1WZNA

Crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
244
Chain Sequence
b'MYELYTLLAEYYDTIYRRRIERVKAEIDFVEEIFKEDAKREVRRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNLKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSKVAEALKPGGVFITDFPCGPVVWNEQKGEEKLVIMDWREVEPAVQKLRFKRLVQILRPNGEVKAFLVDDELNIYTPREVRLLAEKYFEKVKIYGNLKRELSPNDMRYWIVGIAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
molecule tags Transferase
source organism Pyrococcus horikoshii
publication title Crystal Structure of the SAM-dependent methyltransferase from Pyrococcus horikoshii OT3
rcsb
total genus 87
structure length 244
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1wznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1wznA01
2G72A 3SXJA 5HFJA 4RTSA 1G60A 1R6AA 2EG5A 3DMFA 5DM4A 3EEOA 4CKEA 2N47A 1NW8A 2HV9A 2FCAA 1NW3A 3PX2A 1XTPA 5FQNA 3LBYA 1HMYA 1VIDA 3BKWA 3ELDA 1QZZA 3PFGA 5E9QA 4QTUB 4M36A 1WZNA 4KVZA 3LCUA 5C1IA 3FYDA 5BP7A 1KPIA 2B78A 2QRVB 4P7JA 2HR1A 1TW2A 5DX0A 1WY7A 3BWMA 5DRYA 3C0KA 3M4XA 1I9GA 3KQQA 5DRTA 4V0RA 1AF7A 3KU1A 2PY6A 5HIKA 3DP7A 2Z6QA 1L3CA 1NW7A 1KHHA 3K0BA 4O29A 4BP1A 3DULA 1SUSA 2I9KA 2EFJA 4X41A 3TR6A 5FQOA 4IWNA 1R74A 3JWJA 3EVDA 1R00A 3NWBA 4OBWA 2PT9A 4FSXA 1EIZA 3FUWA 5B1SA 3EPPA 5GIPE 3I64A 3LCCA 4POOA 5EIWA 2IH4A 4LWPA 3G5LA 3NMUF 4ER5A 3HCBA 5EMJA 4CWAA 1RI4A 4C06A 3HVHA 4OQDA 3LECA 2IDKA 5DM1A 3FUUA 3G2MA 2G70A 2ZBRA 4FGZA 2PX5A 3G2QA 4OA5A 5E1MA 1QANA 4E31A 3OFKA 3RW9A 2ZCJA 3M6VA 1XCLA 1WXXA 3BGDA 1NKVA 2P40A 4C05A 5FUBA 2KW5A 5K01A 2LD4A 4GC9A 1D2GA 5ERGB 10MHA 5E1OA 3TOSA 2P8JA 4IV0A 5C9ZA 2BR4A 4QTTB 3G89A 3FPEA 1RJFA 3HVJA 3LSTA 4KIFA 3P9IA 3R24A 2BR5A 2ZFUA 4KRGA 4FT2A 2JJQA 4PYQA 4EKIA 3AY0A 4ER6A 2EX4A 1Y8CA 5M5BA 4HH4A 3M6UA 1KYWA 4EQZA 5EIFA 2V7EA 2YVLA 3ELUA 4C08A 3CJRA 2NXJA 5CCXA 3R3HA 3KPYA 2I7CA 2H1RA 5GM2A 3TM4A 2P1DA 3NVMB 3PS9A 3DH0A 4M7RA 4RYLA 5HIJA 2ZIGA 4BLWA 5ICCA 2B2CA 3EMDA 3HTXA 5GINE 3B3GA 4RTNA 2IBTA 3NVKI 1EQAA 2FK7A 4FZVA 4ER3A 2PWYA 2A14A 5KQRA 3VC2A 4RVGA 2JHAA 1H1DA 2BM9A 4GOMD 4PYLA 5CVDA 3KQVA 5KQSA 4HRAA 3GO4A 4QDKA 1O54A 4QPPA 3JWIA 3Q87B 3MTIA 2GS9A 2PXCA 4C07A 2P35A 1EJ6A 1O9HA 1G8AA 1NW6A 2DPMA 2O57A 5F2OA 1JSXA 3A25A 1HNNA 5K0FA 3A7DA 3T0IA 5EMLA 3GCZA 4FR0A 4FS8A 1N2XA 1QAQA 2HNKA 2NYUA 2AOUB 3CVOA 3A7EA 2P3OA 4L7VA 4RSRA 1VLMA 4ISCA 5CVJA 2EJUA 4QQNA 3JWHA 4GQBA 5LQKA 3GJYA 3E23A 1OR8A 3LHDA 3P2IA 1FJXA 3U81A 4DZRA 1YZ3A 3BGVA 4HTFA 1UWVA 1BOOA 2OBFA 1UIRA 1G6Q1 3GRRA 3O4FA 4GOND 1AV6A 4QVKA 2I62A 1ORHA 5GM1A 1NV9A 4KIGA 5EZSA 5FTWA 3SVZA 1JG3A 5CVVA 3EVEA 3O31A 1JTFA 2DULA 3AXSA 1ZG3A 3UJCA 4YUWA 2ZBQA 1ZGAA 3CC8A 2IGTA 3DMHA 2YQZA 3SX0A 1YFJA 3FZGA 5JUWA 2PT6A 5DPMA 3OFJA 5FCDA 2BZGA 4ZTBA 2JG3A 4UOEA 1SQFA 2QE6A 5EG5A 5FHRA 5LQUA 3UJAA 4E2YA 4HGYA 3G7UA 4X1OA 3EVFA 5T6BA 1BKYA 3FRIA 5D1HA 4ATNA 1KYZA 3C6KA 5DTMA 1IM8A 4GF5A 1SG9A 3DLIA 3HCEA 3QV2A 1RJDA 1N7IA 4M37A 4P7KA 2BH2A 4QQKA 4XUEA 5EHGA 1YZHA 1SQGA 5K0LA 4Y2HA 2HTEA 1YF3A 3AWIA 4R8SA 2ESRA 3BZBA 4P7GA 1FP2A 1G55A 5DSTA 5K0NA 1YUBA 5CCBA 1KXZA 3KKZA 1BHJA 3MHTA 3FPGA 2IH2A 2FHPA 1WXWA 5HILA 2HWKA 1NE2A 2YXEA 2ZWAA 4GUAA 4PONA 3DLCA 3HVIA 5EGSA 4PIPA 2OPBA 1NBIA 2GAFA 5FADA 3KQTA 3GRYA 4HTFB 2C7OA 3HNRA 1QYRA 3FPJA 3LBFA 3ORHA 1TPYA 5CM2Z 2PLWA 3LCVB 4X60A 2JHPA 1Z3CA 4U7TB 1X1AA 4YUXA 3ERCA 5EMMA 1M6YA 1L3IA 1P1CA 5DM0A 5DXJA 3TKAA 4AZTA 1JG2A 2B25A 5D1NA 3M33A 3SR4A 2YUIA 2JHCA 2CL5A 2ORED 3FTCA 4WXHA 5P8WA 3O7WA 1JR4A 2GB4A 4RTKA 1U2ZA 4CKCA 1G38A 1NV8A 5ICGA 1DUSA 3EMBA 1JQDA 1INLA 2ZWVA 3IEIA 1X1BA 1RJEA 5LQJA 4MQ4A 3REOA 1PRYA 4YMHA 2ADMA 1RJGA 4RVFA 3TM5A 4MTLA 4PYKA 5IH3A 3UFBA 3UZUA 4YMGA 4PYNA 2F8LA 3C3YA 2XVAA 3ELWA 2UYOA 4FSDA 4IKPA 5FHQA 1YB2A 1XCJA 1XDZA 2BM8A 3SSNA 5FWDA 4M38A 2AN3A 2ZVJA 3GGDA 5K03A 2FPOA 5E2AA 3MERA 1VPTA 3GRUA 3BUSA 4MWZA 5EPEA 4E2ZA 2QYOA 4EMSA 5K0CA 1JQ3A 2PBFA 1VP9A 2YXDA 3FTFA 5JR3A 3G8AA 3TKYA 2VDVE 1WG8A 3CBGA 3HA3A 3FUVA 2IBSA 2UYQA 3NTVA 4AZSA 4AZWA 5KS2A 3B3FA 2BR3A 2ONYA 3UWPA 4DM3A 1FP1D 1EG2A 1G8SA 4GBED 4NECA 2OB1A 3UJDA 4DQ0A 4RTLA 2GH1A 2UYHA 3BXOA 5BXYA 1DL5A 4PYIA 3AXTA 4A6EA 5K8VA 3VYWA 4MHTA 3UJ7A 5K0EA 4E2XA 2PXAA 2VP3A 4PCAA 3V97A 5F2KA 2OKCA 3Q7EA 3THSA 1IXKA 1JG4A 2G8NA 3KR0A 5EC8A 3MAGA 1VL5A 1X1DA 2V74B 2WA1A 2ZSUA 3P9CA 4OQEA 2OZVA 4QVGA 3H2BA 1JSZA 1MJFA 3JWGA 2XYVA 2YR0A 3LL7A 5DTRA 5GP1A 3CCFA 5HIMA 3D2LA 3OE4A 5E1BA 5EEGA 2AVDA 4B17A 4BLVA 3MGGA 4KW7A 1F38A 5GOZA 1R8XA 2E5WA 4G56A 5GWXA 3G2PA 3NDJA 1Q0SA 4A6DA 2O07A 3IYLW 1O9GA 1RI1A 5E9WA 3HP7A 5LR6A 4RTRA 2I6GA 1NBHA 2ZULA 1X19A 3FUTA 1M6EX 4GOOD 1YFLA 5HIIA 3OCJA 5K0GA 4XCXA 5EHIA 5BW5A 9MHTA 4OX9Y 3BWYA 3OU7A 4E70A 5LQNA 3BT7A 3MCTA 1D2CA 4Z2YA 3THRA 5FA5A 5E8JA 5GIOE 3LX6A 2ZZMA 5DLYA 5EOVA 5DSXA 4RTJA 1P91A 2ZIEA 1V39A 3KQMA 4P7FA 4IV8A 5K0JA 2GPYA 3NW9A 3GRZA 3TMAA 3DR5A 3TRKA 4F84A 1PJZA 5HEKA 3A26A 3KR1A 4C04A 2Z6UA 3T7TA 1XDSA 4X61A 3A4TA 4PIMA 2ZIFA 4R6XA 3HVKA 1T43A 1VP3A 3KHKA 1X1CA 1IY9A 3LKZA 2AOUA 4PYMA 4BY9E 1JQEA 1SVUA 4QPNA 3HCCA 4ER7A 4CTKA 3EGVA 3R6TA 2FRXA 3FPHA 5CVEA 3B89A 