 2Q4RA 3ANXA 1WBDA 2X9NA 3A3PA 4EZBA 3NT5A 5JNUA 2C5AA 1G5RA 2OMKA 1EVZA 3I37X 1Y7HA 5BSGA 1JEQA 4UVIA 4TZ6A 3NCTA 4I2VA 4X6XA 4CMAA 4YT2A 5HQJA 2VDVE 5AJUA 4DTCA 1QZXA 4CKXA 4FFLA 5A1JA 2C1EA 1JXQA 1PFYA 3QFCA 1A9OA 3I1YA 5EQJB 4QAQA 2SKDA 1GN8A 3EGDA 4ZO8A 1VQL1 2NUBA 1NIPA 3QBTA 2RFLA 3D6NB 4BU1A 1E3TA 3CCSZ 1BH6A 1IY2A 1G41A 1YR6A 4GVLA 1QGZA 2GFIA 4LY9A 4MRSA 2F1OA 3EG9A 1XDWA 4QL3A 5JO9A 1BQEA 3TFQA 1RCUA 1WMAA 2VAWA 4BECA 1GPKA 2FVYA 1FFWA 2GDZA 8ATCA 1WMSA 2VHVA 3AB3A 1OH7A 1U2GA 3VR6D 5LQKA 4MW1A 4GVPA 1JJIA 3IOYA 1NJ1A 1XZAA 2JGDB 1QWSA 4E0BA 3BMNA 2OZKA 3W5JA 1WXDA 3KOWA 1K7YA 4AQ7A 3ZDXB 1C50A 3ZWKA 2C20A 3SCZA 2HU8A 2X2EA 1MT0A 1YMVA 2UUAB 3ZR4B 4CG2A 1QR2A 1B3RA 4ZOLA 3SQLA 4N41A 3GJSA 4C2TA 3PVZA 4EG1A 4HB0A 3E5MA 1PQ4A 1ST3A 3R9WA 1O95C 2ZSAA 1PYDA 3MOSA 1AGRA 3JALB 4HRVA 3FQMA 2Z3VA 1ZBDA 1R6AA 4FFDA 4R68A 1RNIA 1S7CA 5CVJA 5K6RA 3I2JA 3PUIA 4O5AA 5FH9A 4X3CA 3RFVA 3KQLA 3DMYA 3DEAA 1YFKA 2P4HX 4OHMA 1C8LA 2DY1A 4REQB 2IYQA 1PU2A 1YR3A 3FNHA 2H65A 4Y0VA 5AKGA 3D7NA 3QKWA 1WV1A 2YXDA 2JBAB 3DM5A 5CA1F 3U3XA 2C61A 4NTZA 2AXNA 5G1PA 4WHMA 2PX2A 2Z5VA 3RC9A 4MJ7A 3K9FC 3AUJB 3ZD6A 4LNUB 4RULA 1NXWA 2G8LA 5H4GA 4RXTA 4B7UA 4PZDA 1GRQA 1VQ1A 2GBLA 1HO3A 4NYIQ 2V3VA 2AW3A 4BNYA 1DSSG 1IXRC 5LFAA 1AS0A 4XA8A 4FCTA 1Y8RB 2W6JD 4QDTA 4NYMR 4ARZB 2YH2A 1XA3A 1JHQA 2J7PD 2Y67A 4D4JA 4KITB 1KE2A 1SXJC 3Q6IA 1ZH0A 1TTPB 1D6JA 3AU9A 1RLOA 3M1IA 1YJQA 2DUMA 4R6WA 3RUDA 1N2CB 3LPMA 2YWJA 4HV4A 1S2MA 1WIIA 4HAIA 1K8RA 2JD2A 3JQAD 4URYR 4R5HA 3TLEA 4XX0B 3UT5A 4P92A 1K0UA 2F4OA 4XCVA 3VZBA 3LMKA 1JW9B 1AKTA 1X80B 2X13A 5E6SB 3SFTA 3LBAA 1Q50A 1SOVA 3SHWA 1FIUA 5DM4A 3IBFA 2PSFA 1KY5A 3ORHA 3QXJA 3B36A 5J2TA 1QAMA 2XDQA 1EGVB 1S3FA 1ZD2P 3UC5A 5A4FS 1UAGA 4YCLA 5E95A 2YZ2A 4LTMA 3K70C 1CRPA 4NLLA 4NVRA 4ALNA 3CNBA 1QXFA 4HLDA 2H5IA 4V0OA 5JMTA 1FLVA 5TT0A 1KFCB 1PJBA 2PH1A 4HGZA 3JVVA 3NTXA 1Q821 3OE1A 3W6ZA 5I51A 1KH2A 1Z16A 1T0UA 5B1EA 2JUBA 3DTVA 1X39A 4Q4HA 4URXR 5I7AA 3U26A 3UKDA 1ISJA 4RFSA 5FF9A 3S40A 2VHEA 1H66A 4L57A 5AUNB 2WVHA 4MWOA 2QS9A 3I32A 4RJTA 5DWVA 3ZHBA 3RS3A 2PXHA 3ET4A 1XZEA 3L1JA 1XMJA 1LBEA 4RE6A 3ICCA 2FXVA 1Y5RA 2YVAA 1CEQA 5T57A 2XMPA 2P5UA 2Q1UA 4IIEA 4TTQA 3SDZA 2R8RA 1MRNA 5JCPA 4MV6A 3CUVA 1ULBA 3RIYA 4UASA 3NTVA 4YAEA 1E0DA 3UF0A 4D5GA 2VHXA 2JIZA 2JLAA 1Y6FA 1MJNA 4IKOA 2E4AA 2JIBA 4GZMA 3WVNA 2PUCA 1Q20A 4YJ2F 2ZR0A 4GOKA 4P7JA 3GARA 1RP1A 1DC5A 1JJVA 1ONPA 3FGZA 4COOA 4JI0B 1IZYA 1P0IA 3GUZA 4DMFA 4AJ2A 2ONCA 3QTLA 2NZWA 3QJGA 1YA4A 2W6MA 3G68A 3STXA 3KZXA 3V4PB 3ADCA 2CB0A 4WOPA 2PS9A 4LI0A 4WLOA 5HJEA 5DM70 1VIAA 5IAEA 5HZHA 2GTHA 1SZJG 2R7NA 3EHDA 3BX1A 2IYAA 3KCQA 3KNZA 4O29A 5CPFA 2ORED 2QXYA 2GK6A 3QUBA 1T5DX 2ZP1A 2QN8A 3Q8WA 5AOCA 5TXGA 1TM3E 4X54A 2I7XA 1V2GA 1XZPA 4N7MA 3EGOA 4CI0B 5AK6A 1P4HA 3AJEA 3OCYA 5FHRA 1P9LA 1ZW1A 3EQ7A 1G5FA 4G2NA 4MGHA 1I36A 3TW6A 1FEZA 3T38A 2WEKA 4OU5A 3UCEA 1OHHD 3GEHA 3STYA 3FTFA 2VSQA 1D0SA 3L46A 4J4BA 3OD5A 2GPNA 3FCOA 1EUZA 5LU9A 1E3JA 5AK3A 2BTQA 1VHJA 1IONA 1YI8A 1BXRB 3E61A 3EGWA 1EBUA 3G7NA 3OIYA 5D6NA 5FCDA 4ZDJA 1NBME 1EWKA 5LXTB 2IUEA 4XVRA 1ZI9A 1YITZ 3I04M 1U3WA 4RH0A 4JB3A 2J3KA 4A27A 1NFFA 4C5CA 3IRUA 1QOQB 2EYUA 3OOEA 3PUKA 4XM0A 4NG5A 4KXVA 3ZZUA 2DEUA 4LDJA 3KKOA 3WLLA 5FPKA 1NXSA 2ZYVX 3IHWA 2C4NA 4QTYA 5G40A 1ZUWA 1ZU5A 1LDYA 1K732 1RVDA 1YDWA 4R8KA 5HRUA 4KR0A 2NYUA 2WF9A 4US0R 3UWDA 1MC5A 2VK2A 1OZ0A 3LPDA 3N7UA 3O74A 5JTTA 4AJLA 2FWMX 2AF4C 4MEJA 3OZXA 5KTYA 2I8CA 4YEDA 3QWIA 4FNMA 2QRCB 2ZU6A 3GRKA 4E2FA 1KXZA 2R66A 2NV6A 3WK7A 2I87A 4E2XA 4MPPA 4REMA 1VSVA 2V8IA 3VSDA 3BHNA 3E7WA 2EFGA 2XW6A 3NHFA 3Q88A 4QDXA 3BTOA 3WK4A 3O75A 2QENA 2V9CA 4R69A 2X15A 2FB9A 3NT2A 3URMA 3WZ2A 3DC7A 2BKVA 1E7YA 4ZA2A 3P2EA 3EVDA 4QVKA 1HV8A 2J3QA 1XMOB 3MQFA 2PZLA 4F92B 5IKEA 1T9DA 1F4VA 3ZX4A 2WFLB 1OFIA 4N12A 2WYHA 4QFDA 3DPIA 1LBHA 4A93I 1Y8AA 2MYPA 1W5AA 2IY9A 2OXRA 3F5MA 4HTFA 4Q3AA 4YMUA 1R27A 3KJEA 3L8DA 2H8GA 2INGX 3OMLA 5AIBA 2WRZA 1DEAA 3OPYA 2EZ8A 4C4ZA 4G8DA 2ORYA 1NVGA 4R40A 4GBMA 4EI8A 1BRMA 