1WZNA

Crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
244
Chain Sequence
MYELYTLLAEYYDTIYRRRIERVKAEIDFVEEIFKEDAKREVRRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNLKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSKVAEALKPGGVFITDFPCGPVVWNEQKGEEKLVIMDWREVEPAVQKLRFKRLVQILRPNGEVKAFLVDDELNIYTPREVRLLAEKYFEKVKIYGNLKRELSPNDMRYWIVGIAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Crystal Structure of the SAM-dependent methyltransferase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 87
structure length 244
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1wznA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1wznA01
2FK8A 1R6AA 4R6WA 3KQYA 3IV6A 2PXCA 2VP3A 3NDIA 1F38A 2ZIFA 1G60A 1JG4A 3KPVA 4M36A 4QPPA 2NXCA 3B3GA 5ERGB 4P7GA 4PYIA 2P7HA 1INLA 4L7VA 5LQUA 3WSTA 4OQEA 2UYHA 3R6TA 5EEHA 3KQMA 4ER5A 3NMUF 3HNRA 3R9XB 1UFKA 3ELDA 4NECA 3O4FA 3OZSA 2HV9A 3KHKA 4Z2YA 2ONYA 2NYUA 3MQ2A 3QV2A 3I58A 2XYQA 2ZULA 1O9GA 4C07A 4LECA 2OO3A 1BKYA 1PRYA 2P8JA 3CKKA 2N47A 3TKAA 2XYVA 5LSAA 4GOOD 2ZSUA 2B9EA 3HCBA 1QYRA 2OZVA 1NBIA 3EVGA 1D2HA 3MCZA 3NWBA 3O31A 2HR1A 2IH4A 4KW7A 1I1NA 1ZQ9A 1NW3A 1B42A 4GC9A 1R8YA 2QE6A 5LQJA 3OU2A 1X1DA 2OXTA 1VPTA 3A25A 5EOVA 4XUDA 2PX5A 2NXEA 4KWCA 4C03A 5E2AA 2XVAA 2IP2A 1I9GA 3KPJA 2BR5A 1TW3A 1XTPA 5CCXA 5DM1A 1PJZA 4QTTB 4DZRA 4YV2A 3KKZA 2PY6A 1O54A 5GM1A 3EVZA 3ME5A 4BP1A 5JR3A 1FP2A 1L9KA 2G72A 2O57A 3LHDA 3ELYA 4OQDA 2P7IA 4YMGA 5K03A 1YFLA 3SSMA 1R8XA 5DRYA 3HCCA 4P58A 2PV0A 3NDJA 5HILA 5K0NA 4A6DA 2AOXA 2O0LA 2PX8A 1KXZA 2ZWVA 3MAGA 3P9NA 1DL5A 4OA5A 1SQGA 2PT6A 5CVDA 5FCDA 3LDUA 3OU7A 2PX4A 4QDJA 3RIEA 3EMDA 3SSOA 4DCMA 1RJGA 1SVUA 5CVUA 3FYCA 2YVLA 1KHHA 3DXZA 4KIGA 4E2ZA 1XDZA 2YUIA 5K05A 3FZGA 5FWDA 3M6VA 4QTUB 4X63A 3OFJA 1NKVA 4GOMD 3SM3A 4EKGA 5U4XA 3G2MA 3B7PA 2H11A 3SVZA 1XDUA 2O06A 2Z6QA 2GAFA 4G56A 3I9FA 5EMLA 4PGGA 2C7OA 3GRUA 2IFTA 3A27A 1IXKA 4HH4A 1KIAA 2AOUA 2BR4A 