4CKBA 2HMYB 2AOVA 3HA7A 3E8SA 5T64A 4KDRA 3TFWA 3G5TA 3UJBA 3DXYA 3KPVA 3M6WA 4CXMA 3VSEA 5C0OE 3T7SA 3LDUA 4MIKA 2AZTA 1FPQA 3GXOA 3LPMA 3NWEA 3S68A 2YTZA 3KQWA 5LSAA 1XDUA 3P8ZA 3GRVA 1P39A 3MB5A 3OE5A 4DMGA 1JTEA 2Y1XA 2ZZNA 2O05A 4HSGA 3KQSA 2CWWA 4YUZA 4DCMA 1N7JA 1AQIA 2P7HA 1VE3A 2NP7A 4F85A 4C03A 3NJRA 5U4XA 4R6WA 1FBNA 2NXCA 3MQ2A 3I5UA 4R05A 3KPWA 3E05A 3EEYA 5DTQA 4GOLD 5ICEA 3SSMA 3OU6A 3PVCA 3EVAA 3UA4A 4AZVA 5KVAA 1EJ0A 5KYGA 5LQRA 3B5IA 4LECA 3QOXA 4KWCA 1ZGJA 1XVAA 3PB3A 2AS0A 4F86A 2H11A 3G2OA 4RTOA 5EZQA 3DUWA 3DXXA 5EQJB 5CVUA 3GIWA 4E30A 2XYRA 1NT2A 2OXTA 2B3TA 3GNLA 3P9KA 3FRHA 1UFKA 3I53A 5T67A 5LQAA 2O0LA 4BP3A 1ZKDA 5MHTA 4PINA 5K09A 1XJ5A 3UJ6A 4CTJA 5E8RA 2VDUE 3EGIA 3OZSA 5F2NA 4U7PB 1SKMA 2IFTA 2CKDA 2NP6A 4QDJA 3OZTA 3P71T 3QOWA 4PYJA 2C7RA 2AOTA 2AR0A 3R0QA 2PWPA 4H0NA 3C6MA 1XXLA 3F4KA 3KPUA 3P2KA 1I1NA 4RVDA 4RV9A 5EVJA 3UBTA 4HGZA 4C4AA 3L8DA 3CJTA 2VDWA 1R8YA 4AUKA 5K0BA 2WA2A 3LDFA 3AJDA 3PFHA 5DXAA 4E2WA 5BW4A 5FWAA 4PNEA 4OBXA 5LQCA 1KR5A 2ZW9A 3BWCA 4XUCA 5ICFA 2IIPA 4LWOA 2JH9A 4PWYA 1JG1A 3RIEA 2PSSA 1NW5A 3FTEA 3ER8A 1L9KA 3HCAA 2JH8A 4AX8A 2O06A 3SM3A 4DCGA 4RTQA 4R8RA 4HG2A 1KIAA 4YV1A 2ZBPA 3BGIA 4X63A 2QM3A 3HA5A 4RTPA 4RVHA 2K4MA 3M6XA 3P9NA 3I58A 2AN5A 5K05A 3P97A 1ZHFA 2PX2A 3UJ9A 5E1DA 5E2BA 3OZRA 3LKDA 3TLJA 3DXZA 2P7IA 2AOTB 4JXJA 3HEMA 3C3PA 3A27A 3X0DA 5EEHA 2C7PA 2C7QA 2R3SA 3KR2A 4PGGA 5FULA 3MTEA 2PJDA 1P1BA 2VZ9A 2P41A 3TPZA 4GEKA 4E32A 2IH5A 3KPJA 3EVCA 3FTDA 2G71A 3SSOA 1I4WA 1KP9A 2FYTA 2PGXA 2XVMA 3GDHA 4Y30A 4LG1A 5EMKA 3CJQA 1D2HA 1VQ1A 1RI2A 2PX8A 3KQPA 3TQSA 3G88A 5HOQA 4DF3A 3G8BA 2Y1WA 3ER9A 4DA4A 1QAOA 2OB2A 4RWZA 2PX4A 2NXNA 1KPHA 4ER0A 1B42A 3KQYA 2OYRA 1BC5A 1R18A 4YUVA 3SMQA 1L1EA 3PX3A 2P3LA 4BLUA 4RTMA 3UJ8A 3CKKA 3HM2A 1VBFA 3WSTA 2AN4A 2WK1A 3ELYA 3HCFA 4V0QA 1F3LA 3VC1A 5IKMA 3HCDA 4RX1A 3PTAA 2G1PA 4OA8A 1Q0TA 2ZLBA 3M70A 4YV0A 3LDGA 2ZZKA 3I9FA 3P2EA 5DX8A 1TW3A 3E7PA 2VS1A 2XBMA 1RI3A 2QRVA 2YX1A 3PT9A 4P58A 3RODA 3BWBA 2GLUA 8MHTA 4EKGA 2R6ZA 2PKWA 3CGGA 3DOUA 4PGHA 4WVLA 5CUQA 4EK9A 2OO3A 4GC5A 5FA8A 2PXXA 4FP9A 1M0EA 3FUXA 2ZTHA 3BKXA 2IP2A 2PVCA 2H00A 3B7PA 5G02A 3R9XB 1L3BA 1RI5A 4E33A 1DCTA 3KQOA 7MHTA 5EKUA 3NDIA 3ANXA 2B9EA 3ID6C 3B3JA 5DM2A 5EKXA 5H02A 2CMGA 2UZ4A 5DWQA 3KR9A 4FT4A 3V8VA 3LGAA 4K6MA 2QY6A 1MHTA 2IPXA 2XYQA 3IV6A 4PYOA 1ORIA 2AOWA 4YV2A 1SUIA 3OPNA 3FPFA 2FK8A 1KPGA 2IDJA 1EAMA 2PV0A 3OU2A 4PCLA 2UYCA 2CMHA 2AOXA 5HZMA 3DTNA 5CD1A 4DKJA 5CIYA 1ZQ9A 2NXEA 3EVBA 4YUYA 3PLAE 2P3QA 2ONZA 4EVIA 5DX1A 3MCZA 3EGEA 3ME5A 2EJTA 3EVGA 1QAMA 2NNWB 1WS6A 3IHTA 3UA3A 5DT2A 2OY0A 2GA9A 3FYCA 4XUDA 2Q41A 3DMGA 3EVZA 4KDCA 3T7RA 3SGLA 2AVNA 1AQJA 5E9JA 3K6RA 3GWZA 2ERCA 2YXLA 4HC4A 2Z6AA 3GU3A
chains in the Genus database with same CATH superfamily
3I6ZA 3KVRA 2P0EA 5F7XA 3V2IA 3HCRA 5AOVA 4ZVQA 3KEMA 3ZLJA 4LRTB 1VQ81 3C16C 3GCWA 4RSGA 5TT1A 1NW8A 3QTBA 3FFAA 4HTAA 5C37A 1JJ7A 5IJWA 2VHYA 1ACLA 2Y0DA 2QV7A 3X1WA 4DUGD 1ODSA 1DKPA 1XDDA 1EQ2A 5DX0A 3RSHA 2VRBA 2OL4A 2L42A 1NBME 3KQQA 4ETMA 2OZLB 4HFMA 2J9XB 3HDQA 1AF7A 3E0XA 3R41A 3QVSA 4PAGA 2J5XA 2RG7A 4BTVA 3V3TA 5B30A 5KWIA 5MF6A 2P9QA 1ZKMA 5DWDA 1U7DA 3EY9A 1W36B 1UPXA 1U8YA 3N8NA 4NPAA 8AT1A 3HKZA 4HZUA 4FXPA 4UHCA 5BPHA 4MH4A 3AVPA 3BXPA 3EZNA 3L9WA 3L4JA 4DQYB 4NBHA 1U5BB 4K7JA 4JKIA 3CF6R 2V45A 3HUTA 2DPGA 3EWSA 3QKTA 1XXHA 3SFZA 4Y1EA 3NMUF 4OI1A 3SX4A 2Q0XA 2IEBA 1RFLA 2Q0HA 3LVRE 5DIFA 1UADA 3HSYA 5DYYA 1QV6A 4PPGA 3V42A 1KYVA 5LQMA 1Y1SA 1BMQA 3T9CA 4R2KA 3VA7A 1VKOA 2JLAA 1C7QA 5AOCA 3T3NA 3ROFA 4PEVA 3BE6A 4NCBA 2F48A 421PA 3E9QA 3REGA 4KREA 1F0NA 2XKBA 2Q6VA 3ASUA 2OECA 3QU9A 5TJHA 2PH3A 2Q50A 1FSGA 5JXJA 1JFTA 2LD4A 4TROA 1SOUA 10MHA 1XD8A 3BE5A 1FMFA 1F14A 3TVTA 3VC3A 4CTNA 4N3BA 3U7JA 1QQBA 1H0RA 2OSBA 4DZZA 1D9ZA 2HQSA 4BAUA 2BR5A 2I3GA 5JO9A 2C2XA 2NTEA 4HKTA 4ZC8A 5AHRA 3VH1A 3QEAZ 2D1SA 2PGOA 4IEFB 4UFNA 1A9SA 1Z33A 3GAZA 3NU1A 1ZA2A 2Z2JA 4UVGA 1HQCA 1L4LA 1WP9A 4XLLA 1HE8B 5EI5A 4WZBA 3RI3A 2FWNA 3WLLA 4EF6A 2DR3A 1DMSA 2AYYA 3GZTB 3IX0A 1MQ8B 3CE9A 4ZA2A 2XUGA 3CFYA 3TJRA 3FB1A 1K7XB 3WG9A 4F11A 1ISFA 5KOJA 4BNDA 2BZSA 4IX9A 3HTXA 2IBTA 1PNRA 5JMOA 2FK7A 4FZVA 1HDCA 2R5FA 4G1CA 2A14A 2ZGVA 2GFIA 2A5DA 2AI1A 4LRQA 3M89A 3A6EA 1Y4ZA 4H15A 1YRAA 5NULA 4Z9BA 4A0GA 3VDRA 2WPDA 3EAFA 2HMAA 4Q1AA 4BO9A 1P1RA 4UPEA 2AC7A 2FXIA 4JBGA 4PZAA 1A9XA 3UYLA 2FJ0A 1ISHA 2DUMA 5K5EA 1CUWA 2JA1A 2VXCA 3HB7A 3M9WA 2Z1DA 2NT3A 5ITSA 2Z2KA 2YL2A 2ZRJA 4OLJA 3U3XA 4Q4HB 4GQBA 3VI3B 4RD0A 3MBIA 3P2IA 4HADA 4PBTA 2JVJA 3HN2A 1F1JA 2R1TA 3ANNA 1GPYA 5C4MA 2ISSD 2F2TA 1DFHA 2GM5A 4GOND 2ENWA 1OT3A 3AUKA 3V80A 4DVJA 1ORHA 4IRMA 1J8YF 1PGJA 1TT5B 1IBRA 2GPTA 2BHSA 3P52A 1M67A 2H3HA 3J81f 4LRYA 4M9UA 1GTMA 3TG8A 1AU9A 2QI9F 2CVHA 1OX4B 3UUGA 3MBOA 3CPWY 1IPFA 2DFKB 1ONNA 3PD1A 4QRDA 2X9NA 4B4KA 4ZOAA 3G2IA 4KQXA 5BN1A 3LQYA 3EWIA 4M8SA 4AYBA 2WY2D 1SQFA 3FCSB 4FNGA 1V3VA 2FWBA 2IE8A 3WNDA 1E1LA 1UKZA 2VNHA 4KE9A 1ZIDA 4JT2A 1L4BA 1M1UA 3NZEA 5ARBA 2YYSA 1H2FA 4RM3A 4HLUC 4YCCA 1OB2A 4RL6A 1TCVA 1QDUA 1U94A 2A78A 