1KGDA 3QF4B 3HBMA 1I30A 3KJZA 4BBPA 1DC8A 3CEPB 3IURA 3CPWY 3QWUA 4WZZA 1N2XA 1TMYA 1OASA 3OOJA 3MCZA 1OPRA 4YMIA 4PPQA 1RYFA 3D8HA 5ALYA 1Y33E 1XKLA 3OLXA 1H1LA 1Z39A 2GCOA 4NX2A 4TTPA 4CLOA 3KK0A 1RQ2A 3H0CA 4JSRA 4K1XA 2RIRA 1OLUA 3D3QA 4O2BA 4TSFA 1NNI1 2I80A 3BSFA 3I1JA 5CPBA 1W6RA 5K0CA 5LKAA 1T3GA 4QM6A 3EA5A 5A0TA 4WASA 3HJNA 5JDIA 4JQSA 1IMOA 5C1OA 1QU2A 3BICA 2YV4A 1YB2A 3NC0C 4N3CA 3ZG6A 3DBRA 3GBPA 2XNHA 1GPYA 3DPSA 3TSYA 4BTEA 4F71A 2B21A 3RJZA 2AFIB 1QLWA 4MDEA 4PHTA 4W7SA 2H52A 1P62B 3LDAA 4JJFA 3PNYA 4H2DA 4Z4FA 5K3SA 4ZDIA 4O0LA 2FWPA 3E22B 3L8EA 1CSEE 1ZWKA 1C8KA 2AWNA 2QTWB 3DUWA 3VZPA 2G1AA 1W7AA 1M6YA 3SQOA 3WGNA 3VC3A 1EIWA 2OTJ1 2QX7A 3SJCA 5FO0A 5EHIA 2RK6A 3HHEA 1RI3A 3OX2A 1M8FA 4PRZA 5CXSA 3UAWA 2FWIA 3UPUA 2WWWA 2HYDA 4YUVA 4RTLA 4P31A 4TM7A 1Z12A 4F7WA 2FPGB 4DM3A 4KVAA 4FGUA 3B1XA 4AUKA 1KQOA 3AWIA 4R31A 3VGPA 1L5KA 1KRXA 1KU6A 1GPH1 1YC5A 1CF2O 4XDYA 1BVUA 4RIHA 3WFIA 1RQLA 3D3EA 2M48A 3ZHTA 1H6CA 4JLVA 4ZAVA 1PQYA 3T3IA 4EGSA 5FWYB 5IKXA 3F7TA 4MPTA 2IYEA 2GPAA 3A1SA 3DUFA 4NOLA 5F5LA 4AY5A 2I1QA 1Z17A 4A26A 2ZWVA 4ARBA 1GM5A 1VIMA 3WLQA 1GRCA 1Y9EA 2CYAA 3AFIA 2HRRA 1H3NA 1UBHS 2BZ0A 3DL7A 4F45A 1Z3CA 3BJZA 1DL6A 1ZI8A 3FFBA 1W96A 1T4MA 3GUYA 4L6CA 2ZT8A 1WVIA 4O2AB 2XR1A 4MWDA 3SKYA 3ILYA 2FR1A 3A3NA 2A9PA 4BKQA 3AI3A 4CDMA 2BM0A 1FMCA 3WP1B 4UU8A 4C3VA 1VBKA 3UGJA 4F12A 3DTVD 4O4HB 1R0KA 3EUFA 2R6DA 4KLRA 4F5EA 4GE3A 4MTLA 3M5WA 5T6BA 1XJ5A 2RK3A 3INTA 2OYSA 4ENTA 3DMNA 3IQZA 1DKUA 5GVSA 3UB3A 2FPOA 2PD3A 4TX1A 2JCXA 1SXIA 2YCLA 4RGQA 4XYGA 4ZTUB 1SVKA 1ZHOA 1SIUA 3E9YA 4PX9A 2IRWA 3EIWA 1ODJA 2C29D 4MEAA 4KFTA 3SQDA 1JAZA 4CKEA 3OZGA 2CWWA 1NUQA 3H97A 3D7RA 5F98A 1X42A 1IY0A 1HKHA 1UBSB 3TSAA 3ZHCA 2JIZD 4RTSA 4KH1A 4PLGA 4L95C 3NXSA 1T5OA 4XIGS 2REQB 3KXPA 4H7IA 2DTEA 3L6DA 1I2BA 1PR5A 1RFGE 3F5DA 1HM5A 4OJNA 4OQXA 3QX7A 3W3AH 4L8WB 2XCTB 2XZPA 2GHRA 3V7FA 3I5UA 4XPIA 3JR3A 5TQ0B 3P9YA 4CMEA 4ZK2A 1Y48E 4RPGA 1WVGA 2ZRAA 1FNNA 4MINA 1X1QA 2CL6X 1DJOA 1RZVA 4MS3A 4RYDA 2OECA 4M1KA 1RRFA 2UZ1B 4Z51A 5B37A 4KRYA 3N58A 4L0MA 4EHKA 4TSKA 3KHTA 3ZWWA 4GL2A 2JHFA 2X0JA 3E9QA 3DFUA 2AR7A 2E48A 1CBUA 3B1FA 5HG0A 1RBZA 4EK9A 1JLSA 1G21E 4LZOA 3RUEA 4CQLB 4UULA 4YIKA 3FCSB 5LNK1 4N0EA 2FWNA 2VJOA 2XXAB 4YRMA 3REOA 2YC4C 5BW5A 1Z33A 1TU3A 3PCRB 4MYSA 1EWQA 5EEHA 5TS3A 3CXUA 2FKNA 2G88A 2LWIA 4GQAA 4D8YA 1BN6A 4F5DA 2ZAOA 4F84A 3CO0S 3WBJA 4CKCB 1ATIA 2DCUA 4L9WA 1WZUA 2Q6VA 4LGVA 2ZI7A 2ZRHA 3PEUA 4XEHA 2V5AA 5AW5A 4IQ8A 3ZE8A 2B7LA 4HUQA 4UBMA 1KI6B 2Q3JA 2VA9A 3T06B 5C8YF 4WWHA 3HJTA 3VVMA 1I1HA 5D1NA 3M2TA 4M0KA 1S2NA 1CQXA 4GS5A 2ZRNA 3EW7A 3RVNA 2WWYA 4F85A 4NMLA 4TL7A 1BYIA 3MZ0A 4DCVA 3KQOA 4RMNA 4RVSA 2Q6OA 1X7GA 4EKGA 2Q0QA 2V4UA 1ID1A 1KHTA 3IEIA 4OTZA 1CXZA 2ZGVA 3VHXB 1KMCA 2FW0A 3C2QA 4RDXA 5KQGA 1XVUA 3KBOA 2JVJA 4BNNA 3I5YA 3IMFA 1V1RB 1VDZA 2CJWA 1BX1A 1SHUX 3BIWA 3QELB 5CX1B 2HW8A 1ZJJA 3BIOA 4RPHA 5H81A 1UBJS 2VT7A 1T10A 3TNFA 4C5BA 3CJTA 1LVUA 4IOKA 2NU7A 2P11A 3ZU5A 3CNNA 4EY8A 3SJBA 1UPUA 1Z6XA 2IPXA 2PMBA 3PENA 4YMGA 5D1HA 3U4MA 1T9KA 3NCHA 3MSXA 3HCPA 2EWWA 5CDFE 5C1DA 1VCIA 2J3IA 2UV8A 3F9IA 3G9QA 2SECE 3OCWA 3GYGA 2D2IA 4CTOA 1UC8A 2WMYA 3GRFA 4RTOA 4KE7A 1IBKB 3NUZA 3SIPA 4V02A 1N8TA 1XRQA 1V3VA 4B7AA 3DEYX 3THOA 4W5JA 3M8KA 2QL9A 3FFXA 5FBHA 4CUKA 3WWZA 1MGPA 3JQEA 4Q7JB 4E5UA 4YRPA 3UENA 1UQRA 2R7LA 1N9KA 1WSAA 3I6YA 3L6UA 2LP4Y 2E6KA 4IDQA 2CYCA 3PSAA 5EMLA 5BSTA 4TYQA 3PPYA 1PL6A 2ZUUA 4TSFD 2YDYA 4PBSA 3W1VA 3DWIA 1VMEA 2OG1A 4MUJA 3Q41A 2Y0SA 3WL3A 1GILA 3Q5EA 4DQUA 5K3EA 2ROQA 2ZQZA 5ESWA 4MICA 3WGIA 2FPWA 5FADA 3WZMA 1JHDA 1GPBA 2BUAA 2HA2A 2QAJA 3GFTA 3LAWA 5FEMA 1FF9A 1Y81A 4Q3KA 4IJMA 2HMWA 2X1MA 3DYIA 4ME6A 1FK8A 1FZTA 2JGNA 1CJUC 4A6XA 1XX6A 4IV5A 2GBPA 4MMZB 1D4AA 4LDAA 5CM9C 3GB9A 5BN5B 1U3CA 4KLNA 4IDOA 4Z1OA 1V5EA 1Y1TA 4Q3OA 2G72A 3OHPA 3RKRA 3F7MA 1DQZA 3GA7A 3O9MA 1ZL0A 2XT6A 3IV7A 3V80A 3EZFA 1XZKA 4AB1A 5FLXf 4FR0A 2W71A 1N0UA 1IG0A 4YXFA 2X1LA 2WLSA 5JS7A 3QFHA 1VQ81 1IU9A 3QRWA 3IGFA 4M0DA 3PT5A 2PD6A 3TNDA 