3B5IA 4XUCA 3R24A 4R8SA 2UYQA 2JG3A 1P1BA 4E2XA 2IH2A 2AS0A 3T7RA 5LQAA 3HM2A 5E1BA 3ORHA 5KQRA 3THRA 1WXWA 5DSTA 3VC1A 5LQCA 2P3QA 5FA5A 4RV9A 2O07A 2PJDA 4LWOA 4P7FA 2G70A 2C7RA 1RI1A 5MHTA 3FTFA 3OPNA 4MIKA 3BGIA 2ZZKA 4FT4A 3R3HA 5DT2A 1X1AA 4FP9A 4HG2A 5CUQA 5DXJA 1EJ6A 3GU3A 3DLCA 2CWWA 3GRRA 3LCUA 3EMBA 2VDUE 2NP6A 3KR2A 1G6Q1 5GWXA 1XCLA 3OZTA 3ELWA 4OBXA 3OE4A 4RTNA 1Q0SA 3FUXA 4PWYA 4WXHA 2F8LA 2GS9A 5E9JA 4RTLA 2G71A 5JUWA 5HEKA 5EVJA 1RI3A 2VZ9A 3SMQA 3TFWA 4PYQA 3DXXA 2IBSA 2ZBQA 3B3FA 1R18A 5DXAA 1I4WA 4PCAA 1ZGAA 4PYJA 4YMHA 3P71T 2KW5A 1M6EX 3BKXA 4OA8A 3JWJA 5CVEA 4ZTBA 1QAMA 2V74B 3GXOA 3MTIA 1R74A 3GDHA 3SGLA 1F3LA 2WK1A 2DPMA 4YV1A 5G02A 2QM3A 1D2GA 5LR6A 4Y2HA 3DMGA 1JSZA 2AR0A 1KR5A 2PBFA 4RTPA 5ICEA 1L3BA 3LBYA 3HA5A 1U2ZA 1FPQA 1JG3A 2AOUB 3I64A 4C4AA 4DF3A 2UYCA 3HA3A 5DLYA 4UOEA 3TR6A 5FA8A 5EKUA 5DSXA 2V7EA 3FPJA 4KVZA 1N2XA 4GEKA 3CVOA 5E1OA 4EK9A 4F84A 5K8VA 5FQNA 2E5WA 2HTEA 3CJQA 5T64A 3C6MA 2I62A 4RVDA 5E8RA 3PTAA 3GIWA 4OX9Y 3EGIA 3LKDA 5GP1A 3G2PA 3P2IA 5HIKA 2IDJA 3HTXA 3LECA 4MTLA 4POOA 2R6ZA 1RJDA 3HVJA 4IKPA 2CMHA 4PIMA 2ZCJA 1DCTA 2AVNA 2AZTA 2ZIEA 4V0RA 3OCJA 3SXJA 5HZMA 1WXXA 2CL5A 3C6KA 3PX3A 1P91A 3UJAA 4MHTA 3HP7A 4EQZA 4U7PB 1IY9A 1X1CA 1NV8A 3VSEA 2I6GA 2ZBRA 4FSDA 1Z3CA 2ONZA 4O29A 3A26A 2ZLBA 1OR8A 2BR3A 3PFGA 4E31A 1X1BA 4CKBA 4F86A 3BWYA 3OFKA 2EG5A 2OYRA 1RI5A 5GIOE 1JSXA 3KQVA 5CD1A 1RJEA 2YXDA 2ZBPA 5E1MA 2OPBA 2YXLA 5GINE 3TM4A 1ORIA 2XYRA 1VL5A 4RSRA 5K0GA 4LWPA 2IIPA 5BW4A 5B1SA 3MTEA 4CTKA 2G1PA 2ORED 5DTQA 1NE2A 4HGZA 2GH1A 2IPXA 3OU6A 2P1DA 3BXOA 3SSNA 3EEYA 3JWHA 1QAQA 4FSXA 4R05A 2Z6UA 3M6UA 2PX2A 1FJXA 1EG2A 1HNNA 3M6WA 5EMMA 3P97A 5EPEA 4YUYA 3QOWA 4ER3A 2B25A 9MHTA 1WZNA 4HGYA 3C3PA 3ANXA 3LCVB 1N7JA 2A14A 2PXAA 2PSSA 3NVMB 1UIRA 1BOOA 2AOTA 1TW2A 5DTRA 5GM2A 1XVAA 5DPMA 4FZVA 2XVMA 2YR0A 3BWBA 3G8BA 5EZQA 3VYWA 3FTCA 4CKEA 2UZ4A 5DX8A 3G2QA 1EAMA 2OKCA 3A7DA 3LPMA 3UJ7A 3GO4A 3BWMA 