2VZ8A 4C22A 1HE5A 3QKWA 5JIBA 1QNLA 1X7GA 3VNBA 3VUFA 3BZBA 1P3DA 3OLYA 1YUBA 1NHWA 1ZZGA 2G09A 2FVYA 2VHTA 2VQ6A 4M8LA 4Q3DA 3RUDA 3O6VA 4YXFA 2INGX 4ZVLA 4XWOA 4C2TA 3AGQA 5LL6f 3VPAA 4MWOA 1W2BZ 2D2XA 4HF7A 3D1JA 1PN3A 4B5KA 4DA7A 4F3NA 1ODFA 4D9FA 1GTG1 4IIUA 1QYIA 4LJRA 5G4KB 1NBIA 4YCSA 4B3XA 5KYXB 4FOLA 3M6FA 2VCYA 1LFDB 1RRPA 3RHFA 1IQRA 3HJUA 5A2QA 4AO8A 4YAUA 1DOAA 1VQL1 4R3NA 3F7OA 3EDMA 1ZMTA 2V4MA 4PN3A 3RFXA 5DM0A 4R9NA 2ZBDA 2IU6A 1K7SN 3E8XA 3PNKA 4L5JA 5DI9A 4CKYA 5JH7A 5J2TA 4V2UA 2XDWA 1Z62A 2WUWE 1FDSA 5AXDA 3VKGA 3CN7A 4IKOA 2WM8A 1WW9A 1W0CA 3M1AA 5CLIA 4Z0NA 1TQ2A 1UDCA 4LDZA 1MO4A 3S8MA 3NM4A 3O8OA 4K1LA 1MB4A 4BFZA 1ZC3A 3CX4A 4PO9A 5IYZF 1FB5A 2XV1A 1GGKA 4MPJA 3T1OA 4YMHA 4G1VA 5C8YF 3V8EA 4M7OA 2BP7B 2DUWA 1TEVA 4K9PA 1QHYA 4KVGA 2G5PA 2BFEA 2WV7A 3F90A 2K5UA 3IDSA 3ELWA 3QZUA 2HF9A 5ALIA 4A23A 5JBIA 1O1YA 1YB2A 5KCZA 2TRSB 4G85A 5JXIA 2WPNA 3W9BA 2ZVJA 5TGTA 5CFRA 3EY4A 4HNGA 4Z2AA 4E1VA 2ZTLA 2FGJA 1GCGA 2W6JD 4XQCA 2MOKA 3TLGB 2KPIA 3P0EA 2J3HA 1V3QE 5FLYA 4U00A 5E4YA 1RXYA 2BL4A 4YUAA 1S6YA 1DJQA 4KQMA 5IUJC 5I8WA 1M73E 2REOA 4OAOA 3LL4A 5SYMA 2RAVA 4P0QB 5KS2A 3B85A 3EGOA 4BAGA 4YEDA 4F6LA 1N5JA 2WHPA 4F4DA 4XSVA 1W48A 3FBGA 4DM3A 1FP1D 2GKSA 3FPAA 4GM1A 4KNVA 1RO2A 3FFBA 3TIIA 2KX7A 2IY7A 4Q48A 4D56A 1HNXB 2XBUA 3E1GA 3QYFA 3ENQA 2GEJA 2RCYA 1Y3FE 3IUPA 1JPJA 3ICOA 1MT3A 3NPAA 4DIOA 4G6ZA 1K8ZB 2C7VA 1XFAA 1JSZA 1U4SA 4P7BA 3VH3A 5AJZA 2E87A 3COVA 3KZKA 1ID1A 2SCUB 1OI2A 1RO0A 4PE5B 1QRUA 3E70C 4KLZA 1U2RA 2PKYX 3L4BA 1CJKC 2PJUA 5F73A 4BZXA 2B8JA 2ZSBA 2XMBA 3NVAA 2H29A 1QGYA 3BYZA 1XJQA 3WLAA 4AO6A 3PQ6A 3ZE9A 1IVSA 1M34A 2KB0A 3IYLW 2HA3A 5C32A 2ZULA 1EUCB 4L15A 4P5PA 4WUTA 5B7NA 4AURA 5U9CA 2IPMA 3DMRA 4W5RA 2HUNA 1A5BB 3AVOA 4ZOLF 5EIOA 3HNOA 3IODA 5BUQA 1ZI9A 4CODB 1V8OA 4QJBA 2FRDC 3R1IA 5M29A 4NFSA 3K31A 1JI3A 5D5HA 5D5PA 3M82A 1AO3A 1E2UA 1IN6A 1NN0A 1H6BA 1YZYA 2W6PA 1VQ41 2F64A 2W6JA 3ITNA 3KQMA 5AW5A 3WZ2A 1PWXA 2QTHA 2V7BA 1G21A 1L4YA 1R4MB 3A26A 5B6PA 1ADJA 3TLGA 2GTPA 1ML3A 4KGXA 1YIOA 1YE8A 3BJZA 1KMHA 3JYOA 4PIMA 1SELA 1X39A 3Q12A 3ZWCA 5JRZA 2H8GA 4C4TA 1T2UA 4QBKA 4B79A 3DE1X 3EPLA 2AD1A 3GLIE 3IJPA 4WY8A 4D4GA 1OLXA 4BMCA 1MO2A 1ESEA 1ZH8A 4QUGA 4BLRA 4YRQA 2R96A 3IBSA 4Q19A 2FRXA 2C3MA 2P62A 4NEQA 2WHEA 3VQTA 4ME6A 3RVOA 3E8SA 1OKKA 1XL1A 2X6TA 4DSNA 1G8MA 2HBYA 2XB9A 3JXEA 1GNQA 1PG0A 4NFRA 4RO0A 2XTMA 3UFXB 2D5IA 3GCDA 4EB0A 4DHWA 2Z08A 5EIBD 3VR6D 1OXVA 2E5FA 2VT3A 3ILXA 1R27A 1DMRA 1WUYA 2PSDA 1N7GA 4QYSA 3E9ZA 2IYPA 4MUIA 3CN9A 5U4XA 4OBEA 2OK7A 2HHAA 2X0JA 1CZKA 1N5OX 5EZ5A 3W9SA 3ETGA 3IE1A 2GF0A 3ZU5A 3I2FA 1Z8DA 16PKA 1J09A 1DTEA 2IL1A 4CMKA 4DXHA 3U09A 4YCNA 2IYLD 3B7GA 3TIVA 2FWAA 2C2WA 4GR9A 1L9XA 2BOVA 3TB6A 2A94A 3E2MA 4I1OA 3WB9A 4BFLA 2B63I 2GN8A 3QVXA 3AR4A 4IOKA 5DHAA 4EGFA 3DOIA 1KRWA 5IEJA 1JL3A 2X0RA 1DHTA 1WB6A 2WQ6A 1XZKA 1WUTA 2QSUA 3FDZA 4MINA 1E63A 1DBSA 1XEAA 4URFA 4BTLA 3PUHA 2AS0A 2XNDD 1HEIA 1LVHA 3B6ZA 5F4ZA 3WLRA 2H0QA 3DONA 5JSQA 1PSDA 2YICA 3DXXA 2C7GA 2OXTA 4K9KA 4Y7DA 1W4AA 1DARA 2PJZA 3P4XA 5EZ6B 3TGPA 3WI7A 4IYJA 1KSJA 4Q34A 2I33A 5AKIA 1U0OC 4QXRA 1ADBA 4BVGA 1ZOIA 1Z8HA 1L8AA 4NICA 3DVRX 3P4UA 2CKDA 2GN6A 5EPOA 3VKUA 5JT1A 1K3TA 1HNZB 1EUQA 2NP6A 1YVRA 4R2JA 3S1SA 4KODA 1MEOA 2Q3BA 2XUKA 2CFIA 4RV9A 5KSZA 1Z29A 3S29A 5EVJA 4LHZA 3WLTA 3TIFA 4BO5A 1QC5B 4X7PA 2C2GA 4AUKA 3E15A 3X3HA 4E2WA 1E3QA 3N8KA 3E5NA 2DC1A 3NOVA 2E4WA 4MP3A 4OXXA 4IGIA 4UULA 1YRBA 4GW3A 4LGYA 4JNKA 5EN4A 5FO0A 3RAPR 1FYFA 4LWOA 5FWXB 1HL3A 4PWYA 4Y0NA 3PKJA 4V24A 1PL0A 5IKXA 5TR9A 5B12A 3JYLA 1R8JA 1CUIA 2GVZC 2JGNA 3THOA 1E20A 1EEHA 1T2AA 3A6LA 4NVRA 4RTQA 4YV1A 2J9GA 1WEHA 4X1IB 4NB8A 2GARA 2QLTA 2P3SA 4JU8A 2XUFA 4NOKA 2R4TA 4P5DA 3EPRA 3NHUA 4QGGA 1T4GA 3G0OA 1R2QA 4YAFA 3F0TA 4HLDA 3WWDA 1Z2OX 4BKOA 1NW4A 5ILGA 5AJTA 1ZHFA 3OX2A 4A0RA 1RXIA 2O1SA 1P9NA 1L5HB 1PQWA 3V8BA 4B43A 5JW6A 1V2HE 3CVVA 1TA4A 2WFMA 2QORA 3LQ4A 4BLOA 3DHYA 3QENA 1TJYA 1L6RA 2AOTB 2BFBA 2NWQA 4GMFA 4ZOEA 5A05A 5IVIA 3CUEF 1G18A 3O03A 2C7QA 3PC2A 3EEDA 1B76A 3PHIA 4H7FA 1NZDA 2ACEA 2AJTA 4OQQA 2IH5A 1YJ8A 3PU6A 4B4OA 2VDPB 3EDOA 1TLTA 3IAS6 3PXEA 5AW9A 3CURA 1OZHA 3FLEA 1VYUA 5A6VA 2B3DA 1JECA 5AK6A 1PZXA 2I4RA 5B1DA 4BNFA 1W94A 2VTKA 1J7KA 1E4YA 2H1CA 3G88A 4IUYA 3U40A 4BB0A 2VPPA 4CMBA 2QMHA 3RSCA 5JS8A 1QAOA 2JKZA 3CH5A 3WNQA 5ICMA 4M1MA 3EFOA 2O0MA 4RZUA 1W0KD 1E2QA 3MQ4A 4E5MA 2YJ3A 3DMNA 3FW1A 3ECSA 3DZHA 4YGYA 4JCOA 2W2LD 3WHKA 4MV3A 1RABA 4Q4JA 5T4HA 3A1SA 5IKPA 3NETA 4WGGA 1H6AA 2P6MA 4OA8A 1DLJA 4Z7OB 4DGLA 4GDMA 4UDXX 1CZRA 1N3LA 1B26A 3T61A 1T1RA 4G63A 5JCOA 2EJWA 2R62A 4ZVKA 4EEXA 4Z4FA 1TAQA 2Z3VA 2QRVA 2NVTI 5WRFA 3TRDA 5E6UA 2GXSA 3PJFA 4NU8X 4ZCSA 1Z06A 2CHVA 2G08A 3ZVRA 4W1PA 4QU0A 5DN9A 2YIJA 1KJ9A 1R9NA 1ZNZA 2C99A 3OURA 3VYVA 1JR6A 1O94A 3LY5A 3CVJA 2HJ9A 3LRTA 4KOEC 13PKA 3QXGA 5FNVF 1G5TA 1GCIA 4CG1A 5AM1A 3ZXUB 4DSTA 3PA8A 4V38A 1TKBA 2CMGA 4G0UA 1VPLA 1L7AA 2CUKA 4IJUA 5JZOA 5I7EA 1U8XX 2OTLZ 3T3MB 1M1NB 5KNBD 2YKGA 3JD1A 4YV2A 2OCLA 1LDMA 4D41A 3IUMA 3S1QI 1JP7A 2PV0A 1JHAA 1T2EA 3OU2A 