1FFGA 4HX9A 5FQNA 4Z4QA 1EFTA 2F62A 4LYGA 4BJHB 1ABEA 3U62A 4BO0A 1R4ZA 1DCKA 4TKZA 3VR5A 5FB3A 3TG8A 2XB8A 1B6GA 2EKPA 4JJGA 4E7OA 3S7ZA 1ADJA 3IUEA 2CYBA 1FUUA 3AERA 2G1UA 3DS8A 3UV7A 3ZGZA 2DZDA 1CUZA 4BGEA 5ALSA 3WLMA 1XRRA 3N8GA 1OI2A 4ILKA 2R65A 4MVJP 4LX0A 2F6RA 2QIOA 3B7PA 4ROSA 4AD8A 4BVHA 3EVNA 4JU9A 5DXFA 1VKHA 5KVAA 5CVVA 2C7PA 2DLDA 1WD7A 4R05A 1RO2A 3N3AC 1MJFA 2LRHA 3EOZA 2WTUA 1JR3E 1NXOA 3PTLA 1SXGA 3PUWA 4BDTA 4KIUA 5LUBA 1KDTA 1Q21A 2A0XA 1GAWA 1E1CB 2YCBA 5F5XA 1EUDB 5SY6A 1UDRA 3NHMA 1BVYF 2IOHA 4GZ6A 2W6PA 4Q6BA 4DF3A 3ADOA 1LF5A 1QOPB 2W4IA 3WIEA 4BVEA 1JNYA 4FOOA 2J32A 4BTLA 1NQOA 2XUZA 1NPTO 2C77A 2D13A 1KVQA 1AUXA 2J4CA 3DE7X 4OIFA 3RR2A 4MVJI 4A8JA 2QX6A 3WQBA 3SS9X 4C9BA 1ANKA 2H2DA 4MW7A 4DBLE 4E1VA 1D9XA 5JAIA 3H2SA 4PLVA 5DXJA 4MR9B 3ED1A 3K1YA 3T1HB 1E0SA 1OJLA 2SICE 2X40A 3PX7A 3WRWA 3P9IA 3PJDA 1XK6A 4EYOA 1P5JA 4DIMA 4AVYA 3DB2A 3IP6A 3U0BA 2JH3A 2R7AA 4BWGA 5FUMA 2GO7A 3IAFA 1AUVA 3F0TA 2QUIA 3U80A 2B78A 4X1KA 1M7GA 4N48A 4DMKA 3MFYA 3DAPA 4BKPA 1SH7A 1OE0A 1E5LA 1XF9A 2GYYA 3GUVA 3K0BA 2CVQA 5CTAA 3WJ1A 5LWHA 3UWMA 4TV8B 1EU1A 7GPBA 5KJ6A 5EJFA 4D0RA 2G17A 2Q3LA 4C29A 1NQWA 3QOWA 3ABSB 1OH8A 4TT8A 4YV2A 1GVNB 5EHNA 2KWIA 2V9PA 2D3TA 4EPYA 2HNAA 3CYFA 10MHA 5B7QA 5IWAB 3UFXA 5LDGA 4JBYA 3RCBA 4JMPA 3UOGA 4TKUB 4AP9A 3VISA 4ZMBA 1YR2A 5JW6A 1Z5WA 2I5PO 5E8JA 5DWDA 3QOYA 3HCCA 4FNAA 2XQGA 3PFGA 3HBFA 3LHKA 4EFMA 5CLHA 2ISSD 1U4SA 2GYUA 4DSUA 4MQ5A 5AVTA 3Q87B 3DV9A 5DYGA 4MR8A 1JWBB 1Q3HA 4MQEB 2MJLA 4HAYA 4RJKA 1YRAA 5THQA 1V6AA 3V4OA 2I1VB 1NW3A 2YXPX 2IDMA 3DCYA 3IUSA 1O2DA 3DHYA 1SBQA 3GLTA 2P2ZA 3HB1A 4KYUA 3OTHA 5FPPA 4QNMA 4R2KA 1H2WA 3RRNA 4PGHA 3KZ1E 3B6JA 3JWIA 1Z5OA 1ZOLA 2JJ2A 4RF4A 2R97A 3Q2IA 2AH5A 5IF3A 2YY7A 2AC2A 1Z6AA 3ABRB 2XNKA 2YVKA 2F8LA 3MTEA 3HUDA 2F9MA 1A5ZA 2IU3A 2I2DA 1QGED 2MU1A 3B6KA 4ZI5A 5A9SB 1EBBA 2QREB 5C37A 2C2HA 1U1GA 2EJVA 5IVIA 1WXIA 3I6IA 3MUEA 1N3IA 1NSTA 1WU7A 3L7LA 1Y42X 4G89A 1E3WA 4ZXFA 1XTVA 4LXTA 5G1NA 5IZCA 3O5AA 4ENWA 1GTRA 4YJGA 4ZCTA 4PTLA 1ZIPA 3IXMA 5JCOA 4A23A 3KYDB 4EELA 4LYFA 3LDGA 2XXJA 4JBWA 3RBVA 3C6KA 1TZBA 3B2NA 5HKLA 1YHQ1 1B8VA 4FDMA 3TLCA 5ES4B 4D9FA 4UQPA 1HDOA 4BQRA 3W8DA 5DLEA 1QIJA 3JQ9C 4XTRA 1O9HA 4QFMA 2OP1A 2FW8A 3O2SB 2IPMA 2KHZA 2HK7A 3F9RA 1L7BA 2WJ3A 1TYBE 3LNCA 3IQIX 5IDYA 2BKXA 3MELA 1KZ9A 1WG8A 3HKDB 4HQOA 4AY2A 2NUAB 4D6YA 2AZDA 2QJWA 3H5VA 3CCQ1 3JWJA 5ABPA 2ZWMA 1W47A 5CG1A 1CRZA 4PCVA 2BM8A 1T1EA 2XRMA 5BSFA 1YI21 3FPFA 3ZBPA 5D1OA 3NGMA 4IWXA 4Q7MB 3IMGA 3LHFA 5JZ9A 1EFHA 4O4JF 1F14A 3I8XA 4K9NA 4M3NA 4NZYA 5E4JA 2WVJA 3B9QA 4EHFA 4EHDA 5C80A 1WRBA 3E7XA 2HU7A 1D7AA 5GOZA 3VV2A 4ZFNA 1KO1A 1B00A 3LUDA 2O50A 4OBBA 4TLCA 2ZULA 2IODA 2NTEA 1HYHA 1K1EA 3Q9SA 2QVLA 4L4SA 1NW9B 3S16I 1R88A 2OT3B 2HGSA 2NN3C 3O3NB 4P5PA 2Y0BA 2MCFA 1HLDA 2ZAYA 3AI1A 4Z0NA 1ZGGA 1Y1VI 1ZRSA 1XPOA 4EHAA 4J0JA 2P3QA 4FHFA 4P7BA 3CCCA 2RT9A 1UXJA 3CQZI 3IJRA 5F3DA 3RYHA 5E1OA 3KR2A 5F1OA 4CDGA 1KJWA 1RXUA 2V7WA 4R01A 3ZZNA 2G4VA 1DC3A 1LDGA 4J2HA 3WIDA 4A3II 1E59A 4UARA 5HVNA 3ONNA 1R8QA 4Y6OA 3EVAA 2ZYDA 4IIDA 4OJKA 2DBZA 3IVXA 3OHMA 4Y0AA 2ES4A 1EVIA 3OW2Y 2VNIA 1ETHA 1KK0A 3MT8A 1Z06A 3UHAA 1GUZA 4DR4B 3ICOA 4LOJA 1IM2A 2VZEA 2C8VA 5FR1A 1EUCB 4W6ZA 5JMPA 2V54A 2PMDA 4CFSA 1E2DA 5CD1A 3LOPA 4ZYYA 3N2KB 4B3TB 5CJ2A 2ZATA 2VDLB 4Q1FA 4RF2A 4UREA 3VO1A 4AG3A 1NJ6A 1BMDA 1KDPA 2C0QA 2PGAA 2F64A 1ZSYA 2XMDA 2XTNA 3GFFA 3HYSA 2ZIGA 2V65A 3VR5D 3ZY3A 4BNHA 4DGQA 2RB5A 3QVWA 5C5DA 2ZREA 4TOIA 4UM7A 1HT2E 4WN3A 3S1LA 1U90A 1TO6A 3RFCA 4CQMA 5J43A 2FDXA 3C3EA 4PSCA 4ZVUA 4A1OA 2P0YA 3CSSA 4K9DA 4FC7A 1I51A 1P5HA 2JFXA 3QHQA 5DH9A 5DI9A 4YRKA 1GSAA 5L7YA 2ZUSA 4TXMA 5LMZA 4MJLA 2GEFA 3A28A 1V35A 1XP8A 1SUDA 3VU1A 1JFFB 3K8YA 1IVYA 4L27A 1L5GB 3SP1A 4ZMRA 2D5AA 3RAEC 2BEJA 2DPHA 3L6OO 2QG6A 4MLCA 5KOJA 4EB6A 2QROA 4OB7A 2PRJA 3ZWVA 5A2Qf 3ZXYA 1I6MA 3WMRA 3O3OB 2AFRA 2W2VA 2CXHA 3DDOA 3CY6A 3QKIA 1JIVA 1W581 4GX1A 4KQHA 3T9EA 2H3EA 1ZNYA 4KTVE 1GRRA 2BEUA 4NWIA 4PTYA 1M2HA 2P9QA 5K0NA 1Y5NA 3A2MA 3T1VA 1TAHA 