3JWGA 4QPNA 3AXTA 4X1OA 3V97A 4RVGA 1NT2A 5K0EA 3MHTA 1G8AA 2B78A 2LD4A 3EVEA 5EMJA 3UFBA 4PNEA 2IGTA 5DTMA 2VDVE 2OBFA 2ZIGA 1KPGA 4FR0A 3UJ8A 1G55A 1P39A 1ORHA 2AVDA 4EKIA 5FULA 1RJFA 2AOVA 2ZZMA 4DM3A 1YF3A 1NW5A 4IV8A 5M5BA 4YUWA 4HTFA 1IM8A 3G2OA 3A7EA 3G7UA 3T7TA 4BLWA 3UZUA 4CXMA 2FCAA 3KQPA 4JXJA 3T0IA 3NVKI 4GUAA 4PYLA 3G88A 2AN4A 4E2WA 1SUIA 2FYTA 3X0DA 4M37A 2I7CA 4ER0A 2Q41A 3IEIA 3GRVA 3DLIA 3FUTA 4EMSA 1EJ0A 3K0BA 3VC2A 1Y8CA 1AQIA 3Q7EA 3C0KA 5FWAA 1KYWA 4E30A 1JG1A 3EVAA 3EVCA 4YV0A 3ER8A 3LGAA 1P1CA 5CCBA 1SG9A 1X19A 2Y1WA 3UBTA 2IBTA 5CIYA 2K4MA 4RTRA 4C06A 3UA3A 2AOTB 1UWVA 1NW7A 2AN3A 2HWKA 4MQ4A 4MWZA 4QQNA 4XUEA 4R6XA 5K0FA 3O7WA 4GBED 3UWPA 2C7QA 4H0NA 4RYLA 5K0JA 3KR1A 4QVGA 2ERCA 2YTZA 1ZG3A 5T6BA 4P7JA 5K0LA 3REOA 1VLMA 5E8JA 4E32A 1EQAA 4X61A 1BC5A 3R0QA 3F4KA 3KQWA 2GPYA 5D1HA 3PFHA 3TMAA 3TPZA 3GCZA 4AX8A 3HEMA 3GWZA 5HIMA 3RODA 2ADMA 2R3SA 4RTMA 4DA4A 1FBNA 3DR5A 2ZZNA 4BLUA 2NNWB 1NBHA 4HSGA 5EIWA 3EEOA 2VDWA 4OBWA 2GB4A 3BWCA 1WY7A 4HTFB 3G8AA 5EQJB 3MB5A 2HMYB 1N7IA 3KQTA 4GF5A 4A6EA 2QY6A 2JJQA 3HCEA 1BHJA 1T43A 2H00A 3FTEA 5E2BA 3B3JA 4HC4A 1SKMA 3AWIA 4E2YA 2FPOA 3P2KA 3KU1A 4PYKA 4F85A 3EVBA 1FP1D 5GOZA 2PXXA 3OZRA 1L3CA 4KDCA 4PYMA 1YZHA 3I5UA 4RX1A 5EHIA 5LQKA 4BY9E 3ER9A 5EHGA 1VE3A 1YFJA 3LSTA 10MHA 4FGZA 5LQRA 5CM2Z 2YQZA 4M38A 4DKJA 2H1RA 2ZWAA 3UJDA 3CJRA 4RTSA 3PB3A 4B17A 3NTVA 3RW9A 4IV0A 4KIFA 1NW6A 3G89A 3TQSA 2Z6AA 3HCFA 2IH5A 5E1DA 3UJ9A 5EEGA 5F2NA 1VBFA 3BZBA 5EC8A 4M7RA 3DMHA 1SUSA 1MHTA 2B2CA 2P35A 3M4XA 5CVJA 5HFJA 1JQEA 4LG1A 3LDGA 4AZWA 2FRXA 4RTJA 2CKDA 1AV6A 3KPWA 2JH8A 4CTJA 1WG8A 1R00A 4U7TB 5ICGA 1JTEA 3EVFA 3KQOA 3NJRA 4X41A 3U81A 1XXLA 3ERCA 2PWYA 3HCAA 4BP3A 5KYGA 3DXYA 7MHTA 2EX4A 3BKWA 1YZ3A 5K09A 2BZGA 3GRZA 2XBMA 4DQ0A 3LL7A 4AZSA 2OB1A 1G38A 3T7SA 2AN5A 2JHAA 1XJ5A 3M6XA 3UJCA 5DM2A 2DULA 3K6RA 1O9HA 4Y30A 3TM5A 3AY0A 3OE5A 4BLVA 1EIZA 5EIFA 3P8ZA 5C0OE 3E23A 3PS9A 1JQDA 2PWPA 