3L82B 2X15A 4C14A 1TM4E 4CN8A 4ZYUA 2QEXZ 4G0WA 3IEVA 1GTL1 1KQSY 5HZMA 1J8VA 2J31A 3ZWPA 2UU9B 3TTWA 1ZQ9A 3MLEA 2JVKA 4REQA 4C4RA 2P3QA 2IEYA 4LWZA 5DX1A 5EIAA 5KTKA 3M81A 4A3CI 1IEVA 1NVGA 2YRWA 1CHNA 1P4HA 2HPAA 1JB1A 2VUMI 1JAZA 1QYXA 4WCDA 4BQFA 3CLRD 4UNSA 3ZJUA 1L5MA 1IWPB 1REQA 5C7LO 2CJPA 2B4RO 2G36A 2Q6TA 4ZXPA 1EX9A 3S1MI 4GI7A 2JFZA 2Y27A 2WP8J 1FSFA 1EK1A 1NLMA 1T4MA 5CH5A 4EY8A 1Z6XA 3OY2A 4RIFA 2H1SA 4HC4A 3V8NA 2F1KA 2IBMA 2G72A 2ZSEA 3GU3A 4N8EA 3VSAA 4CT4B 3ZZMA 1RFGE 2LGJA 1NF9A 4R2MA 3UJHA 4P4LA 1D1TA 3WXBA 4QJIA 3NT4A 3QITA 4RK6A 4N39A 2EFHB 2V7TA 1V5WA 5KCMA 4FIDA 3IILA 4QWMA 3UMRA 1WZNA 2VHJA 3FHCB 5JSKA 3PT5A 2EARA 1MAUA 1DEXA 1N2HA 5DYNA 1CY7A 3BWMA 3IMKA 2VATA 4JB8A 4RLQA 4G4GA 1YZUA 4FDLA 4NDAA 3U80A 1ST2A 2MDTA 2Z6QA 1PR6A 4BVBA 4MW9A 5BMVB 4O29A 1SVIA 3QVWA 5C80A 5JBQA 4A93I 1BU8A 1KBQA 1VHWA 3OLWA 5FDFA 4JXKA 3IV7A 1N25A 5CDYA 2C78A 2XODA 3RHZA 5J4YA 4OBWA 1OI7A 1DVRA 1VI6A 3QVGA 3ST7A 2B1GA 4B85A 3GLKA 2QZZA 4IDNA 4EH1A 2J3MA 4O8CA 4LWPA 2Z6VA 3LPDA 1PHPA 2QM0A 1CNMA 4KTVE 4MWBA 4E5PA 2Y71A 1RI4A 1RQXA 2HWUA 4GBGA 1FMLA 5DM1A 2P9JA 3JQRA 3W6UA 2WICA 2J0VA 2RHBA 4LBVA 1TVCA 1VL0A 4ARAA 5JS7A 4MCIA 2ZIXA 1TIBA 2ZWPA 3VR2D 4A3BI 1SAYA 1KMNA 1JDSA 3L41A 3N8HA 3PEFA 4PRKA 5H0IA 1VCIA 4EHJA 2C8VA 5E9AA 1T8PA 1K9M1 2YADA 1VHLA 3TNLA 2J9FB 4XYLA 4HNSA 1YASA 2G9VA 5I7HA 1BJTA 3NFRA 1AMOA 1VBKA 4TZKA 5CA1F 2BR4A 2EKLA 2CJWB 3E7DA 5CK4A 2LCFA 1F8UA 4R1LA 1ZOLA 4N7MA 5IABA 1NM5C 1IZ0A 3U3ZA 3U5TA 4KRGA 1TM1E 4ZMSA 3QKIA 1NURA 2EX4A 1BX1A 4CQLA 3AI1A 1P3Y1 4D81A 3S16I 1SKQA 2YIDA 3FY4A 1KYWA 1C7RA 4RETA 5HKLA 1IUNA 3KWJA 3TW8A 3QFHA 1YK1A 1JFFA 4X7BA 3KRTA 2ZXEA 2DSTA 1AHNA 3F5MA 3PV0A 4RYLA 2F9FA 2DTEA 4PZPA 4RVCA 4J3NA 3SLRA 1YS1X 3PXXA 3RU3A 1GEGA 1N5MA 5HRAA 1ONPA 4FFBA 4D9GA 4EUEA 3NVKI 3HR8A 1LX6A 5HA5A 1EESA 1E7MA 4RVGA 2H8KA 2R2GA 3PR2B 4HV4A 3LWDA 4J9UE 5BSKA 1XE3A 3CZRA 4QTZA 2BZ1A 2PUWA 4HRAA 3I3OA 4ALMA 5KQSA 2IYVA 4GGOA 4QDKA 1CF9A 2J3DA 3U49A 3Q87B 4FB4A 1XROA 2FRVA 3R76A 1GR0A 4F5EA 3WAGA 1EJ6A 2L0XA 1G7RA 3ESZA 3O8BA 1FFXB 2OCPA 4JLJA 2XKAA 3PUKA 5IT0A 1QHHB 4AMVA 1DUIA 1N2XA 1H42A 4G89A 3QOFA 3LP6A 4F3YA 1AV7A 3GLHE 5EE0A 4N6GA 3T6KA 3V4ZA 2XT9A 2JIRA 3LBAA 2Y1GA 4BDTA 4FPXA 1A95A 3MWEA 4P31A 1FXUA 2BMFA 1QVAA 1BD3A 2RH9B 3PIDA 1SC9A 1AKEA 3N75A 4LYDA 1IHYA 2D7DA 1UOOA 4BP8A 2GZSA 3A1UA 1P7WA 2ZE7A 1XZNA 4R68A 1WETA 1JWHC 2BM0A 4J2HA 4IYRA 4XH9B 1WMEA 3KD3A 1X0VA 2CFRA 3LX5A 3PFIA 2OWEA 1JB9A 1NF3A 2X7JA 4G9GA 4N12A 4RHEA 4DIMA 1RHMA 5AN9F 5EZYA 4MKXA 3RVPA 5B3JA 4YMLA 4D92A 5COBA 3RRJA 1S02A 4GPEA 4DRXA 3LFTA 2ZM5A 2R93I 3ND5A 3Q98A 5IVHA 5JQGB 3EIUA 4AYTA 2IEIA 4YMVA 1Z47A 1YUAA 3JAKA 4UNQA 3DFZA 1GU7A 3X43A 5BRAA 3LQKA 5DTMA 4GF5A 4QUDA 2FSPA 1QVGZ 2KI7B 2BH2A 2GHIA 4C89A 3N2IA 1G0OA 3TFWA 5ES3A 1ESZA 2ZS8A 4Q4LA 2FOLA 3IA7A 4GLOA 3U48A 4HDKB 1J9GA 4I9FA 4NJEA 4X20A 5FBKA 4A2PA 2XADA 3QKRB 1JHPA 1NQ5A 1Z9BA 2OSVA 3CO0S 3FPGA 1V45E 2X23A 3GAMA 1WMBA 3N7TA 4JX8A 5EL0A 1IBCA 3SQMA 1SY7A 2AFHA 4H0CA 4E1AA 5H9WA 4B4WA 2FPLA 2FUNB 2XQIA 3RGWS 1T2CA 3V9PA 4NH4A 1GNLA 4LRWA 4WASA 3U5ZB 4CF3A 2QENA 2PD3A 1JYSA 3R5HA 1LF5A 3S3TA 4HLQB 2PLWA 3NT2A 2KHZA 1NNLA 1C1XB 4BE4A 4YUXA 3UEOA 4MZXA 1HRDA 1C80A 1M2JA 4JDUA 1PZMA 1QIMA 3O4VA 3C6YA 2B25A 5B58T 5LMZA 1B0ZA 1VBNA 1ZK4A 1C30B 2Q9AA 3ZNQA 4Y2UA 1YBMA 3ZGVA 2Q2WA 4EA8A 4UM5A 5ALHA 3H8SA 2FX5A 1J5PA 1JR4A 3GNSA 4NCIA 5DK4A 1PT7A 3CTMA 4LCEA 3GHYA 1IN1A 3CNLA 3IEIA 2GFHA 4N0EA 4KMOA 2RAFA 2W11A 3MVEA 4RY8A 3O4GA 3WK6A 4AAYA 1JR2A 4MWDA 5IDYA 3FWKA 2CNKA 2RK4A 4DC9A 4CF6A 4LPSA 1VA5A 3K0AA 2WSSA 2OYSA 1CQJA 1XCJA 5HCNA 1GZDA 4CIWA 3FKJA 4GZ5A 3RVMA 5HPYB 2WNIA 4Y9SA 1JDJA 4ZYWA 2ZYTX 5KJ6A 1NVEA 2ZI7A 2Q7OE 1I3CA 4D3ZA 3LXUX 4U7WA 5IS2A 1YNOA 2WF7A 2BGMA 3SBOA 3KB8A 4M6WB 3IRVA 4FLMA 3DWGA 4NZPA 3K30A 3T4UA 3HOWI 1PEYA 1SC6A 1AXGA 3AZOA 3CBGA 1ZC4A 3GZ4A 4R1NA 2JJ8A 4FDTA 1NJ1A 4QHYA 4WXMA 1V1RA 2BCJQ 4WFKA 4MGIR 2W6ID 1Q812 2NUPB 1IN4A 3GPLA 5BORA 2QJFA 5AW3A 3KDAA 4BCCA 3AF6A 4MW7A 3TAXA 5IHPA 4PYIA 3OCUA 3EZXA 3IVCA 4P4SA 1O7JA 2Z04A 1I2ZA 3EBPA 3M8KA 3PNMA 4PCAA 3IUJA 1OV4A 3A37A 5F2KA 3KE8A 3K9FC 3FRJA 3VNAA 4NMLA 4HMQA 3TO5A 1I4OA 1A8PA 2JGJA 5EWLB 4I50A 4OD0A 1KZ9A 1QWSA 2LPMA 5KVCA 2HSEA 4QM7A 1LQLA 5JADA 3CCFA 1HE4A 2BKAA 2FE1A 1RXEA 1YVPA 2B82A 4JASB 1ZUHA 1V5FA 2BTOA 5ALRA 3AVTA 1A9YA 4X7RA 4B17A 1NMZA 5L3SB 3MGAA 2B0CA 2QX7A 1VOTA 1L8QA 1Z6ZA 2CD9A 3QH4A 3PEVA 1RYYA 5D87A 4HZUB 2JAQA 2IW1A 5D3QA 2JFPA 1O94D 1PFTA 1SOWA 5C3EI 4HAIA 4RKEA 1OPRA 3A9RA 3EB9A 1KMMA 5C52B 5L95A 5LDHA 1KIFA 1MB0A 2HFJA 4B74A 1CF4A 3JAWB 4Z99A 2DETA 3DL2A 4B6SA 1ILWA 3H2ZA 3DNMA 1SD1A 4QULA 2JNWA 3CR7A 5AJUA 3H99A 1O6FA 2HSJA 3CEHA 1P91A 3OLCX 3R5KA 1A7JA 2GPYA 3WB1A 2JFFA 3JD2A 1G7CA 1C50A 2BI7A 3GEGA 2I7TA 4PC2A 1EP9A 3ILYA 4JZKA 2EF1A 2GK3A 1TKAA 2F67A 5KBYA 3H2KA 4N40A 1PJAA 4M1SA 4OL0A 3F4LA 4CIXA 1DHRA 2D1YA 1NVKA 1MW9X 1E2FA 2NVWA 3FR8A 4V1CB 4OYHA 3FPHA 1ECFA 4BEJA 1QHFA 2QUIA 4YJHA 5BR7A 3UUWA 3T5PA 1EUDA 5JFGA 4ZO8A 2ZIAA 3ZDBA 1U1GA 5C0OE 5BN4B 4F6RA 4X1YA 2A84A 3N2NA 4AF6A 2F1JA 