2XXBA 4M2LA 4L02A 1H4TA 1AK1A 1R37A 3KHKA 4J16A 5JPIA 4B6FA 5AICA 2P9CA 3CM0A 2DY0A 4UC0A 5TARA 1AK9A 4KV9A 4ABTA 1SJ9A 1FFHA 2ZJOA 1A2QA 2DH5A 1TWCI 2ODAA 4TMZA 4C5AA 1Z5UA 2HEGA 3IVAA 3MTGA 4MUYA 4DJ5X 4DSTA 1B76A 3B6IA 2KSQA 3SBEA 3DO8A 4A2PA 3HOZI 3HKCB 3TB4A 3V48A 3HS3A 1QAOA 2V6MA 4B34A 2YOGA 2BKUA 4KJZA 3OIVA 1OR8A 2QTZA 4M8NE 4DV3B 3LDHA 2QG4A 3JD3A 1U9YA 3VA7A 5AKEA 3MXOA 1K97A 4MUIA 2AQHA 4BE7B 2LXNA 2HBZA 1ZQ1A 1K7FB 1NR7A 2GYWA 2QN1A 3MAGA 4H6PA 3LWDA 4JJIA 5IP5A 2OFWA 1YBVA 3JV7A 2VJLA 2VP0A 4XLLA 4RE5A 4LC1A 2BTEA 4FHDA 4HH4A 4D9BA 1U0LA 3DP9A 2IEZA 2BMDA 4M7PA 1SM4A 1D2EA 2YWCA 2LD4A 4Y2SA 1MO2A 4CHGA 1CJSA 3E5RA 4CM9A 2J07A 3OUTA 1E4OA 4XW2A 5NLLA 4BP8A 1XQVA 1I4TD 2GOYA 2Y0CA 2F3UA 2VNAA 2VUHB 2J1LA 4KXQA 3WSTA 3U13A 1HLGA 3N3BC 2XMQA 2AB0A 5A9SA 2B2XA 1VQ91 1HRDA 3NTRA 4MRVA 2CKDA 4Y1FA 1M9NA 2TMGA 3OHSX 3T15A 5EIBD 2GNAA 2REBA 2BBSA 3GJQA 4PYOA 4N0PA 1T8WA 1NWCA 4DCSA 2JJ2D 4G0QA 4DWWA 2O7SA 1R6DA 2P7IA 2WF5A 5F2KA 4RTNA 1BGVA 2DFTA 3BIFA 1PS0A 3X1JA 1YUAA 4TS4A 1SG6A 3SKVA 2EC5A 4XGNA 4PBTA 4AIRA 3ZLUA 2P5SA 1QYWA 4W8OA 4L28A 5FI5A 3TH5A 4POOA 5D8DA 2PO7A 1B2RA 4B6JA 2VSYA 2QUBA 1Z13A 4BRSA 5JBQA 1USPA 4Y7NI 3TUZC 4I5IA 2YN0A 3C5HA 4XR4A 2ZJ8A 1HKUA 3MJSA 3E5NA 4LWQA 3WJ2A 2JI6A 3R6GA 4YDRA 4C0JA 1E4EA 2RGRA 3VBEA 3VKFA 2QEX1 1SB9A 2BFBB 1GRNA 1PS8A 3JQQA 2M98A 4WXMA 1F2TA 2Q0SA 3WMXA 4EYGA 4ND6A 1Q0LA 1W87A 3R4VA 4L4RA 2Z04A 4RQTA 1G3MA 2B4RO 4BXXI 5EIAA 1MB0A 3ZGYA 4X44A 3K71B 1ODKA 4PCAA 2O0KA 4S1TA 2W83A 4Y2QA 3WKBA 3BRCA 1GGJA 4YRGA 3U7QB 3QP9A 1F0YA 2VCHA 3UM9A 4EKEA 1F9AA 4KDEA 1L5HB 1WEKA 3THXA 4H7KA 3ZNNA 2ATXA 3LW7A 3RIMA 3VOBA 1CJMA 1JF8A 1GZ4A 1ZCAA 4OLFA 4R81A 1E5QA 3BWVA 1XD9A 1XA0A 3PDHA 4BRWA 2JKZA 3HCWA 4FMPA 3SXUA 2V5VA 4X7PA 4HDKB 3QI7A 5AMXA 5IPFA 3ETGA 3NJ8A 1W52X 4CM1A 4D98A 4LAFA 3LX5A 3MGCA 3P5JB 3OEHA 1IK4A 4LBVA 2GN4A 1K7EB 1ULTA 5EXEA 4HQLA 4G8CA 5CLGA 3P4UA 1XAHA 2QMYA 2E49A 1KNXA 1G4HA 1TF5A 4XSGA 3S5UA 4DC0A 5AW1A 2N3ZA 5FBVB 3RROA 2FOIA 1USUA 4D79A 1PNRA 1J2JA 1G6OA 2FFHA 1G20A 4DA4A 4ETIA 2BHNA 5FIUA 2E85A 5CT6A 3LHIA 1XB2A 3EC2A 1EA5A 3Q6NA 2JA8I 5K6AC 4OXXA 4AKHA 4FFSA 4M9UA 5GAJA 3RK0A 3HJFA 4DG8A 5KQMA 3QWFA 4MVWA 2IITA 1TCBA 1TTQB 3DKRA 3R6LA 1UQUA 2B6NA 3W9UA 4YYZA 3GEIA 1KVRA 2IV3A 4G5SA 4RCYA 2H92A 4FFNA 4L3OA 1OZGA 2E4YA 2PRKA 2H2AA 1Y7IA 2H4HA 3LUCA 3PVCA 3ZV5A 1QZTA 4GLBA 3KUDA 3DE0X 3U4HA 3BZWA 3GLQA 4EAQA 2X86A 4TUYF 1O0BA 3MCWA 1CZHA 3PD1A 2FG5A 1DFHA 4QT0A 1PJAA 1EAMA 1QG4A 3RGWS 3GFVA 3AP1A 4MNTA 3COVA 5A7HA 2EW2A 2XNSA 4C7XA 1SBYA 1ACJA 2K2QB 4QTUB 4J49A 4TWBA 5K99A 2YKGA 4Y30A 3OPNA 4FYYA 3HVJA 5F33A 1V45E 5IT5A 4I9UA 1T2VA 4GI7A 2DC1A 4AZSA 4CQMD 5EZSA 3PXGA 1QHNA 5E7IA 1RHQA 1VIDA 1L4UA 1FX1A 2OCBA 3GLHB 2GKGA 2QLFA 1WM1A 4RVDA 3KSRA 3NANA 2RKBA 1YL5A 2QD5A 3VVLA 5COBA 1QC5A 4H4DA 5EWLA 1Z3IX 5IVHA 4RL4A 2CUNA 4TLBA 4CBVA 4B82A 4FCVA 4G0VA 3DKIA 2W0MA 4DJJA 1L1RA 4XX2A 4PTZA 4FYXA 5JR3A 2ZXEA 4W7HA 4E5SA 5FYQA 1ORVA 4LYJA 3P0IA 1AXGA 4B46A 3RABA 2J08A 4FKZA 1MO5A 3HMQA 1TYZA 4BQNA 1E9RA 1FS6A 5AKKA 1YI1A 1A4RA 2W2KB 2OSVA 3O1IC 4J3FA 4N18A 2HQOA 5FA8A 5EP4A 1F5SA 5ICCA 2IYTA 2W11A 5AJWA 3BD9A 4ZO9A 1NVBA 2EX4A 2GCGA 3AVVA 2HX1A 5A4JA 2FLWA 3VH3A 1VQ5Z 1NF3A 1TEXA 3IEXA 1DKNA 1VPEA 4LHWA 3VMHA 3UMSA 1AKYA 3HQ4O 3KZKA 4J7CA 1MMFB 1NRJB 3D3WB 3LBNA 3F4KA 1FNSA 2FY8A 4ZPXA 5HJ2A 2DHRA 1QG2A 5CT5A 3UY4A 5K3FB 3S8YA 3EXAA 2A3NA 2DR0A 3WGLA 5B6PA 2CXSA 1GKYA 1U5CA 4DJEC 2Q0HA 3A1TA 1I10A 3I9NA 5DIFA 3FOCA 4ZK6A 3LUSA 1CKEA 2P6MA 1U2RA 4DL9A 3L43A 3H8SA 4TTVA 3I9MA 5JSYA 4FYKA 1WZCA 1LBIA 4H08A 4IRXA 1U3DA 1Z5PA 3QUAA 4PSDA 5FV4A 4ZC8A 4EEZA 1BFKA 2WQ7A 4RIGA 1XQWA 3MNFA 1QDLB 2UZ4A 2FDRA 4YI5A 3Q2OA 4YQFA 4QUDA 4OVKA 4UTZA 4DHEA 3K1AB 1GTG1 1SFOI 1HEUA 3OJWA 4CEJB 5KHOC 4I9GA 1LC0A 2ZR9A 4M9CA 4NBCA 3JPYA 4ZP1A 3RUCA 1QK4A 2YWFA 4OQPA 4CM9D 1AGNA 4R9VA 4NV0A 5GONB 1N5OX 2QUAA 4LYHA 5ADUS 1GQOA 3HEBA 2LIYA 3E1SA 4HYYA 3SYNA 1Q7RA 1QIEA 3TRFA 3X2FA 4AKGA 1J09A 2ZROA 3KT6A 1AA9A 1B16A 1ND5A 5EXTA 4BFWA 1L6RA 3C3JA 3LT4A 