1RI4A 2UYOA 5ICCA 4ATNA 1ZKDA 3ELUA 1MJFA 2PT9A 2JHPA 4V0QA 2YX1A 3LCCA 3L8DA 5KQSA 2OY0A 1XCJA 1VQ1A 5C1IA 3CGGA 3BUSA 5FTWA 3TKYA 5K01A 4P7KA 5HIIA 1Q0TA 3DTNA 3NW9A 2EJTA 3LKZA 4DMGA 1KYZA 1G8SA 2PKWA 2WA2A 3CBGA 4WVLA 5D1NA 3CCFA 3KR9A 5DX0A 4PYNA 2GA9A 4C04A 5FQOA 3ID6C 4HRAA 4KDRA 4PINA 5FUBA 3BGDA 3P2EA 2NP7A 1YB2A 3HCDA 2P40A 3LDFA 4PYOA 2P3OA 2WA1A 4PGHA 3E7PA 1VIDA 2YXEA 2PGXA 5BXYA 2P41A 5EGSA 4C05A 3GNLA 4RTOA 1JTFA 3CC8A 5DM0A 3P9KA 3THSA 3TLJA 4X60A 1H1DA 1KPHA 1D2CA 5DRTA 3SR4A 1V39A 2BM8A 3EVDA 3AJDA 3C3YA 3V8VA 1KPIA 5EZSA 2C7PA 4GQBA 4YUXA 2QYOA 1YUBA 5C9ZA 1QZZA 3G5LA 5FHRA 1ZGJA 5GIPE 1TPYA 3MERA 1VP3A 3SX0A 4CWAA 5P8WA 5KS2A 4FT2A 3HVIA 4IWNA 3FYDA 5EKXA 4AZVA 1QANA 2NXNA 2CMGA 5F2KA 5F2OA 5FHQA 3UJBA 3M33A 4AZTA 5HIJA 5BW5A 4ER6A 3HVKA 4RVFA 3D2LA 5BP7A 4QQKA 5DM4A 3FPFA 4YUZA 2I9KA 5CVVA 2QRVA 4GC5A 4QVKA 1KP9A 2BH2A 3GRYA 3PT9A 3UA4A 4GOND 5E9WA 4XCXA 3IYLW 3HVHA 3GJYA 3IHTA 3FTDA 3KQSA 4QDKA 4RTQA 3H2BA 1L3IA 2PVCA 3GGDA 5K0CA 8MHTA 2AOWA 1SQFA 4YUVA 2IDKA 4PIPA 3FUWA 2B3TA 3LX6A 3P9CA 1NW8A 3S68A 3B89A 3DULA 1L1EA 3KPYA 3MCTA 5DX1A 2EFJA 5KVAA 3FUUA 3EGEA 1VP9A 3JWIA 1AF7A 3FUVA 2VS1A 3KPUA 5DWQA 3P9IA 5H02A 4E33A 2P3LA 5HOQA 4FS8A 1JR4A 2PLWA 1DUSA 3DUWA 1M0EA 3MGGA 4RVHA 2BM9A 2GLUA 4RWZA 5EMKA 2ZW9A 3FPGA 4ISCA 3HA7A 5ICFA 5LQNA 1AQJA 3QOXA 2JHCA 4K6MA 3PLAE 3KR0A 4DCGA 2NXJA 2OB2A 3FPEA 3PX2A 3DMFA 1XDSA 1JQ3A 3E05A 3FPHA 2FHPA 2HNKA 2FK7A 3FRIA 3TRKA 4C08A 3BT7A 4RTKA 3EGVA 4R8RA 3G5TA 2ZFUA 3M70A 4AUKA 1NV9A 5EG5A 4PCLA 2O05A 3EPPA 3PVCA 5FADA 3DH0A 3TOSA 2JH9A 3UJ6A 3NWEA 2G8NA 2QRVB 1M6YA 3KQQA 2EJUA 4EVIA 2ZTHA 4GOLD 3A4TA 2Y1XA 3BGVA 1QAOA 3DOUA 1RI2A 3FRHA 1WS6A 1JG2A 3I53A 1ZHFA 3Q87B 4PONA 5K0BA 4E70A 2ZVJA 3E8SA 1HMYA 3LBFA 4KRGA 5E9QA 2ESRA 4ER7A 5IH3A 3AXSA 3CJTA 3DP7A 4CKCA 5T67A 5IKMA
chains in the Genus database with same CATH superfamily