1LLCA 3KQWA 4CL8A 4LN1A 1P4JA 4GI2A 2GYVA 3ICEA 3KOMA 2OM6A 3N59A 4UQOA 2NP7A 3LOPA 2JIMA 4GAEA 3V1NA 1ZITA 3FOFC 1KO5A 3NJRA 2QVZX 4Y2QA 8OHMA 4BUCA 5KKAA 4D8UA 1WRBA 1GNTA 2FSVA 2R751 3LUKA 4HNHA 5CT5A 3I5UA 1QLWA 5TQVA 4KRFA 1I1QB 4P53A 5GTDA 1S3GA 5DM70 4H7IA 3OZCA 4CVNA 1DQPA 1VG0B 3L2OB 2I6QA 2H54A 4NHEA 3ZK7A 5AJHA 4NBUA 4NBNA 1GDDA 4NY1A 4WNAA 5KYGA 4EB6A 2IK8A 3AT1A 1BSVA 1WIIA 4FDVA 1M1YB 2WMNB 1TPZA 3AF0A 4ZT2A 3C4QA 3EH2A 4IQ8A 4RTOA 5LB2A 3MMXA 3WRVA 1U0LA 2QRUA 4PZUA 4E30A 1UCFA 4TNUA 3NVDA 5F7JA 2XTZA 3MM4A 3N0VA 1M72A 2ZRCA 1IZZA 5LZ9A 4O4IF 4YIHA 5KYNA 5I9BA 1XLVA 3EOZA 1DRWA 5D3KA 3T1QA 4F5YA 2W48A 2ET6A 2QL7A 1IEQA 1RLMA 4DNOA 2HQ1A 2B8TA 1OGIA 2Q4OA 1XP5A 2IEGA 4PZZA 3RTGA 5KNDH 3KHSA 4RPJA 1Z5PA 1BTOA 3DG9A 4HGRA 2FE4A 2YY7A 1BU5A 3L7AA 2P77A 4OFWA 5EXDA 4GHWA 5AVRA 5EA2A 3EUAA 5K0BA 1TMYA 4Z5XA 3CPJB 3LDFA 3OFNA 1H5UA 1I3OA 1GSHA 2GSDA 2HHLA 2XDAA 2ZW9A 1ZGCA 2WUFA 3QUBA 4GH5A 1KAEA 4KQ1A 1YI21 2AI3A 2HUPA 3PXAA 1X1QA 4KH1A 4W5JA 3MCWA 3D8UA 4DJDC 5K8CA 1RQ7A 3T9AA 2O52A 1K83I 4C7KA 3PGKA 2ZQ5A 1FTGA 3EIEA 4GVXA 1YR1A 1L1QA 3QX9A 4RPKA 4ENSA 3LKBA 1I10A 3GJ7A 2AG1A 1JIXA 1R12A 1BCRB 1AZLA 2G0TA 1RCTE 2WIBA 3KJNA 4EZEA 2CLMB 5EXPA 5HXAA 4AT1A 4KXFB 1T0UA 2ZRMA 3UT0A 2P5UA 1SCAA 2PZGA 3UKJA 3BCSA 2EATA 3KUXA 4UE3S 2ZSHA 4CM4A 4Q3OA 2F59A 5CBPB 1GA4A 1E2KA 2PL9A 2JIQA 3Q41A 5BV7A 5HF9A 1OU0A 2VT2A 3AUFA 3LC2O 1X9HA 1AQ6A 3AI7A 2X2EA 1OAOA 2JJ2A 5EEHA 2O3SA 3N6VA 4MUMA 1LWNA 1CIVA 3OJ0A 3CCV1 2BKVA 3EDYA 2QMEA 1P1BA 4LRUA 3ZTWA 4AS1A 2QRHA 3F67A 1JQJC 1PJ8A 2PBRA 4Q7EA 1F06A 1RWOA 1VHDA 3T0GA 3ZH9B 2AZXA 1PKEA 2B4YA 4B32A 2XVMA 1YL5A 2IHJA 2XHEA 3IBFA 5JAOA 1NN3A 1SIBE 3DOCA 4H6PA 1KZHA 1P1FA 2FOXA 3J81k 2E4XA 1ZM3A 1U0NA 5AVWA 4P80A 4YJFA 5JROA 1E18A 2P68A 1W4BA 2Y1EA 1O95A 4BV8A 4CETA 5CNIA 4NI5A 4ZVVA 4DANA 5I7UA 4MGYR 4QREA 1RMTA 4URUR 2QN8A 3VC2A 2VNIA 4YT4A 3IVRA 1KI2A 1R0ZA 1M2OA 3L6DA 3W2GA 1ILEA 4MAAA 2AN4A 1YBHA 1SA0B 1NPDA 2WK1A 1A7KA 4OHMA 2WD7B 3DCIA 5KJEA 4FLEA 3ZI0A 4B75A 2C98A 4F60A 1XTRA 2ZLBA 4LE1A 1UQUA 2I3ZA 4WXYB 1M76A 3OEYA 4DXAA 4YV0A 3GELA 3GBPA 4RDXA 3QE0A 4FSHA 1DQSA 4YRKA 1PWZA 3NXSA 4WE3A 5I9IA 5L53A 3E7PA 4IINA 1O5IA 4ZXFA 1GXSB 3EQ8A 5E4TA 3OG9A 3U0VA 1E69A 1LW6E 2PKWA 3AW9A 3E5HA 4PGHA 4F6CA 4MX8A 3SC2A 5C5DA 1UMCA 5L9AA 4DSZA 3BS4A 4RKYA 8LDHA 5HE9A 3BKXA 4ESEA 5AW6A 3NDPA 3ZEIA 4OXIA 4Q3KA 3ZY3A 1C3OA 7AT1A 1VQLZ 1YV9A 1TC1A 2KBEA 2XLBA 1SR8A 5FUVA 1USKA 5DWQA 2DBQA 3ETCA 5EP2A 3TLXA 3T0FA 3CUVA 4HJRA 1Q7CA 3L79A 2CLOB 4CUKA 2WABA 3M4OI 3O93A 3WE7A 3BD6A 2IDJA 4IHAA 4N3GA 3WYNA 4R2HA 2ID9A 2X5XA 5AKKA 4KFCA 3ZIAA 2AXEA 4V0LA 2AR9A 4QBGB 5K1ZA 4KYIB 3S40A 2F7SA 4BEWA 2UXBB 2REXB 5LOVA 4CM8B 2XBLA 4EKDA 4LHYA 1V7ZA 4EVIA 1N9GA 4WKOA 5E3HA 5J1SB 4GXTA 4JLOA 5AH0A 5HR5A 3I5XA 4DC0A 3C8DA 3QU4A 4G1BA 1G1AA 1N0HA 1P7ZA 2OILA 4KK3A 4EBFA 2ZTVA 1AY0A 3LXMA 2HPVA 2XUQA 4FYWA 4F3CA 3TFQA 4G0VA 2HA0A 1WXQA 4LDJA 4JVNA 1LZKA 3RDPA 2C1EA 4QUAA 3ECAA 3GEDA 4G9EA 5KX5B 3BD9A 1AQJA 2GO7A 4H7JA 4R8KA 3ILVA 4OQFA 4GD3Q 1R8QA 1J0XO 4NR0A 2OGZA 2QVGA 1K8YB 1TOAA 2PGJA 4TS1A 1YR3A 2X4DA 3TEFA 3TL3A 5H4GA 4TKUB 4TM7A 3TSYA 1O77A 3OPMA 3QG1A 2VXOA 1NWHA 1R0SA 5C44I 2D5LA 1LU9A 2CJWA 3AH8A 3G9QA 4RVNA 3URMA 3W7BA 5CNMA 3ZE6A 4F2HA 2BGJA 3V9AA 4DT1A 1TC2A 1CEEA 1C1XA 1NRWA 5CFNA 4FYHA 3QWUA 1Z5OA 4C3UA 2J6AA 1BFUA 4U02A 5IXYA 1RMYA 3OBIA 2C9DA 1CPYA 4FZ3A 3PPWA 1R0CA 1A27A 4JEIA 3ZW7A 5JZ9A 1D3AA 2WZDA 1BFKA 3MBKA 3MJ4A 4F5WA 1VC2A 4MVJH 5BV2P 5AM4A 4IJ6A 5EUQB 5F98A 1UEXC 3HUDA 5FAKA 5TF4A 1R3UA 5IJ0B 3FI9A 4NMWA 1ONBA 1TDJA 3G02A 4I1VA 4YMSA 2WSIA 2I3CA 3K5IA 4FSXA 5ICSA 3ESWA 4Q1DA 2CHQA 3H65A 4JD5A 2OFFA 4ZYXA 5KKNB 4O4LB 5FA6A 4KACA 1ISJA 1TD1A 3LCCA 1HETA 1F0PA 1II9A 3G5LA 5LZ2A 2QNIA 2XZTA 3AHEA 5EMJA 2PL3A 5BN3A 1HM5A 1Y1VI 2JI8A 4BVLA 3RC3A 4EGAA 3P2YA 2O3JA 1PNQA 4FC7A 1ZN2A 4PFSA 5AVOA 3VR5D 1JEEA 3UK6A 4AJHA 1SUDA 4AXXA 2ORVA 4BVKA 5A2Qf 1OYVA 3DBHA 1JBKA 5FLMI 4MW2A 3I04A 3JSXA 4DEVA 4D44A 3OFKA 2VKQA 2F9MA 1C7ZA 3RNLA 3WGTA 2G67A 3QPVA 2QP4A 4JY7A 2YHIA 3D7SA 4RAOA 2E37A 4E46A 3EPKA 2HV8A 5ERGB 1HO3A 2AA3A 2NO4A 2WHQA 1X8LA 1JKJB 1M901 3SK0A 1UC8A 5C9ZA 2HREA 5D6OA 5KYKA 1A2QA 1QDEA 1VGVA 2D00A 4MMZB 1EHYA 4MWGA 2PUFA 4RESA 5FI3A 2V03A 3R24A 1Y1QA 1YJCA 3SNHA 5GONA 3H3VJ 4EX7A 4ALKA 1O97C 1PR0A 4ER6A 4LF6B 5FPKA 1KC81 4L6CA 2G77B 1SKBA 5GGYA 4RCYA 3ZK8A 4EQZA 1VQ51 1MO6A 3SDZA 4Q9JA 3AHGA 1K27A 1P7CA 4K8OA 4DLRA 3KUKA 1M2NA 4M49A 3PS9A 1LA2A 1WLYA 3N53A 1YK0A 3LK7A 4RFSB 5ICCA 1NZFA 1AH2A 2JJ2D 4ZQCB 1MG5A 5HQJA 1S2MA 2FP4A 3JYHA 3F78A 2JKVA 1D4OA 4ACAA 1MC4A 2BM9A 1P0QA 4BDSA 3FZYA 1W4RA 2W22A 2PX0A 1RYMA 5HS4A 1II0A 2J4CA 1OQAA 3CRRA 4J2OA 1XSEA 5CFQA 3IDQA 3O8QB 4MUKA 2WSYB 3DAYA 3EG9B 4WUVA 3EBOA 1B3BA 4YXWA 5CEJA 3E3NA 4PLFA 1H05A 4BZPA 1DTSA 3VJRA 2RONA 4AM8A 1ECPA 2IYSA 4FS8A 4INJA 3EAGA 2WJZB 3M4ZA 1OKKD 1A97A 1S4MA 1NONA 3QPUA 4HI0E 2Q9CA 4YRZA 1HYHA 2DWQA 2HI0A 5LQKA 1VIVA 3Q15C 3DJYA 4ITVA 3O4RA 3OCWA 2Q51A 4A2WA 3GRRA 1D6JA 2HRDA 3O4FA 4QFBA 3GJ5A 2VQ3A 3N70A 3RS9A 1WZUA 1RM5A 1YQQA 5B1IA 1E94E 