4TQUS 2G08A 1DWUA 4BHTA 3BQ9A 2OORA 4QYSA 4BBAA 3TGLA 1J42A 1S4MA 1KDYA 1NOJA 3SOPA 4OI4A 3TL6A 3ZOZA 4UPEA 4YV7A 3VNUA 1CQIA 1XTZA 5E2BA 4YAKA 3FWNA 3ZCPA 4RTJA 3GJ6A 1JPUA 4H16A 1K731 1P0PA 1PDWA 4MITA 5THKA 3C4VA 1SKYE 4PO1A 1XK7A 2RH9B 1A5AB 1RWWA 2J67A 4XAQA 3JZDA 3SLGA 4LJRA 3IKLA 4G97A 2QRVB 3GFOA 6CHYA 3M82A 1C7FA 1YL6A 1VQ7Z 1UEJA 3QVOA 5KWVA 5HR5A 4NDNE 4YAOA 2WT9A 1Q0RA 3GA5A 4Q4JA 3S2UA 4AECA 4BZZA 3F3MA 4RENA 3H9UA 4TRNA 3BWCA 3F6EX 1X3WA 3PC3A 3EXFA 4B45A 4IDAA 5DT9A 4URVR 2B82A 1GLNA 3BREA 4NPAA 2WM9B 5KOHB 3HFGA 4P9NA 3SWWA 3NHUA 1NVKA 4DA8A 1W0JA 2BEVA 4PHHA 1Z0KA 2W2MA 4DRXA 3ITKA 4L3WA 3F73A 1WCIB 2H9YA 4B5LA 3TCKA 3WA7A 4MLPA 1US8B 1KQSZ 1K8ZB 1X7ZB 1SZDA 2RBLA 1U11A 3RD5A 1D4OA 3MGKA 1WU8A 2CL5A 2G77B 1PRYA 3H2IA 3T12A 2Q2NA 3ZI4A 4HDQB 1UT8A 2KJQA 5H3CA 2Y1FA 4BX9A 4KR9A 4D9KA 2H9AA 2FMFA 4NYMQ 4LFCB 5CK4A 2E2WA 2I22A 1TKRA 1ULZA 2I6FA 1J0EA 4IIVA 2YHIA 4ETMA 5HOQA 4NRDA 1YB7A 3TAHA 4ZCQA 5HNKA 4LHEA 2AUTA 5BWLA 1E0JA 3DLIA 5BNFA 4BMNA 2VAXA 4JKYA 3TRIA 1P3DA 1SA0A 4Z99A 4RHUA 4X3PA 1HDRA 3PTZA 3EE6A 4MCHA 1GPAA 3HWWA 3P96A 4NCIA 1CNMA 5JNRA 1H8HA 1I3QI 3CCVZ 1Q7Y2 1V41E 3A05A 5LYJB 2ZKIA 3OEHD 3OZUA 1MB4A 3NKLA 4JLOA 4GBJA 1GFWA 2W6CX 4CN8A 1AUPA 1ZOIA 4LF5B 2EHDA 5JBNA 3PV0A 3A11A 3RTEA 2F59A 2R6ZA 1CJTC 4UPVA 4X1IA 3FHLA 5ALEA 3X1KA 3GEMA 4JJ4A 1GL6A 2JHPA 1I4LD 3N6RA 3QVJA 4DEXA 3PFHA 4M76B 3G0HA 4BVLA 1TE2A 4DMRA 1INLA 3I01A 4CM6A 2CXTA 1TA9A 3D4LA 2XUPA 5FNVA 1P7WA 1UKZA 1YDGA 3TR6A 3ZBQA 1U6KA 1ZITA 2WYOA 2YR0A 4JJ7A 1LXCA 1N3LA 1H42A 3ZDZB 4AW9A 4C0QC 3E3AA 4JWTA 3NZEA 3OZRA 1VQKZ 4RLHA 2HDNB 1M2OA 1L0BA 4Z7NB 4TLMB 3BXZA 1RXYA 3SBOA 5FWAA 4KXFB 1L2TA 3DO6A 4LOKA 2ACVA 2A3RA 4DB2A 1RI5A 1K7CA 3HL0A 3ZY2A 2VF8A 2FMKA 4AJNA 3SKXA 1QDUA 1J33A 4KQ6A 5A3VA 1Q7GA 1T8UA 2P8SA 4B87A 3D54D 4EEKA 1FDWA 1WV0A 3X1WA 3UYKA 4YLGA 1T9CA 3GVIA 4PRKA 2PJDA 4DCTA 2FGKA 5DN9A 2VJPA 3UJDA 1QNLA 1IUKA 1V3UA 3WRVA 2DWPA 1AB6A 4YASA 5EJEA 4DE5A 2XRZA 1R16A 1V4BA 2BE7A 2J9FB 4LJ7A 3AF3A 4FVTA 2AEEA 2ZANA 1ZINA 3I4NI 1HE4A 1XCOA 3E3OA 2B1GA 3EBPA 4RGBA 1C7QA 1K3FA 1PGPA 1Y37A 5KS2A 1G66A 3E23A 4NR0A 4URUR 2CLEB 3WSWA 1DJLA 2VEDA 4C08A 4J0IA 3ELBA 4FI3C 4RKYA 1WNTA 3O9VA 2Y99A 4L78A 3ZCRA 4ZZ3A 3R5XA 4IOMA 2BJOA 1DOZA 2K6GA 2HN9A 3CC21 1G8SA 2Z1DA 3K1ZA 1ZVKA 3P9KA 3TNJA 3HDJA 3ZDFA 4AXBA 5DBOA 5ALGA 1XGKA 2H11A 2K3RA 1DUVG 2JLQA 2XUFA 2NQ8A 3EERA 2H1FA 1VQ6Z 3R0VA 4I1RA 3VYTB 4MJXA 3HUTA 2QVXX 2EIHA 1OT5A 2OKGA 4Z8XA 1NZFA 1U8YA 3DMPA 2QTNA 5ERYA 4N3AA 5IZ4A 4QXQA 3F98A 4MVJA 4NCXA 4U6NA 3KT8A 1QH9A 1ONSA 1DPFA 4IYJA 4LTDA 4GSYA 1XNRB 3FIJA 1DADA 1NRWA 3SJZA 4MZXA 1Z0DA 3QMVA 1NJ5A 3TN7A 2FDCA 4G1EB 3ZCUA 2OTL1 1DAMA 1O9BA 1ZEMA 1C1DB 3BL5A 5AHWA 1Y9JA 5F3WB 1A1SA 1PGOA 2JS7A 4CT4B 1Z4PX 2OZLB 2WD9A 2H54A 1CRLA 3OTWA 2WJYA 3DMHA 5H16A 3P1JA 5SV2A 1RJ9B 2V7PA 3NHWA 3O8QA 2AR9A 5CAEA 2A78A 1TM1E 3AF4A 5AKXA 1CUEA 1UINA 4GWLA 5JO0A 2XZDA 1Z0SA 5DGXA 3CMAZ 4QUHA 1A88A 4OF4A 1FRNA 3KG2A 4UMFA 4QG3A 4KDRA 1Y3IA 5EFZA 1Z6TA 1ZM4A 3FTQA 1LRJA 4G56A 4YRQA 5ARDA 1B42A 4CJXA 4G5GA 2WTAA 3QEOA 4D81A 1AN9A 2C94A 1KJ8A 3BG5A 4P8RA 1SFRA 2P62A 2WZCA 4AJKA 5U4XA 1H5NA 2BDEA 3GO4A 3H5WA 1YDEA 4ZODA 3WXBA 2BLLA 2O2ZA 4ZMSA 2CMDA 2WVGA 5L3SB 4Y6GB 3S1RI 1AT1A 2C2MA 1UOOA 3CKMA 3JAKB 1G8MA 3C3CA 3BFKA 1QHHB 3KWFA 2Y1GA 3R40A 1X3SA 4I7EA 1IVSA 1ZY2A 2FPLA 4DKXA 3EOAI 2OLEA 4E94A 3P45A 4G5FA 3HKBB 1IMJA 2XWQA 1L1OC 4QGSA 4DR5B 3PNMA 4MEBA 4PZZA 1GPMA 1MJ5A 2P8JA 1T3LA 4I1YA 2YWDA 2OCLA 2XYHA 4Z0TA 4CV1A 2FTKE 3CONA 1XZ8A 2VP9A 4C06A 1FSSA 1W5SA 3LPLA 4G3XA 4NBVA 3ZDYB 5CJJA 4BQQA 1VP9A 3C24A 2GHIA 4E3ZA 4YUXA 1VYUA 4L8FA 1FP6A 3HSYA 5BN4A 5LU8A 2VTEA 2O3RA 1IZ9A 4Y2YA 2P0AA 4NCNA 3DAFA 1C8VB 3HY4A 5DXAA 5HDBB 4BEWA 3B3QA 4LJ8A 3S7TA 2C97A 5CM2M 2GPJA 1PVOA 4QEDA 1AV6A 3V1NA 3NBYC 5HQTA 4I1IA 3ECAA 3W05A 3BDVA 2J6HA 1MO3A 1L1QA 2CEAA 3E18A 3FNRA 3ELUA 1W0JD 1XC7A 1Q0UA 2YICA 3FCXA 3NV9A 1I94B 3IHKA 1T36A 1H2XA 4NMXB 3WRXA 1ZM7A 4N39A 1KYIA 1N1MA 4M99A 1PV4A 1QHIA 1PZEA 3KB2A 3FCAA 2GZDA 2KQUA 4XWYA 