5JJKA 4DBLE 1VB5A 4UE6A 4YPFA 5ILOA 3ROXA 2C99A 1IEVA 1K8RA 2AYDA 1X7ZB 1JG4A 1NR1A 2PKRA 4G81A 1DV1A 5D86A 1BQ3A 4DLWA 3RVBA 4XD7D 3MFQA 1MW9X 2C0PA 2CUKA 2Q51A 4JV5B 3NAZA 5CYGA 1U6JA 5B3JC 3I1JA 3M5PA 3SZLA 1RYZA 4QJ3A 5C7IO 4Z49A 1TJYA 4PYRA 4HUJA 5HZGA 3T5PA 3ZWCA 4QDTA 5D5PA 1CUUA 1NKTA 3MINB 2FSHA 1GQSA 3DE1X 4WEQA 2PG3A 2G36A 4WX2B 4HDAA 5DGHA 4CMKA 4JQYA 2ZUCA 4GQIA 3DW1X 4LCBA 1O9GA 4Y2JA 1NPDA 1BVRA 1YUAA 1OTXA 2P8JA 4QQRA 1MVNA 4D1YA 3MTDA 1K6IA 4DC1A 4MYRA 1EQ2A 1XTVA 2MSDB 1F60A 2ODPA 1D2HA 2IH4A 2VP6A 1VYTA 1OFUX 3FYUC 2UU9B 4MGEA 2AUTA 4QU0A 4TTQA 1LI5A 2YWRA 2ZSHA 4ALJA 821PA 3OU2A 3PD0A 2XKBA 1E7MA 4C0QC 4DSUA 2JW5A 3GZNB 1OZHA 4KWCA 4TTVA 5GV8A 2W43A 3OZFA 5BV2P 3GLUA 3JD0A 4F9EA 1WD5A 1C7JA 4ENUA 3QA3E 1CEYA 1BWQA 4ZA2A 1ZUNB 4MQFA 3MUFA 4S1OA 5JAQA 3ZK8A 2G4CA 3I8SA 2DJIA 4B34A 2ZB4A 3EX7C 5FPTA 1TYDE 4FB4A 4Y1GA 3GLHA 1BQ4A 1U31A 1J2YA 4ZDIA 1DRWA 3VX4A 2ZWVA 3RRZA 2ZJ3A 3JVVA 3OU7A 2XPCA 1JPUA 1Y8RA 3DM5A 3X2EA 1KEEB 3BIWA 3QVMA 4RDIA 3DJFA 4H9GA 4JOSA 1ZVVA 1YC2A 3O90A 3QXGA 3OT1A 3FZGA 3HOYI 1VSTA 3K32A 5FNZA 5FWDA 4A36A 3VI3B 4MCAA 1T4GA 4F56A 5GPBA 3G9XA 1AZLA 4IJWA 3TVDA 3VI4B 3LJKA 4EKGA 2PNFA 4IG4A 1GQ2A 2JARA 4U63A 1W94A 2HIAA 4Z86A 1BDHA 3I6MA 3F90A 5EE3A 2EW2A 4IDBA 5EERA 3HR8A 5BQPA 2BGMA 1P1KA 1OWOA 2OGZA 2JFFA 1ST3A 5LQAA 3ZV5A 2OV2A 5AI5A 3TRHA 3DYVA 3L46A 4L0DA 4EHDA 5B3LA 4KFRA 1Z8HA 4F9FA 1IXRC 5DSTA 4CEHB 2P3QA 3E1SA 2QY9A 1GDHA 3P9PA 1W7AA 2UUAB 2WG0A 4QJ4A 1I32A 5ITZB 1J8VA 1T1JA 3JQGB 3Q85A 4FMPA 5JANA 1C0KA 2I6TA 4YJ3B 1N8NA 5FYQA 4KPUB 2W4IA 5KQLA 4BRZA 1VFNA 2ZYTX 1CS0B 2V8KA 4HMOA 2IV3A 4RFSB 3TVYA 4U2FA 4FBGA 1X7XA 3N76A 1B6RA 4IGFA 1CZUA 4JCOA 3QEBZ 3A3KA 5F3WB 1E9FA 3MYRA 4UDOA 1Q0SA 4FGUA 4Q4JB 1KQPA 3KB2A 3TTUA 1TX4B 1UJMA 1W48A 1D0VA 1RWMA 4OM7A 4M87A 1H2XA 3WMXA 2IBSA 5HRCA 3GLIE 2ZIXA 1K3TA 3WKAA 1C1DB 4G1MB 4EVSA 1TE2A 1JHAA 1ML3A 2RB4A 3RVDA 3UK2A 1A8SA 3QKUA 4WJKB 3BMNB 3TZEA 2Y66A 3CR8A 3L77A 4OU5A 1N3IA 3DBLA 2EU8A 4ND7A 1R6DA 2WK1A 2BFFB 2FE4A 