4D9JA 2PH7A 3SVZA 3C3WA 1YDWA 2DULA 4WLFA 5E6SB 4EA7A 4UUOA 5KOYA 5K3AA 1UL1X 1P5ZB 2B6HA 2YQZA 1BDMA 3VRHA 4J9VA 3U17A 3MS4A 1LLUA 4EW3A 2BEWA 1G5QA 3BCRA 4COKA 3L84A 3PYMA 1ATIA 4UEWA 3WFZA 1RTTA 3ZQJA 1MIHA 1VGQA 1XXHB 4LNAA 1FJ2A 4LJ6A 4P33A 1X7YB 4U7GA 2DM6A 5ALLA 3ZTTA 4UE6A 2CLEB 3QEMB 4O3FA 5J2UB 4XVHA 4RJKA 4ND7A 2JNYA 3NNNA 3WLFA 1SCQA 1OLUA 4C7OB 1M0TA 3KYCB 3V48A 5C4XI 2XXAA 4MHOA 2WMOB 2D5CA 2PL5A 5E3IA 4JU9A 4JFAA 1JUDA 1RC8A 1M8GA 5BRJA 3U9TA 4R98A 1VMEA 1EFUA 1IG0A 2AE1A 2CBZA 4XUEA 3QUAA 3P5JB 3RFVA 3IP5A 1UBMS 1D5CA 2BFPA 3K1AB 2VXBA 3LLCA 3MUOA 2IZZA 2Q5LA 3DZCA 3H9CA 3S1AB 3ZWXA 1E3SA 3UGQA 3LO8A 2WR8A 3L7IA 5DNEA 3HXPA 3H5NA 6LDHA 2VTBB 3P9QA 4MUXA 5CX1B 3H4TA 4C6TB 3H97A 3SHTA 4JOQA 2M6NA 2YIVX 3IPYA 3NBMA 1JDZA 2Z4SA 4MGEA 5E95A 2VDQB 1G8GA 2H2FA 3DLCA 4Q82A 3EFHA 4PIPA 3T15A 1NUIA 3BIOA 1SUWA 1ZU5A 4TL7A 2AUMA 1CV2A 2ZIWB 4IOMA 2NUPA 2B5WA 3HJRA 4F2PA 3CMCO 1C4KA 1PV2A 3AU8A 7ADHA 4IR7A 3QXXA 3EEBA 1CDZA 1CUAA 4A5SA 4ARSA 4TLLB 5D1OA 3NCTA 1CZLA 4YJ2F 1RQ2A 3GFRA 2C54A 1YTUA 1XB2A 1OIXA 1G64A 1PDWA 1H2RS 1PS8A 2H5EA 2ZOSA 4XYGA 4NS4A 5D1NA 3M33A 1ZH6A 4NNOA 4TLEA 4DV7B 1PSWA 7REQA 1PK9A 1XZPA 3D4IA 1U2ZA 4JJGA 4W1QA 3W79A 1DJNA 1NV8A 2HKIA 3NKLA 4KK4A 4ZAFA 2IPNA 1UBEA 1ZBDA 2IHZA 1REQB 1OFUX 3WWCA 4Z49A 1UM9B 1COWD 3NP9A 4EI7A 1KFCB 3H1TA 3TM5A 4C4ZA 4UVHA 1ISIA 2MSDB 4LFBB 4L8FA 2F8LA 4LMPA 4IKPA 3ILSA 3GB9A 4HWPA 4QDTA 3MGBA 3W7AA 3TRFA 2YFQA 1F2TB 3G17A 4C4SA 5JPDA 4BMXA 2EW8A 4LVOA 3NS7A 4GNKA 1GVNB 4QM6A 4FMDF 1ML8A 4DLZA 3M4YA 4L2IB 1B0AA 3MMZA 5K0CA 2YXDA 1Y81A 4P92A 2JH3A 2RFLA 3K05A 4P3XA 3ENNA 4TWRA 4ALLA 1ZD3A 3FUVA 5BSGA 4KX3A 4QC2A 1J9EA 3H9QA 1IN8A 3PFFA 3GJXC 2BR3A 3EUFA 4A9AA 3JU3A 1LSOA 5IT4A 1KI6A 5HK8A 3UWMA 2Y68A 4I14A 2Z8XA 2JA6I 2C77A 2XHZA 3DW1X 4BMZA 4MR7A 2JLXA 4GUDA 3TVYA 4EUKA 3TDNA 3CRQA 1I80A 4XARA 5AJYA 5JYCA 5KB3A 3RIMA 4AJ9A 1OX6A 2YCLA 3ITEA 1BJRE 1MGOA 3P2JA 2PT7A 2P9TA 2GBFA 1JEQB 3ADOA 2BDEA 5ALGA 4ZVPA 3SQOA 1GU1A 2WUDA 3IPLA 3OC6A 4LISA 4QU9A 5CJJA 4KSCA 2AVDA 1CRQA 5DTIA 5EEGA 3CXUA 5I7FA 3ZCRA 3AFMA 3C8MA 2Q4DA 1R8XA 1I01A 1OLSB 4JELA 4YJFB 3ZW8A 4ZI7F 4ZI7A 5LD2C 1ZNWA 1OGYA 2H07A 2QLNA 3DMTC 5FBHA 5AKYA 4FNMA 1USIA 1CZOA 3GT4A 3IPXA 3UJ3X 4G0ZA 1FDRA 2J5RA 4NU5A 1HEYA 4PCVA 3EE6A 2C5LA 3FSGA 1X87A 5JD6A 1D2CA 5JY6A 1KVSA 5IAKA 5JZMA 2PUHA 1VQM1 4FFLA 4YFYA 5GPBA 2OFXA 1NVDA 1WDTA 4HP8A 3EVNA 2W03A 1AQYA 2I1QA 3UG7A 5HEKA 2F8TA 4RAQA 2BTQB 4EI9A 1GZ6A 4HCJA 1XV5A 3KR1A 2PS3A 3CC21 4JSTA 1F17A 4HNRA 1J2EA 2NTJA 2W2QA 4R41A 4DCCA 4IXNA 2O8BB 2XW6A 1GUDA 1XA3A 2VPQA 3HXKA 1HOTA 4Y3UA 4IWYA 4XX0A 5TMPA 4BY9E 3AM5A 2WF9A 4QGAA 3GGCA 1IHDA 3BAFA 4YQZA 1T35A 3R6TA 3AR8A 1E3EA 2QF7A 1PT5A 3B89A 4U5QA 3TAHA 2AOVA 3G711 2R86A 3BXEA 4PO1A 1XZFA 4BQSA 2EGHA 5JVDF 3KPVA 3SZGA 1BYUA 4PZYA 2HAEA 4ZPJA 3K15A 4U7HA 2WHYA 1UT6A 1AS3A 4MSUA 1C29B 2WU3A 5KNDA 2JIOA 4C21A 3D9XA 1DFGA 4V0ME 1J56A 2O05A 2QREB 3QPWA 4XXHA 4DV5B 3WGKA 3DBRA 4US1R 2C3OA 1PD0A 1LB1B 1QIKA 2QX8A 3FETA 5DCUA 1ISMA 1G4AE 3UKOA 1L4UA 4OFBA 5JZBA 5L4NA 2I71A 3QKSA 1DINA 1Y5RA 2ZJ6A 1NYLA 4L75A 4NIMA 1E3WB 4MVJM 4DEYA 3EEYA 3V6MA 4MI3A 1UJBA 4CEJA 4BVHA 2XMRA 2XOKD 1EP2B 5EQTA 3ZLTA 4PC3A 4HWKA 4X7MA 1M2FA 1ONSA 5LQRA 4E03A 1GPMA 2ZCVA 3ACBA 2R0QC 5AHKA 3RUFA 4NENB 2A9QA 1KERA 2HCBA 4D42A 2EQBA 2OC9A 3VKFA 1LS1A 1G16A 3FJOA 3DUWA 3NAGA 5LZ5A 2ADOA 1U0JA 1S7GA 3ZU6A 4PZCA 2XUIA 2O7RA 4GYKA 3CTPA 5EZYB 3RGGA 2DKNA 1FBTA 2HMSA 3JQAD 4YJGA 5TS2A 3V55A 1VHQA 3HBAA 3OTHA 4G67A 2QLBA 3GJTA 3NTXA 2RHJA 1CDOA 4OL9A 3DQZA 4TVKA 1NXTA 3V5NA 4IXWA 5JQGA 3RIHA 3AM4A 3MC1A 1TK9A 1ZW6A 3DBHB 4EEZA 6REQA 4R05A 2DFPA 1V71A 1ZRMA 3A4MA 3E9CA 3UBTA 4KDFA 3A4LA 3GDOA 2ZUVA 2R97A 3FGPA 5F1PA 1G20A 1SEVA 1IQPA 1GPJA 1H66A 5DXAA 3UVEA 1NLYA 1WVIA 2MR5A 3K8YA 5C2JB 5C46F 1NP7A 3IKJA 4UATA 1KR5A 1YR9A 3BWCA 5AYVA 3FSGD 3O9ZA 2XT6A 1G3QA 2JK1A 2DUJA 3F49S 4QIHA 1RLIA 3GUUA 4QGSA 5BV1A 1P74A 3WB2A 4B4UA 1A9OA 2F43B 3AR6A 2GRUA 5D51S 2H48A 3S1LA 1WBBA 1HE1C 1N8NA 3Q5GA 2CXNA 3HLTA 1U1CA 1VJGA 3PQ5A 1E89A 3RABA 3BGIA 2J7PD 2XA1A 4AF7A 1U0SY 2QA41 3EC2A 5FLXf 3HA5A 1E77A 3D3NA 4IDHA 5JLAA 2EFDB 4BQOA 2YBDA 1YJAA 3IURA 3UMBA 5FLXb 1LI5A 5IK2D 3S2EA 4EG3A 1LDYA 2PX2A 2VJDA 5DH9A 2ZYGA 2O3TA 3MTBA 1A4UA 3FM9A 3OZRA 4PZ9A 1RKQA 4NDNE 1USPA 5IMSA 3BRQA 4IOJA 4IIEA 2YJGA 2R3SA 2NVQI 1K6IA 1FYWA 1OOEA 1UMBB 3IC5A 4PGGA 3V4PB 3L1HA 2P41A 2VYQA 5B3JC 1VL1A 3QHAA 4QXPA 3PO2I 1J1ZA 2JW5A 3FTDA 3FPBA 5DLQC 3WFIA 1E5LA 1FP4A 1YZNA 3WLEA 4B6PA 4D3YA 5JY1A 5DNUA 1V16A 3G0GA 3CJQA 4NZOA 1RWPA 2WYIA 5A0VA 3HKBB 4B3TB 4KXMA 1MZPA 3GKQA 4XYBA 2QSZA 3OZXA 4AQDA 1VQ91 2KWIA 1VQMZ 2WKWA 4F04A 3PEUA 4DIKA 2C94A 1SG0A 4GSYA 4FEEA 4QL3A 1JDVA 3IJ5A 5ADUS 1QX3A 1YBVA 3MT8A 4P6VF 2RBGA 4UUPA 6CHYA 3MTQA 1M9NA 3E81A 5B7PA 1SU6A 3KBOA 3VR2A 3EF0A 2BE9A 3M70A 3UQZA 2X4LA 3TX6A 2JCXA 4UNPA 4JB0A 3I9JA 1H5QA 3GEBA 2XOEA 2XMGA 4LVCA 4QARA 4CNQA 4A0QA 1AUQA 2DQSA 1A69A 1NDQA 1XKQA 3LHIA 4MYRA 4Z3OA 5A5DA 3HY3A 4DLWA 3ROKA 2VVTA 1JJIA 4PPFA 3AF2A 2MCFA 1LNSA 1D4AA 1PUXA 2HGZA 2PKRA 4MDHA 4PR0A 4YCMA 