3SVTA 3QZUA 4DCOA 1BGWA 1KOGA 3OMXA 1JMVA 2DQ4A 5B6JA 2ASEA 1K8YB 4YR7A 4WFQA 4GYYA 3SC2A 3WOVA 3CB4A 4OQQA 4AZ0A 3LLVA 2BI8A 2AZ4A 1MAHA 1G7TA 2EJUA 1CDDA 1GO2A 2GAIA 2AYXA 2FRXA 3MJVA 3NOQA 4IJVA 4KIWA 1D04A 1S89A 1EG2A 4NBUA 4ZU1X 4OI0A 3CXCY 4G85A 5JXHA 1UBKS 1HBJA 3HPQA 4P35A 3FMVA 3SU8A 5F52A 1X77A 4U9UA 3AFHA 2VPQA 3DQPA 2JFNA 5DBGA 1ZISA 1TWFI 1LSOA 2Q3HA 2H1WA 1BJKA 3FNQA 3KJFA 3L1HA 4UEOA 3W7AA 6LDHA 3U49A 5EEGA 1DOAA 2YXEA 4BS9A 1H8HD 2K87A 4X92A 4J7XA 2EZ9A 4RWEA 4HDAA 4EH1A 2D5IA 5HA5A 2W8ZA 5EJAA 3HA3A 4XVUA 1P9OA 2EIXA 3AKDA 2Z3ZA 5J5CA 1BDJA 2VL7A 2G83A 1XCPA 3QPAA 4QHTA 1ZK4A 4J94A 5ERGB 4CKBB 3CJQA 1JDJA 1EWRA 3TFOA 4YA6A 4LSGA 2CJYA 4YRLA 2NUTA 1GNQA 2UXDB 1CR4A 2PPVA 3WB0A 3OT1B 4CM4B 1AO0A 4AS1A 1RFLA 3UWSA 2M6NA 1ODSA 1GPWB 2PGOA 3JAWB 3WWEA 1AIPA 3G82C 1W0KA 4HHEA 1GLGA 1O3YA 2QPLA 4L3VA 4Q24A 4S24A 4X91A 1PR1A 3A6KA 1ZAYA 2F8SA 1K75A 4HAOA 4G0UA 1P4RA 3CD61 1GYPA 1R0LA 3QMPA 3PNSA 3QG5A 1U9IC 3K0CA 3GJ4A 1JE0A 5LZ5A 4YB8A 4HI0E 1LV8A 4EDHA 2YV2A 5DNWA 2K4MA 3TLZA 2EJWA 2WSBA 1G21B 1W93A 1WMEA 2Y93A 1NWHA 2EJCA 3Q7IA 4HL6A 4Y9RA 2ZIXA 4CLXA 1D2GA 3FKJA 1JIQA 1NXTA 3CRRA 3VPDA 3TIGA 2ZW9A 3I9LA 1I5OA 5AD1A 1YQDA 1G6KA 1NOIA 3BQMB 4HFMA 5CVEA 5HIKA 1Q1QA 3N8IA 1PEAA 4DW8A 2HV8A 2VDKB 3K8OE 4ZQGA 5FAXA 2HWXA 1YI0A 1N1DA 3AKEA 3OZFA 1S8AA 3SYKA 1AMNA 1M54A 2VDWA 1FYDA 1MQ9A 4BLQA 2D06A 4J0KA 4Y1GA 3IUMA 1F60A 5FFNA 4CL8A 1VRWA 2I4NA 1JIXA 3PNKA 4MCJA 1STOA 1UKBA 3JTEA 2G70A 3VYRB 4ZZ0A 5FUQA 2E4VA 3UATA 3GPCA 4YRIA 2IHTA 5JVDF 1U0FA 2A5GA 4W9RA 3BA1A 3MWDB 5BOSA 1JKJB 2BVNA 2JB9A 3H9JA 4KFCA 3QXGA 3N75A 3O91A 5KZMB 2QMEA 5K0SA 3SDBA 2WWHA 3L8ZA 4YPOA 2MSEB 3MJEA 4BRUA 4PGAA 2CZGA 2P28A 2HQSA 3FCYA 4YGYA 4JI3B 2MT9A 4CW7A 3DLBA 4L6IA 3DDHA 4JUIA 4ND3A 3QE2A 4GQBA 1XTTA 1FQKA 1HH4A 3G88A 3HSKA 2OHXA 4WCDA 1KEKA 1QRSA 1MW9X 3R5JA 2IUSA 3GJTA 3NS7A 4UM8B 1KI8A 3FIUA 2GT1A 5CYFA 5DPMA 4OHZA 5LZ9A 3PEYA 2BFWA 2GK3A 2V74B 2WUFA 3AY0A 4UBJA 1RM5A 2G06A 4MVJD 4UUNA 5EA2A 1EWYA 1DDOA 1E4YA 3HXQA 2BGKA 3R7BA 4EY6A 3DT6A 3GY0A 4ZT2A 1E3LA 4LOLA 4KNYA 3LRPA 3BWYA 3KEFA 3BRSA 1VJTA 5JH7A 3QUCA 2JLBA 2X2FA 3AX6A 3NVAA 4P4SB 4CEIA 2HK6A 2RHMA 3AP3A 3IV9A 4HVAA 2KM1A 1MOQA 4A3BI 2RCNA 3CCJZ 1QVFY 1C7ZA 4H7JA 3HY6A 2FG6C 1M1NA 3RRMA 2B4TO 1DT3A 3TEJA 1RKBA 3RB8A 4EG7A 3M3YI 3F67A 1FRZA 1CHNA 3OF5A 1KH3A 3NGLA 4J1SA 1SOWA 4HCJA 4AP6A 2K5RA 3OAAA 3ZPXA 4EVQA 2AI1A 2XMRA 3VKWA 5BORA 1FXWF 5T3UA 6Q21A 3IPAA 2KI7B 1NF9A 1OWNA 3CTMA 3O92A 4N0MA 1DEHA 4HG2A 3DQZA 2NXEA 1UFKA 2NYAA 3AOEA 1EX6A 2HPZA 4KO1S 3VAAA 1W2BY 4UEQA 2XCRB 1OGJA 2XKAA 3GFSA 3ZCSA 1P75A 5LBUA 3QLVA 2OR3A 4YAWA 3HYNA 1P1BA 4HFJA 2F3SA 3T3EA 1YR9A 3OOYA 3CUYA 1OB5A 1KZ7B 2ISCA 3IE2A 3NTQA 1UOQA 3ZJYA 4ZVTA 4UBNA 2ODNA 1U4NA 4M9XA 2DR2A 3L5KA 3PEEA 4R98A 4JLUA 5CCEA 4JHXA 2HHHB 1XTRA 3DKKA 4LRSB 4ZQFA 3NMUF 5GINE 3SZLA 2G76A 2P5YA 1WMDA 4BV2A 3SX2A 5EQDA 1FUKA 3NYIA 2O05A 5G4KA 1GWNA 3UKOA 3ET5A 1WKVA 4L72A 4JVNA 4JDPA 4A1FA 4DZZA 5HMLA 3G5AA 1E1MA 4CM5A 2QRQA 2WWFA 3WQHA 1OFUX 2BFCB 2G8NA 2O1SA 5AW9A 3NW9A 3U17A 1CDZA 3G89A 1I7PA 2QTHA 5KIAA 5HKAA 1EFPB 5ALVA 2GBIA 3T7SA 4XGKA 4MMYB 1EWVA 3IH5A 1RAIA 3ZV4A 5HOEA 2M9MA 2R60A 2PXCA 3H4TA 5ESXA 3CF6R 3CWCA 4Y1RB 3RU3A 5FUBA 1CY2A 4MS4A 5AXDA 2ZYIA 4UTNA 5DW3A 1U81A 2P41A 5EXSA 2MYUA 3MWYW 3N2EA 5ICSA 1L9XA 3LUKA 2GDJA 4TYMA 1S6YA 3PFKA 4ZTZB 2QX8A 3PF9A 4LJKA 3MBOA 2NO7A 4ZYLA 3BK1A 4U7HA 4LE1A 1PNVA 3NAQA 3TMAA 2ZRCA 1UC5B 2Y9MB 3DHEA 4LZPA 4FX2A 3IP1A 2IYYA 3RVBA 1GY8A 3EQ2A 4TYPA 4BWYA 1ECLA 2XE7A 3PWSA 3R3ZA 4ER6A 5FFMA 4EY7A 1LKZA 4HPXB 3R9IA 3KKPA 3TF5A 3PSHA 3G2MA 3KSDO 2W2OA 2X5KO 2A8YA 1GNRA 1HTTA 1UM9A 1Z0FA 3EDCA 4P4GA 4WDQA 4D0NA 3Q7RA 2DT5A 2CJXA 2GXUA 3FOZA 3DFFA 3VKVA 3QJ5A 4ZOQI 2DBVO 3VR4H 4B7CA 2C7BA 4JI4B 4P33A 5EZ6B 1VGQA 4UNNA 2P77A 2Y0EA 3RC1A 1GUBA 3ETEA 2D2FA 3GLGA 1E9SA 1DKQA 3I2FA 1DX9A 1YK1A 2R7ZI 5DNUA 1E98A 4YP9A 2C2XA 2H4JA 3OKAA 4UNQA 1L7NA 5BMVF 1FX0A 3QM1A 5H02A 4B4VA 4OHPA 1WXWA 3U9SA 1DBSA 2GPWA 1ZA1A 3WK5A 4E4TA 3OFSA 4JYPA 4CTJA 2NADA 