3I2FA 3D1VA 3WLPA 2A3RA 2QPAA 4TV9A 2AB0A 2JKYA 2JZCA 3CRW1 1RIIA 2CDNA 4FOPA 2PXHA 3L7NA 5CX1A 1HE8B 4BO3A 5LR6A 3DKKA 1BFKA 3IV7A 2FGJA 3N0VA 1XZPA 3LBYA 4RA9A 4L5YA 4C4AA 2B1JA 1V0JA 3SYLA 2Q1YA 3I09A 3UH1A 5K0SA 2Q1WA 4MW9A 4TSFA 2GYWA 4DRZA 2AFIB 4NICA 6ADHA 2J5RA 4EWCA 2AW5A 4TYMA 2Z8YM 4ZAGA 1TMOA 3WTBA 4HX2A 4PXYA 1WUKS 3G59A 4Z0NA 3F6EX 2PJZA 3HZRA 4MVJG 2BKVA 3HFJA 4WOKA 2W6QA 1CD5A 1IN8A 1LFAA 3GFPA 3N6RA 1EUDB 2P0AA 3HWRA 4FWIB 1XTKA 3Q3JB 3BXXA 1X6VA 3RTCA 5KU7A 4NVRA 5IF9A 1YH3A 5AVTA 4DW8A 5HZMA 1WPRA 2BKXA 2K6GA 4YJ3F 4A73A 4YAGA 2Y1EA 2G9VA 3WWDA 1U3VA 4EQZA 4QTYA 3OCWA 1JJAA 4IMPA 1SBNE 9GPBA 1KO1A 3NVAA 1Y34E 3IVRA 4GMXA 1FLVA 3IEXA 4GM4A 5B7GA 2Z1DA 1UFVA 1NWHA 2C8JA 3FBTA 4PRZA 4LDQA 1TQ6A 1UJ6A 1SK9A 3TCKA 5DT9A 2IY9A 1YBAA 1ESMA 2OGSA 2QLLA 3DOEA 4OU4A 4Q3BA 5HXAA 1T2AA 3C3XA 3BWEA 1XZQA 1NNI1 2JIOA 1P7PA 3BS4A 3D4LA 1HDEA 3GEHA 3D43A 1J8MF 3C8DA 5GIOE 2J3HA 1C3VA 1W5TA 1XMPA 2YXLA 1M0TA 2XITA 3I37X 4KE7A 4K6CA 2H1LA 1A9XA 3BWVA 3AL0C 5I7UA 2ID7A 2IIPA 1U2DC 2P5TB 2VCYA 5FV7A 5B1SA 4D92A 1QYDA 4A3DI 4IMJB 1D2MA 5K1ZA 5TMBA 2O50A 2OHVA 1Z12A 4Q7JB 1ZRNA 2W6JA 3H2SA 4GS5A 1DZIA 4R2LA 1GRVA 3IUYA 1QRSA 4R05A 2WU1A 4EUEA 3JQBA 1ESDA 3ZLBA 4C4XA 3AERA 2ZDGA 3JWEA 4FYYA 2J1LA 4MQEB 4YUYA 2FR8C 4AJ9A 1X7WA 1N9GB 3NXSA 4LJ4A 1A9ZA 4NP6A 3F7MA 4J6EA 1XNQB 1UIRA 3BREA 1R9JA 4X92A 3KKMA 3PDCA 2Z2ZA 2HRZA 1HFJA 4KFUA 2YZGA 3AJ8A 1YZUA 1XVVA 4ABYA 1BJRE 3HP4A 2QN2A 2RCYA 2X7HA 1E7RA 4G85A 5M7EA 4KIGA 3WL7A 2OKCA 1U8XX 4ZVVA 3NRCA 1D2RA 2CCJA 4AVYA 2Q9BA 1DCMA 1C8BA 1G8AA 2CF6A 4KU4A 3GJ7A 3BM5A 3TN7A 1N2OA 3KO8A 5DTMA 3F73A 2Z5FA 3HJCA 1DXHA 3MWEB 3TOZA 3JQAB 2V8JA 1JIIA 3M9XA 5T3YA 4ZGWA 4S05A 1GLNA 2Y2VA 1E5XA 4LE0A 4TM8A 1MXHA 1PYGA 2OAEA 1A97A 5D7NA 3L92A 4KQEA 3G9UA 2EYUA 4ZQBA 1JR2A 2BM1A 3F8TA 2W4MA 3GUUA 4O4JB 1ICEA 4JT2A 4RUKA 5C52B 3N07A 4JXJA 4QVIA 4PYLA 4ZHQF 1XEFA 1B8PA 1JR3E 3GPBA 4E2WA 4V0OA 2R8XA 1XMXA 1YQWA 3X0DA 