4Y6PA 1M1XB 3RS7A 5ELMA 9LDBA 1Y7IA 2IZ3A 3FBTA 4AJ1A 3AKZA 2BRUA 4FGSA 2G76A 1UK6A 1KYTA 2I99A 2LBPA 2XGSA 1C3EA 3GRAA 4IIHA 4JEUA 4WDRA 5H02A 2NV6A 4UPDA 5IJ9A 3JQFA 3NP7A 1XGKA 2X1LA 1X42A 1QOPB 4Q5IA 1PJ4A 4TT8A 1KQPA 5BMOA 1POXA 1TCBA 4PYOA 3WK5A 2HT6A 4IIXA 1Z2EA 4KKVA 4L3OA 3EWNA 2PCLA 4PLHA 3U16A 4OOFA 3OZIA 3D02A 2G07A 1BWPA 1XU4A 3F6RA 2GZRA 2KLBA 3HS3A 2Q1YA 1XQ9A 4EYOA 4NDZA 2OHIA 5CD1A 4MVCA 3EVBA 1GU0A 3N6XA 1NQWA 1U7WA 3Q11A 5D2CA 3RBXA 4G5FA 2WIFA 4YMIA 3W1VA 3IUEA 3NFYA 4MONA 1U2GA 1IONA 3BHNA 1JJFA 3DZJA 3FUCA 5JH7F 3PQFA 1LLDA 1NT4A 1UPCA 4L4RA 1HKUA 2QW8A 4FKMA 1ISSA 3DT8A 3D8BA 4MUAA 3FYCA 1UZMA 1EXVA 1K98A 3H6GA 1F2DA 4QFCA 3O3OB 5LZ8A 3ZU4A 3T7RA 4EF4A 4M1QA 4B47A 1LY1A 3OJFA 4WSOA 2V5UA 3K1YA 1H0KA 1T5IA 2C58A 4DC1A 2K2QB 1NQOA 2ZE6A 3RVNA 2OR3A 3WGVA 5JTTA 4AIRA 3NH6A 4YRJA 1PDOA 5YASA 5FTMA 3DMPA 1T0IA 2OHVA 1H65A 2HV9A 5HIJA 3PG5A 5AHWA 4TXMA 1EXWA 1NL3A 1QZZA 2XE6A 4O02B 4OJYA 5BSTA 4ENQA 3NRCA 3AHFA 2XMSA 1LV8A 4P7JA 1IRIA 4IH9A 4QBHA 1KSFX 1FMCA 2CBXA 1ECCA 2RIPA 3GYGA 1JJBA 4ZT3A 3AR5A 4UFPA 2V7GA 3ICCA 2FLVA 2Y92A 2ZIUB 3COZA 4UHKA 5DU2A 1DZ3A 3KELA 5A9RA 1X77A 4HQRA 2PO5A 4BP1A 1V8PA 1QTIA 2FFQA 2VHZA 4IIVA 1CTQA 2OV4A 2PANA 3G0IA 4BIMA 3G6KA 2I9KA 1NKSA 1C2TA 2EIXA 2W04A 2Y2UA 1YH3A 4KWIA 1AKRA 5E6UB 3EZFA 4IY1A 3LI2A 1GIAA 2JS4A 4FOPA 3OPYB 3M9XA 1O0BA 2M32A 2R1ZA 5DW0A 4POOA 5KTPA 1GAJA 3GLHA 4X24A 1Y3BE 2X7HA 4UXJA 2PRYA 2O4UX 1U0RA 3Q8LA 3B20A 2YWFA 1ZOOA 2JGRA 2IDKA 4FS3A 1I0ZA 4UHBA 1E6UA 2G70A 3MT9A 2GAJA 3IP3A 5CHYA 1P9WA 4IXTA 1VL2A 3T1NA 4HQ0A 5K09A 3HZZA 1MDFA 2V7QD 4EX6A 5JCJA 1R3DA 1WCXA 3T5GA 4BKQA 5BUCA 3RU9A 1TF7A 1RXUA 4KO8A 4O2LA 3G7NA 2HIHA 1BAPA 1DXQA 2HMWA 3C7AA 5TB5A 1MIOB 1ESMA 1YR2A 2JD2A 4P4GA 3FHTA 5ALMA 3AB7A 3RQSA 1HR0B 2FSHA 2HDWA 4I55B 1DT3A 1T9ZA 1A5ZA 2MSKA 1NMEA 4WKGA 5JAPA 5JJLA 1VFPA 5M5BA 5CXXA 4BX2A 3Q0IA 3FJYA 1KAOA 4GM0A 4J0JA 5EIFA 2WV9A 4MV1A 1YRYE 4ZVMA 2A58A 4R1SA 1E5XA 1QRDA 5I8ZA 1PG2A 5AXCA 1N32B 1ZD9A 2B99A 2PZFA 2Q9UA 1KZ6A 3H5AA 4Q3LA 2QRNA 4RVOA 1EQAA 4B7AA 5GINE 2WT4A 3BJRA 4ER3A 5DW3A 2PK3A 3Q87A 3NO4A 3ON5A 1QGZA 2YJZA 3KQVA 1ZLYA 2NSHA 4JIGA 4NBLA 4FHCA 1TAUA 4WZZA 3MMNA 1OBOA 1WPQA 4ZMRA 3CZCA 3MTIA 5MGNA 4MB0A 4DLXA 1O3YA 1TWFI 1NFRA 1RT9A 3HKDA 5GZ3A 5KNCH 1PWYE 1EE1A 4MITA 3URKA 1RAHA 2CN1A 5BV0A 3ZLUA 4WAUA 4UEKA 1Z6AA 1G3MA 2HK6A 3AEUB 1B93A 4YNBA 5TVKA 3VPGA 3Q8WA 2YN0A 2HDOA 1UBTS 3E61A 4FNAA 1TVMA 1F60A 3JWHA 5B37A 2NU8A 1KDOA 2ZAOA 5FPHA 3H83A 1UWVA 2DKOA 1MV8A 3BULA 2XD9A 3DEYX 4NF2A 3DE2X 1KS2A 1IM2A 1E8DA 3VDQA 3VXKA 1KBZA 2BFDB 3I5YA 3E7WA 5B2ZA 5EIEA 4FGJA 3UO8B 3TLAA 5FTWA 4FFNA 5CVVA 1T9GR 3GPBA 3MTAA 5DB4A 3PFCA 4UD6A 2AI2A 1Z12A 3BDAA 3CC8A 3UAVA 1DAEA 3TWOA 3CCVZ 1NP6A 3MN1A 3GLFE 5KSYA 1XKLA 2VAPA 2ECKA 3IE0A 2BMWA 2AH5A 3R3YA 1T36A 3WLQA 1SD5A 3WQHA 2PX6A 4I4IA 5JUWA 3HWWA 1NSYA 5FCDA 2JLSA 5M2QA 3CF0A 4TKLA 2ODEA 4OMFG 3S7ZA 1AMNA 1KY4A 4CTMA 1YCGA 1L7OA 4MA5A 2ZS9A 4TTRA 2HRQA 5FEMA 5T6BA 2I6SA 1TQDA 3HI6A 4J29A 2FN8A 4LVUA 5KYWA 4I8IA 5LYJF 5ENVA 5M3BA 2N1BA 1ITZA 1JILA 1DEHA 3HCEA 3RUHA 5BNIA 4TV8B 1TAGA 1T8UA 3O1LA 3F3FC 3O0DA 1JW9B 2HTEA 3R7FA 3TRIA 4MS3B 1T6ZA 1ZBQA 3U50C 2DECA 4R8SA 2N1MA 3I9OA 5JXHA 1E3WA 3WGOA 4H3KB 4RSMA 2ZK7A 3ONWA 1J06A 3PFNA 2OP0A 4A3MI 621PA 4EYKA 3HFRA 3M2TA 3QWBA 3W04A 5JH7B 4MR8B 5DHPA 2H4ZA 3G85A 2A0YA 1RDFA 2RJOA 1CUJA 2FX2A 4E22A 2DX7A 2YIMA 1UZNA 2QTRA 1HSOA 3P9PA 2HJRA 5TT0A 3WZMA 1T1JA 3HKDB 4NK4A 2X9LA 3GJRA 4CCYA 3RYHB 4W5TA 4IDGA 2P2YA 1CE8B 1CQIA 2A0UA 4M55A 1N1DA 4LTDA 3ORHA 4X93A 3RHTA 1MOZA 3PICA 3C7TA 3I61A 3K2QA 4GPD1 1EB9A 1WTAA 4A8HA 4DIUA 3WA7A 2CNWA 3L92A 3S7TA 3SY8A 1JKXA 1HFKA 2QQGA 1SJ9A 1W4LA 3CX6A 2Y66A 4ILEA 2X5KO 4O4HA 3SR4A 2D4HA 3ZY6A 2QN6A 1QE3A 1O8CA 2JHCA 2CL5A 2ORED 3C4VA 3QV1A 2JPDA 2IOFA 1FTSA 1T91A 3QLVA 4E5NA 1MENA 4TMVA 2BELA 3EMVA 3SFVA 4CKCA 4UQLA 1HFEL 1TX4B 3GLIB 1PHRA 3SI7A 4RCVA 2H65A 1PYDA 3NBUA 3K0AB 1YZTA 2NO1A 2VWQA 3S2FA 4D80A 5IAOA 1NU6A 1XRLA 3SVLA 4FI3F 4IH1A 1NJI2 4TV9B 3VM6A 2J33A 5F51A 3JVIA 3Q88A 1XTIA 1SXQA 4OHXA 3JWPA 4LDPA 2V8IA 5E4FA 4CLXA 4RPLA 4YPFA 2QRCB 4F8JA 4R69A 1VG1A 4WN3A 3UN1A 1CX9B 1L5WA 4N49A 4NBVA 4UJ3A 4EBBA 4EPRA 5K0JA 4N76A 4S1NA 2H52A 3HKCA 1PR1A 4BKMA 4MWZA 1Z4MA 3CRMA 1OZ0A 3QFRA 1ND5A 3VPSA 5KYWB 4TUYA 1W8IA 5CLFA 2R7AA 1PAUA 2ZI3A 4II2A 4TVBA 2B6NA 2E0IA 3OX4A 5IBQA 3V7WA 1WG8A 3D7MA 2WF5A 1FRZA 2OFPA 4XW2A 5BOSB 2VQDA 3DMYA 1BE6A 3C1UA 1P19A 3K9QO 1S1CA 5CFPA 4LOAA 1F8FA 1UUFA 4WZAE 1Y1TA 1TU3A 3MJCA 5AIBA 2XH8A 4ZVNA 3STYA 4NBCA 5IU6A 2EKBA 1SVWA 1X8XA 2WOJA 1XXHE 3L7KA 3FPLA 2C3YA 2FZVA 3SEFA 2IOQA 1OWMA 2ANCA 3UC5A 3MAGA 1VL5A 2WTMA 1Z5WA 3G71Z 2FZLA 8GPBA 1KEKA 3PP8A 2YR0A 1P7YA 2QU7A 2CLCX 1SBYA 2H63A 2IQ5A 4QOJA 3MOGA 1U0GA 3KFVA 5FI0B 4OP1A 3NANA 1NN1A 1E0KA 2AMJA 2Q4RA 2AZDA 1K5GA 2Z3WA 2WVJA 3JYPA 3MGGA 3PNYA 3Q1KA 1BHO1 5COQA 2QQ0A 4MQBA 4LQLA 2V1UA 3R9WA 2FA9A 1GNSA 4G56A 5GWXA 2QG9A 3RC7A 1FMJA 1QCZA 3O91A 1KQFA 1ODKA 3NDJA 1Z4KA 1JS1X 2MSWA 2QM7A 3OEWA 1I2MA 1I3KA 4J0DA 4KIWA 4MVJE 1XCMA 4A03A 2HK9A 5A5EA 1AK1A 