4BVBA 5JSZB 4IW3B 3SQXA 1TK9A 3ZYZA 3RFXA 2H3HA 4EUNA 4F2WA 5E9JA 2AOVA 4M7RA 1UKYA 2X6RA 2GAJA 5IRCD 1HE5A 1T4CA 4DV5B 4RSRA 5CITA 4CT5A 3IQHX 4Q02A 1RWVA 2YFYA 4XSVA 4BJ6A 1U3TA 4B17A 5E3HA 2ZCVA 4KR2A 1UKEA 3RH0A 4HNAB 4RVHA 4HQKA 3VH1A 2D3WA 4D80A 1KYVA 2E2HI 3PIDA 5EG5A 2VAPA 5GZ1A 2H08A 4LCBA 2ZPUA 5TSDA 4DMMA 3U3RA 2NO0A 1DXHA 2OM2A 4GD3Q 4ZJZA 1CQWA 2IIBA 3O93A 3DC2A 4FNGA 2QM7A 4RD2A 5K3BA 1SWWA 5AR1A 3ROFA 4BKOA 2VTVA 5TVKA 1WUYA 4I2NA 4QE3A 1W0KD 3VU3A 1DNPA 1CW2B 1S9HA 2VHZA 3TWOA 3PEVA 5B58C 5CFLA 5K4GA 4Q4AB 4TMVA 3ROGA 4BNDA 1WCWA 4Y0NA 2GCIA 4UW9A 5J4HA 1DL5A 1DAOA 4RK1A 2VQSA 2WMDA 3BVPA 3OZSA 3ABOB 3GG9A 1G8YA 3AF1A 3H0KA 4O8CA 1PD0A 2ZSUA 4P2GA 1BAPA 1OF1A 2TECE 2XEDA 4HQ6A 3QX3A 1QSGA 4TNUA 1II8A 2AW5A 5ICMA 5SZJA 2C7OA 4IIUA 1PNQA 2R1ZA 2ZRGA 3HCFA 3KPYA 3AV3A 3OESA 2PVPA 1IQRA 5MFZA 3G5UA 4MUMA 2PYIA 2Z8XA 4DT1B 3Q8XB 1V7PC 4FSDA 3TTXA 4CV2A 1P4GA 1QIGA 1MNAA 2W4QA 3UTCA 3JRNA 3WQQA 4E08A 3E3LA 2CLMB 4LIPD 3I55Z 3AKZA 4P0QB 2WHPB 3ES9A 1HE1C 3P2JA 3HDYA 1X7XA 3BXGA 1A2OA 3SYRA 3B85A 3WGOA 5JI2E 3GTMI 1Y1VS 2H2GA 2ZJ4A 1B23P 1EUQA 3E4CA 5INTA 1L1EA 2VDQB 2JFZA 5A4AA 4C04A 4YFYA 2Z08A 2JGIA 4CQJA 4QM7A 4AIIA 2ACEA 3THYA 2VJBA 5L4LA 1NQUA 4B2LA 1DRUA 4N5IX 3CPSA 1T8RA 5AW2A 4B4KA 1TLTA 3PNOA 3IJ5A 4PSUA 1QKKA 2FLKA 3PFWO 4JGGA 4H1UA 1OLSA 4Q7KA 4QRHA 3SGLA 3VSCA 4EFNA 5BT8A 2CHGA 1SOUA 1GU7A 5KVCA 1RBYA 3K2BA 1MEJA 2OB2A 2O2GA 3L49A 5GVRA 3HADA 5CDYA 3WO1A 4MMXB 3SC6A 3MGAA 1CD5A 3JQAB 4F11A 1YQXA 4TWJA 1I3NA 3OX4A 4OSEA 3HK2A 2R6JA 1OB2A 4UCFA 1G8JA 4XLZA 4IZIA 2NNLD 4IGIA 3C41J 1IN8A 5BSWA 4H0NA 1WUTA 3INNA 1TWAI 2NV0A 2W03A 3FUUA 4HLQB 1SK8A 4O4IB 4PAGA 3FMGA 4IDPA 4U8GA 2GHTA 2RH5A 4G07A 1J2YA 1P6XA 5DDIP 4FBLA 3T0FA 1AF7A 2DJIA 2VN8A 1CUBA 2EGHA 1N6IA 4MRMB 3MD0A 4BMZA 2BM9A 1XZDA 1RWBA 5DGIA 3L02A 2QE7A 2G1PA 3BFVA 3OAAD 2FWJA 1G3QA 2X58A 3F6YA 4LS3A 4W1QA 1L4YA 1OTXA 2PLWA 4LTNA 3KVNA 4J29A 4UUBA 5EUBA 4A16A 4IDBA 5BWNA 5JI3E 2ZJ7A 5JT1A 1LPPA 3H5IA 1F6BA 5EYPB 4DDTA 2PU7A 4JGBA 2NU8B 1O9GA 2WZQA 4H0CA 2OD2A 3GEBA 3IAM6 1R0RE 3PA8A 1KS9A 4IJ6A 4OSOA 5DLDA 3GDWA 4Q9IA 2MSLA 4M9QA 3UJHA 3WLJA 3ROPA 3SYMA 3ZLVA 4Q21A 1AS2A 4EGFA 4FZ5A 5I8WA 1SUCA 1N8NA 3P0FA 3DWFA 4G0PA 1YL7A 3WJAA 1B7GO 1KAOA 1QIIA 3PWTA 3MYYA 2J0EA 4G8BA 3K70B 3IL2A 3AF6A 4ARSA 4QYIA 1UMCA 1RABA 2GN6A 2HA0A 4KI7A 1ZGCA 2J30A 2BHSA 2JVIA 3FPKA 2IP1A 3Q1LA 5K2MA 3VYUB 4Y6QA 3VDRA 4PLYA 4CV3A 1CFZA 2V7QA 3ZOKA 3L8CA 1Y80A 1Y6RA 2CW5A 2AJCA 2PY6A 4KX3A 5AM2A 1TMGE 4JX9A 4P0PB 1XYGA 3DNFA 4ZQBA 2WT4A 1I2AA 3VH4A 1PT9A 1N34B 4QOJA 2AGVA 1QTQA 3HXTA 4Q37A 2HDOA 1G20E 4M0PA 4G0XA 5TMPA 2IBMA 1E2FA 3F1LA 3NO4A 3Q10A 4RJJA 4UD2A 3STTA 1E6WA 4GPAA 2BGGA 2ZUDA 3R5KA 2WC1A 4IHJF 1UEIA 2F2TA 4OHVA 2BKLA 3BORA 2APJA 5A2GA 2R7MA 1NASA 1WVMA 3PE3A 3VSBA 1U0HC 4F8YA 4M8IA 2W6ZA 2WVAA 3FNIA 1D1QA 4QUIA 3RRZA 4DQVA 4NHEA 3K70D 2XVAA 2GJ4A 2WYUA 4B4UA 3X1XA 2GXAA 1A7KA 3K2QA 3JD2A 4NJOA 1QHFA 1S2DA 2C99A 3GGCA 3QPUA 4R5MA 3R7WA 2UUOA 3UJPA 2DMRA 4EVSA 4NBGA 1ZHFA 5G0VA 2VJMA 5BOVA 4B4DA 4MRPA 4U00A 4JS0A 2WU1A 3PD7A 4LPKA 4RK7A 3C5CA 3GX1A 5JCXA 4D3DA 3EXG1 3E70C 3KUCA 3OFJA 3WTCA 4XZ3A 2JEOA 3SS7X 1JA1A 1YC2A 2NVBA 4DJTA 4BXOA 3UMCA 1QYCA 3ODGA 4RHTA 1QRTA 3MJCA 1TZ2A 2EEZA 3NWEA 3C8DA 2WNSA 3I05A 5LBTA 2Q7DA 1FYFA 3IBGA 4YGXB 5A5EA 1GL3A 1RJWA 1PD1A 2AOXA 2FN9A 4B73A 3ENQA 4FNOA 1E18A 1A50B 2QXTA 4MDFA 5EWMA 2ZE5A 3OQJA 5TPZA 4WDRA 5L3QA 1RYZA 4R1QA 4HDOB 1M7HA 4IOJA 1B3BA 2FOXA 1YQUA 3M4JA 1L4FA 3ZTTA 2VF2A 1JEQB 2W6NA 3HXKA 1P1KA 1FYVA 4DEVA 1F20A 1L7VC 1U7OA 4O4JA 5AKJA 4DWVA 3KWLA 1EK2A 4FW9A 4F38A 3OO1A 4RV9A 1OAAA 2NNWB 4FONA 3OPXA 3U31A 4JC5A 1EESA 1XRJA 3DYBA 4C87A 1VIYA 1YOBA 3EGDB 4KACA 3C8MA 1CEEA 1NY6A 1OGIA 3FCCA 5CYGA 1E9EA 1RJEA 2RG7A 3RG8A 3T34A 421PA 2C2GA 3EG9B 2OQIA 3LO5A 4MYTA 1GXSA 4NE2A 3RVRA 3VSEA 3J81b 2I54A 1Q44A 2R85A 2HXGA 3P19A 2G1KA 1Z29A 3FHJA 3NBAA 1F1BA 1IN7A 3BMNB 5GY7A 2N1BA 3AP2A 1Z75A 4U2KA 4HXFB 3UAYA 3JWEA 5CXQA 1M72A 3DQQA 5KYTA 3VJMA 4JUCA 2G25A 3GGPA 4F9GA 4UBIA 4H31A 2E1RA 