1Z2PX 3EGXB 3ST7A 5SYMA 3IQXA 1OVGA 4C14A 3K0BA 2PZGA 1A7AA 1XJWA 2PH1A 1GEEA 4FCTA 3GCWA 5GY7A 3VC2A 4BMCA 3NPAA 1T6XA 4D46A 1SXHA 4RFLA 5ECDA 3H9JA 5BOVA 1A3CA 2O48X 2V5VA 1KARA 1Q57A 3CX3A 1TVKA 1NJFA 3B1ZA 3GBPA 3LRPA 2XTAA 3QMWA 4AKHA 3PDIA 3DQPA 4IXNA 3SBEA 2Y1WA 3JR3A 5DCWA 5J2TA 2J5QA 2JJYA 1XQ6A 3UAOA 2JCXA 4RQBA 1UWVA 2AN3A 4M98A 3BFJA 1FRFS 3MMSA 3U9TA 4D4LA 1ADFA 2REBA 4ZTUB 3T3NA 5KCMA 1G3RA 4BUCA 4ZHQB 4B48A 4UEKA 5CVTA 3NH8A 2OG2A 3HV0A 3V4OA 5T6BA 1C7QA 5H0IA 2OWEA 5BYBA 4AY3A 3D0RA 4OLJA 1KK2A 1BC5A 2K7ZA 3SQMA 1QS0A 3PEYA 1VLQA 3ETJA 1SU6A 3PFHA 2RKBA 1O2DA 1C7FA 2RGWA 2FUG1 1EUCB 2NQ2C 3GDGA 4Z0HO 5EIWA 3VNQA 2ZTVA 1GTVA 4P53A 4QRIA 5G41A 3K8QA 3BPSA 2H1CA 1X7DA 2NSJA 3KQTA 3PGJA 2HA4A 4UDNA 3MC1A 1ZDMA 3UQZA 2J46A 3RS8A 4R0MA 1DCTA 1U2GC 1WCV1 2VQFB 2MSNA 5C1DA 3WL5A 1FW6A 2JI7A 1BX3A 1NNUA 3C7DB 1YRHA 3KU1A 3U26A 3TTYA 2VXBA 2YMPA 3BK2A 3S44A 2DFTA 1RAAA 4B4UA 4DGQA 4ZICA 1DEAA 1VE3A 3DZKA 1H2ZA 10MHA 3CT6A 4O4JF 3H1BA 5ALEA 2H0QA 3RBVA 1VHQA 3RKRA 1H1TA 5DWVA 3EERA 2AMFA 1XX6A 4JAVC 3ASYA 2O1WA 3CS3A 3HBFA 5KDDA 1NBWB 2X6RA 2YYZA 3QLTA 4KIFA 4ZC1A 4AG6A 1I6WA 1QH9A 1BG6A 1FVHA 2HWXA 4LXXA 2RE8A 4IZOA 3BZBA 2AZDA 3JYHA 4RLHA 1E2MA 1PR9A 2I78A 4DTIA 3M4XA 3ADOA 4BFSA 4QM6A 1QGUB 5REQB 1KY4A 1X3LA 4J0QA 1UPXA 1E4VA 1YVEI 1A9QA 2BE7A 4MITA 5L3QB 1WG8A 3KAQA 1RRVA 1DJNA 2W48A 2IPLA 3IP9A 1RC1A 4JVMA 4D43A 1UMCB 4UPEA 3ORFA 3KUXA 3ZE6A 1M54A 2MOKA 1Q7RA 3FPSA 2OCXA 3H0KA 2HSEA 4YTEA 2JGAA 3ZDXB 4HN2A 4DUPA 5CM2M 2HUPA 2AHRA 2OGTA 3JR7A 3JRNA 1G7SA 1JHMA 4FZRA 5ECGC 3T7SA 3ZZUA 4XVQA 2M1ZA 3C6BA 3S1RI 3D1LA 3E4DA 3CCMZ 3M4NA 4N47A 1D6NA 1KYIA 3A2NA 2J48A 2PYZA 4TQGA 4OHZA 2QN9A 4L4XA 3KC2A 3K2QA 4BLVA 2A94A 2X8LA 5TEVA 1X9HA 3RVOA 3L7JA 3LF2A 1RAHA 4JK3A 4M60A 3E23A 3PS9A 4D3FA 1GR1A 3ISVA 5GJCA 3DMRA 4I9NA 4E12A 4EAQA 1PK9A 1Z2DA 3IERA 4FFDA 2J9FA 4LDPA 4B6RA 3L1JA 3UK0A 1KS9A 4MUBA 3S7ZA 3LV8A 1U8YA 3EUAA 4YONB 3WRVA 1CEXA 2CKMA 