1JMYA 3R3XA 3I4NI 2Q6OA 4K9RA 2PS0A 2Z9BA 1M6VB 5BW5A 5K0GA 1QG4A 1AHIA 2N42A 2X76A 1CVIA 2UYGA 4EB8A 2BFCA 4CEJB 5T3UA 3BK1A 2BI4A 2AMLA 2A9RA 1WU8A 2ZZMA 2WINI 5H1YA 1R10A 2BEVA 1EA7A 1C7JA 1KVQA 2GU2A 4DLBA 5B6IA 2L18A 3NW9A 2PFGA 4M4SA 3JQ9A 1I6HI 1XZGA 1FQWA 4JROA 4LY3A 1WUKS 4IG4A 1U3WA 2E9HA 2D1TA 4KRYA 4L8VA 1RR6A 2W37A 4EI8A 5FBVB 1SBCA 2ZIZA 4M0KA 2CZGA 2BJVA 2CHUA 2AQKA 3DLPX 5FOXA 2NVUB 4ZEMA 2UXCB 2J0QA 3LZ6A 3O94A 2AOUA 2WJ3A 1TYEB 3PNVA 3JQ7A 4WOBA 2B83A 2XSZD 4OO3A 4HDRA 4RGQA 5DHTA 1CIPA 1KU6A 3JYQA 2QHXA 3GH3A 3I4CA 2IXFA 1X7XB 2G83A 3UJBA 4HH3C 5C1DA 5AFSA 4JJAA 1BDHA 4CXMA 3BJEA 1IZYA 3LDUA 1EWRA 4HMOA 4L85A 1U7ZA 3CEJA 4GECA 5LSAA 1E6LA 3U9LA 3DCNA 5EHZA 4BBAA 1FSSA 4YASA 3T52A 5DGXA 3ZD8A 3B1JA 1CQJB 4HL6A 4HQKA 5IKOA 1CB0A 1TF5A 4I8XA 4UUAA 2V8BA 1OB5A 2XMCA 2X8AA 1MAWA 3JASA 2ZAIA 1U65A 1RAAA 3WHPA 2YC4C 3UAOA 4O2AB 3RG8A 1FU7A 5ECYA 3UHAA 2RGBA 2D1FA 1SBNE 4Y8VA 1E9EA 5J40A 1IJFA 3MNFA 1AKWA 3FCOA 2P0AA 1OGJA 4QG3A 2J7PA 4DOMA 4FE3A 1SIUA 1NR7A 5CDFA 2BMEA 4RH1A 4XGQA 2H4JA 1DFIA 3A9UA 5IDWA 4U2CA 3SEQA 3L7NA 5A6SA 2CEKA 1WQ3A 2W2KA 4KI0A 4DR3B 2IYRA 3DEFA 2JAPA 4MUEA 2EC5A 3LUSA 1VRCA 2XZDA 3CRNA 3FR7A 2NADA 2OO5C 2BEWB 2YU9I 2O0LA 5A7HA 2H16A 1W25A 1VLAA 1MNQA 3A9TA 4IMPA 3UJ6A 3AV3A 2P2DA 4UJ5A 4BB6A 4U7PB 4UMVA 3TZ6A 3GLFB 2IFTA 4KPFC 1I94B 5KYYB 4MPDA 4G4IA 1SOVA 3LGXA 4I6JA 3BGOS 4E6EA 2AOTA 4U2KA 4H0NA 1V16B 3RKUA 2XJ9A 3KPUA 4K88A 1V48A 1N4DA 3AIOA 3RRMA 3MZLB 1A8QA 5CA0A 1TK2A 2X4IA 4F1WA 2I76A 4P4TA 1YQ9A 1H2HA 4BB9A 2WRZA 3G3EA 5CB6A 1CB7A 1BIFA 1OX5A 2BBSA 3IB3A 4ZQEA 2JFNA 2I8CA 2KLHA 3FNGA 4FDMA 3R74A 2R87A 3CPWZ 2RGXA 2QTCA 3TJZA 1GUFA 3I09A 1XT6A 5A02A 3QU5A 2CL0X 2PSSA 4GM4A 4ZI3A 4D2IA 1Z2NX 4TXLA 4U6NA 2RBEA 3OA0A 3B36A 4LIPD 1G63A 4HAZA 1AS0A 3JYNA 4JKYA 1VHJA 5IVDA 3TW0A 4RTPA 2J0SA 2O3UA 2A9PA 5LIPA 2RJNA 4A3LI 4NBKA 5BRNA 5GONB 2IKQA 1NQAO 1B41A 1RWKA 1VFNA 5AVJA 3L0BA 3R9IA 5CDTA 4QYTA 3DHWC 1A77A 2CHFA 3EEFA 3EGXA 4EVQA 3WK4A 2GCEA 3MPUA 3NHZA 4D9CA 1BWSA 2OZPA 2GNOA 4PQRA 4YCJA 1BEUB 1WCYA 2OOKA 3D2CA 2BLLA 5BSFA 3HLYA 3KOOA 1W2BY 2BVNA 4LKOA 4PLCA 4GEKA 1LH0A 1DDGA 2QEX1 4XLTA 4XPZA 3MD0A 1CS0A 3HOXI 2EZUA 1GL9B 2JZNA 1YI8A 5KWSA 4N6OA 1R88A 3LQFA 3ZZTA 1B6RA 1LCIA 3N9IA 1S7MA 1B73A 1YJQA 2EOAA 5DNWA 2OAQ1 5T6MA 4CUZA 3GLFA 1YZVA 1YR6A 3NBYC 2LCIA 2WAAA 2OUKA 5JYEA 3A4IA 3BDVA 1E58A 4JC4A 1X3WA 2ZP1A 2GTIA 3CONA 2A4MA 5IAEA 2PSJA 4N9WA 4ZPXA 4RL4A 4B3CA 4DLKA 4EA9A 2YWXA 1SRRA 3D59A 1M8JA 3NFZA 4WNIA 4XB6B 4ZYTA 5JAMA 1VSQA 1OXKB 4QUKA 4YONB 1L5VA 4NJOA 4A16A 3CMAZ 5KX5A 4YGXB 4RY0A 4D82A 4QEZA 4EW6A 4J43A 2NN3C 3IQDB 2R8RA 4LZLA 5CUQA 5K9ZA 1PFQA 3AJAA 3AWDA 2VUUA 4OHUA 4CF7A 2AKEA 4O08A 5FA8A 1MTZA 4B7CA 4B33A 2P6PA 1HE3A 2ST1A 4N9QA 2IDMA 3WNCA 1K8QA 1ZCJA 5EYPA 1KI6B 2QYTA 3WRXA 4TV8A 2I1LA 5JQGF 2ZYSA 4OYRA 3NDIA 4ERNA 1NJ5A 3IQGX 3TI9A 3S81A 3R8CA 4JWKA 4UU0A 1QKIA 3KJIA 3LCMA 3OP4A 4RF2A 1D2NA 1V6CA 1RBQA 2ZJ2A 3L0PA 4I55F 4H59A 2BSQA 4JN6B 2LNDA 4F9GA 1ZAKA 1ZEJA 4QXOA 4W5WA 3IL2A 3KFLA 2BCGY 2A1IA 5L3ZA 2HSDA 4HDOB 5HKOA 2AOXA 1DP4A 3DTNA 4UZSA 3QF4B 4MQ6A 1I7LA 4EJSB 4EPTA 3QKUA 1H2EA 3OT1A 4X44A 1CQPA 2D06A 2FF5A 3MTJA 3RWBA 1GKIA 1M2VA 2HXGA 1GT91 1G9XA 4F21A 4E5DA 4CKBB 3SHOA 4LF9B 3DDZX 3Q5EA 4LKRA 1M6HA 1YCFA 1KZ4A 1WCIB 2FU5C 3H9UA 1NJ2A 3QXHA 4I4TA 1HZZA 4IJMA 1JT2A 2HJWA 4LI0A 1ZRNA 5B3KA 3LPNA 4HAYA 3EOAI 2YXLA 5JCZA 1TL7C 2BUCA 4PNPA 4ZZ2A 2V98A 3PJGA 3KVYA 2AK3A 4L27A 1I6MA 3L6UA 4YCBA 4QBTA 2AEEA 2QPTA 3I2GA 1A82A 1Y3HA 4NULA 1XBTA 5D8DA 5G41A 4AZ3A 5FQNA 1Q0ZA 4HO1X 4D0SA 2BGWA 3BKWA 1KI9A 3GH1A 4FGUA 4P4UA 4B6OA 4ETIA 1R9TI 3B1YA 4XYMA 3KOWA 1KPIA 2B78A 2VJPA 3F9IA 3D4BA 1H2AS 2WF6A 3NHYA 4L78A 3VNSA 3CX8A 4TKVB 2FN4A 1M7BA 1U7XA 1QH1A 4MW1A 2BKXA 2HOQA 4N5IX 1SU4A 1H6CA 2QP3A 3DULA 4H7KA 3R40A 5EYPB 2EFJA 3WBKA 5EQDA 4X20B 4NYMR 2GCIA 1UXHA 5F3WB 4JJ6A 1IUOA 2GK7A 2JMOA 1F5SA 1SO8A 4MPTA 1W44A 2R68A 3GFOA 4YP0A 1HLPA 5CCDA 3MJRA 4BY7I 3R6WA 3O2NA 3OA2A 3VI4B 3MJVA 3IBCA 3NIDB 4I3GA 5DNCA 4W5OA 1QTQA 1OVMA 4FEAA 4XASA 2OTCA 4FB5A 3B52X 1KYXA 3G2MA 5LYJB 4HXYA 3O8LA 4XWGA 1AGNA 1QANA 4DBLE 2JD0A 2ZCJA 1NF2A 3EJ6A 2YJTD 3F7TA 1AGXA 2XWSA 4EF5A 3DLBA 4Q7KA 5ERXA 4HQ6A 1F12A 4LY9A 5E1OA 2P8JA 4YCAA 4HQOA 1EX7A 4IV0A 2X2OA 4I4TB 1KEWA 1ZJ5A 6REQB 1QHHA 2HNAA 3VO8A 5NLLA 1JLHA 5GZ6A 2XAUA 4TYYA 2RPRA 4N3CA 4JC5A 2NU6B 3S5JA 4AWBA 3DDUA 3GLUA 2YQ5A 2Y0CA 1XZLA 4IHQA 4R7TA 4RZ2A 3UB3A 3F4BA 4ZAZA 3PX7A 1VI5A 3KJEA 1Z74A 1ECBA 4C0LA 5E6RB 3H8VA 3NHSA 1OIVA 3DNPA 5TMDA 3CKYA 5L45A 1XZEA 3I28A 5G1PA 3LPAA 4RH0A 5AM0A 4BN4A 2FP4B 1JHRA 2ZIGA 3ETJA 3ZDCA 3CCEZ 1C0IA 4KR2A 3OQHA 1QH1B 1FNSA 1ECLA 2PWYA 1VHTA 4HZGA 4M83A 4OXYA 1YS9A 1G3IA 4GOMD 5CVDA 4MDFA 1GTSA 3TH5A 4DA8A 3WC4A 5E7MA 4G4SP 1UDRA 4IDCA 4EJMA 4WD3A 2ANBA 2DPLA 1BW9A 1XZQA 1NBOA 3A25A 3K4HA 1OYWA 3VR4A 2P75A 5JS1A 4KU4A 1L4KA 1NDUA 3HYLA 3O4HA 3TDKA 2FR8C 2BFAA 3CNHA 4H35A 4HR7A 2QLMA 3CA8A 4DQVA 3NKVA 5FBQB 3VOAA 4V1CI 1H2BA 2YZMA 2E49A 4IIJF 1MC5A 3OIGA 4JR0A 4Q01A 1B14A 3KKMA 1ML4A 1BOOA 3HUUA 1NXVA 4OB7A 3SBXA 1TMGE 4DSAA