4ZOLB 4F4JA 5A0VA 2FFJA 4A91A 4US2R 2VYCA 3X44A 1OQAA 2PUAA 1MHPA 1KOJA 2JA7I 3AF5A 1MF7A 3SK0A 4KQMA 2H57A 4C6HA 4HR7A 5JY1A 1M2EA 3MOIA 3TSZA 1BXZA 3ZWMA 2D1FA 5AVXA 1OVMA 1QRRA 2JA1A 3M6FA 2PRYA 1F6WA 1NL3A 3NG1A 5BQ5A 3T3HA 3KCNA 4XX1A 1Z4QA 1GFIA 4K86A 1OXUA 4NEQA 5BV8A 3K7AI 3CUSA 3ESDA 3SZOA 4BNMA 4D6PA 1BSVA 3OTOB 1E60A 4F5YA 2AJTA 3AXSA 3BILA 4QPJC 3H17A 5LL6P 3L7NA 4RHEA 3GLKA 4UM9D 3HZOA 4NOKA 2WY2D 1I4DD 1IBRA 1T9GR 3QE3A 3IB3A 2WSMA 2O52A 3G7UA 2JAOA 3UJ6A 1O96A 2C4MA 3CH7A 1EE2A 4QYWA 1CVRA 4FOSA 4M1YA 1G4AE 4MARA 4F4FA 5AJTA 1DDGA 2BHLA 2QU8A 2XKJE 2Y1CA 4IRUB 5AK4A 4EVIA 3KDAA 3JATA 2I1LA 1WJ2A 1XZIA 4I14A 2H0RA 4H7PA 5EPOA 5I7SA 4BQIA 5LOVA 2A0UA 2TSYB 4LJ6A 4OIMA 2NTNA 4NIMA 2VUMI 1IJFA 1GSHA 3GGJA 3H65A 3H1EA 4YRNA 1R6BX 4CN9A 2VTBA 4LE2A 3BL6A 4D1YA 1TQ4A 1GCUA 3G9TA 3UT5B 4CTMA 5IFKA 3QOFA 3KHUA 5SY4A 1NUAA 2IPAB 1BZYA 2RHBA 3K0EA 3PQEA 4F93B 3NVMB 1WPRA 1MIOA 2ZSFA 2ZUVA 4G41A 2HF8A 2IH4A 1T43A 3S2EA 1YH3A 5D51S 1BEZA 2XUQA 5J2TB 2XDQB 2YXLA 4R1TA 4KO4S 3ZJ4A 1C9EA 3IAXA 2W2PA 2WKQA 2PFSA 4EZIA 2IHBA 1XTBA 5IAJA 4BTVA 2JJYA 1VFPA 2ZBQA 5ADVA 1P1HA 1VHQA 1JB1A 2R4QA 5HGJA 4EGCB 1OILA 2ZUCA 1ZCFA 2JCBA 3UG6A 2QE7D 4A15A 3HGTA 1U0JA 3ZWXA 5CDTA 4D4LA 2CLLB 3DONA 5DCUA 3EVZA 4HDMA 1Q11A 2ZB2A 4XVCA 3DTVB 1X8KA 2GPBA 4Q4HB 2C82A 5LB4A 3O8CA 3TNLA 4YMHA 3GNQA 1AZWA 1R64A 1USWA 3VPBA 4RFSB 4OK5A 4PBRA 1JPNA 4MWCA 3ZIAA 5KU7A 2QA41 4DSOA 4GEGA 2IEBA 5EHQA 1DUSA 1F0NA 3A27A 1P77A 1POWA 4NULA 2QDXA 1JTFA 3NAZA 2DUWA 1J2TA 1A04A 4OGGA 1SVUA 5HPYB 3P0RA 2B99A 3LBYA 1MLDA 5LB2A 1BW9A 2RHRA 2O8NA 4TXLA 3HJAA 3TVDA 4X7RA 1YIAA 3A06A 4CXMA 2VQEB 2GSWA 1U2GC 2WJHA 2N47A 2G2KA 5EKTA 1V16A 2V7QD 2YMLA 1R9JA 3MGGA 3SN6A 4LF6B 2IGTA 5IKOA 3VPAA 3KTFA 4JC0A 2GM5A 1M2FA 3FDZA 3MWLA 2ZIAA 3ZGNA 1LW7A 3D3JA 3EFHA 2QOEA 2LKDA 1TJNA 1MAAA 2VPPA 4K3VA 3U9LA 1TWGI 16PKA 3DPUA 4QOHA 4DLTA 1MV5A 5FKJA 4AZ3A 1Q95A 2ZIFA 4IRMA 3HA2A 3KVYA 1QGDA 4NFSA 4XM2A 3FMPB 2OBNA 2DPMA 4FGKA 1NQVA 4GI2A 5NULA 5LXTF 5FUYA 4CMKA 2W4MA 4M98A 4BEBA 4HNUA 4YP0A 3K0FA 1DC4A 4NQRA 4WACA 4YK7A 2NAFA 1IDOA 4D9MA 4DAOA 1XMQB 1PTJC 3FDIA 4M1OA 1EQUA 3GRRA 2R5NA 1V8DA 3UHFA 4N54A 3ETCA 4Y3UA 5JSUA 2A0KA 3OQOA 2IHNA 1F7UA 4I4LA 2FXIA 2HMUA 1BD3A 2C54A 1HURA 2NQ2C 1EK0A 2WZBA 3G17A 1YA8A 3N0WA 3R3SA 1XSEA 2V0NA 1HOTA 3BJIC 4LYAA 1LQTA 3EOBI 2OEPA 3RARA 4DJAA 3PQ3A 3ZY5A 2XODA 4YPFA 4ESEA 3P71T 4OFWA 4V39A 4ECAA 2OFXA 3UWOA 1P45A 2GAOA 5C53B 5I7HA 2D8MA 3R9KA 3QITA 1PVDA 2IFTA 1CZNA 4JOQA 3QYPA 4EF5A 1DHRA 3LM8A 1L4NA 1V3TA 4PG4A 1IY9A 5EP1A 2ZM5A 4MV8A 1JMYA 2GTPA 4NBKA 1Z2PX 5AJHA 2GBLC 4GVXA 4B80A 3AVYA 4IHKA 1KSJA 4P4UA 4JLSA 5KEIA 2OTJZ 4DAEA 3JW8A 4DPLA 5G4LA 2RC6A 5AVYA 3JVIA 2VPWA 1AKNA 4U0KA 2A84A 5JSFA 5TPZD 1Q7Y1 2EHJA 3BL8A 3BRQA 3U7HB 1Y4DE 2WFZA 1KSGA 1Z2NX 1VL2A 1JWHC 1YB5A 2XE6A 3VYSB 3IR7A 1IIRA 1BA2A 3JD1A 4UKDA 4E88A 2I3DA 1SPXA 5DCWA 4ENVA 4HAWA 2O0JA 3IAS6 3L0PA 5M2QA 2BR5A 2GR9A 2QLLA 4HDCA 1RMYA 1JQEA 1JNXX 2V98A 1T3HA 3A1UA 3M4XA 4G9GA 4RIFA 5F9HA 1G8PA 2Z30A 4QUJA 2ECPA 1IEVA 1ESEA 4MVJE 5FOXA 2I7CA 2RH8A 4AO8A 4DY4A 1QJ4A 1LLFA 2ON6A 2W2XA 1MABA 2JIDA 2C98A 3IIKA 1ENOA 3IT3A 3V1UA 3VI3B 4ZVRA 4LYEA 3RE1A 3IPRA 1I4WA 3F5QA 4OMCA 4ZGGA 1KS2A 2PVCA 2WB4A 2FSFA 3LI2A 1YJBA 4NMWA 1HG0A 4HH3C 4HTFB 3HU3A 4L85A 1DJQA 3S17I 3E7PA 5KVVA 1OGYA 4QFBA 1P1JA 1SCUA 3EFBA 3JAMf 3OPYB 4IOLA 2X14A 4WCFA 4UTRA 4JYZA 3CX8A 4KU4A 2PMEA 1PP4A 4JOBA 3ZW8A 4DYDA 3NFYA 2IL1A 4QUBA 3ILSA 2DH6A 1RRGA 3O8OA 4DDHA 1LK0A 1FCJA 1S01A 1LF0A 3DTNA 3G0CA 3T7AA 3TRKA 1H1LB 1JDBB 1JXMA 3GFQA 3FPSA 3MEQA 3QPWA 4KMMA 1ZPDA 2OPHA 4CLOB 1OLUB 4O2BB 2V03A 1NE7A 2X6QA 3R5HA 1FUYB 1QYRA 2J3LA 2CLDX 3HU2A 4D56A 3LYLA 1VYVA 2BEKA 1FLDA 3L2OB 1CG6A 2BGTA 2C3PA 2JZOA 3PNBA 3VPCA 2IYVA 4BASA 1CUYA 1IN4A 2H9IA 3CNOA 3DBRB 4I50A 5ELXA 1Z0UA 2RAPA 3K6SA 3B13B 2H29A 3TX6A 2J4DA 2EFHB 4NFRA 1CY1A 2Y0PA 3GJ0A 5E4YA 1EFCA 4DEYA 5DTMA 2AR0A 3OLCX 1GZ5A 3RU9A 4ZQHA 3UHJA 2IZ4A 1F3OA 2HKIA 2BC9A 4JXKA 4F3KA 3O83A 1VL8A 1HWYA 4WPGA 1UP7A 2QW0X 1AMOA