5DCYA 5ER9A 3GG9A 3HLYA 3DTNA 2ET6A 4OMDA 1YONA 3WIBA 4R83A 4S1TA 3ABSB 3VR6H 1HRKA 1Y9JA 4W1SA 1CRLA 4EFNA 3QUAA 2OCBA 3CCEZ 3KV3O 4DLBA 4ZI7A 1D7AA 2A1UA 1FDUA 1K5HA 4DUZB 3WP1B 3N6VA 4UAVA 5JNSA 2N75A 2XOEA 4NBBA 1BVUA 3V2GA 2F43A 2O8VA 4EYKA 4AJNA 1EB8A 2XZDA 1MORA 2V0CA 5BXYA 1FQKA 3TSWA 4YRPA 1ECCA 5AHOA 2ZITA 4YCBA 1S5PA 4M8LA 1TIPA 3W9SA 4CL2A 3CYFA 1O6FA 4B2YA 4DKXA 4NARA 6YASA 1YJN1 2G76A 1E3IA 5GOTA 1T1GA 4KI7A 1B6SA 1CULC 1XP5A 4O4LB 3UAWA 3GI1A 4C4OA 3DPSA 4NH0A 1JHXA 1MAVA 2FZCA 3SU8A 1FZQA 1PLLA 2B3DA 4URVR 1CUSA 5IBRA 2FKNA 3M81A 2C61A 5CK4A 2Q2OA 4H1HA 1OAOA 2DHDA 2NO9A 1DHRA 2Q5QA 1Y1VS 2AJLI 2H2FA 3ICEA 1RTKA 1FMJA 1NFFA 2F1KA 4EY7A 1LU9A 4RVFA 5EY5B 1DKMA 4MRMA 3TFOA 3GRFA 4LHEA 1YA6A 1N1DA 3QKIA 5C5DA 3MWJA 4RA6B 4QBHA 2V7UA 1PGOA 2GAJA 1GPKA 4JL6A 4I4LA 3G0CA 3KOOA 3VNRA 3TBKA 3UJPA 4X1IB 4BEJA 1Y7HA 1DXYA 3GLTA 3T5MA 2OTJ1 3WYCA 3QSYA 4FFRA 3OA2A 3I5AA 4B3BA 1UODA 1U0LA 3KSZO 5BXQC 4C89A 2RJOA 2J4CA 4BO6A 5HGJA 3NUQA 5FXMA 4ACBA 4D9HA 3EA0A 4YUVA 4ZCMA 1QUEA 2VTEA 4ID3A 4PIPA 1XIVA 3SSAA 4D5GA 1IQRA 2QTNA 1NULA 2FV8A 2UDPA 3LRXA 3BCHA 5LOVF 1FOEB 3B89A 2QAGC 4CU2A 4RDXA 2P4UA 5A4DA 3C3DA 5B1HA 3W8NA 2P67A 2FFHA 3KPUA 2DR2A 2DE7A 1D1QA 4GR9A 1WIWA 3HNPA 3VYVA 3QEAZ 1JR4A 3C3AA 1Q1NA 1DUSA 5EYPB 2R5NA 4E5SA 4QGBA 2WPNA 1WX1A 2V8BA 4HQNA 1N6IA 2GAAA 2WUFA 1HOTA 5CVCA 5IKXA 4UTPA 3FLBA 2WF7A 4K6MA 2QF7A 4YHHB 5HBRA 1PL6A 1CRWG 3FW1A 3N0RA 1H3NA 1GL6A 1E79A 4BL5A 3EQ8A 4HDMA 4RMHA 1IB6A 1GM5A 2FK7A 2YW9A 4MYHA 5C31A 3ZWOA 1GNSA 3QELA 4REQB 2J3EA 3KM0A 5T4FA 2ZRBA 2IYTA 2M6NA 3NETA 1MVOA 5SZIA 2AR7A 4TUYB 4WK4B 1R6BX 2FA9A 2JH9A 1U1GA 1GGMA 3K53A 3LHSA 4YCAA 3WI7A 1IHXA 2GN6A 5LDDC 1DAMA 4Q1FA 5EMHA 2Z2KA 3WDMA 5BWOA 4LQ4A 5I4CA 4YIHA 2VDQB 3ACCA 2QTGA 1KC82 4CM8A 1R0LA 4GM0A 1M1K1 1NFRA 3E8SA 1GG9A 3KP1A 4ECAA 4DNFA 4ILKA 4M46A 2PA3A 2HYIC 5IH3A 2JGLA 2WUVA 1KOFA 2C4WA 3NONA 4OHWA 4QUIA 4FYJA 5B3AA 2E9SA 2DXIA 1I8TA 1TJ4A 4ENSA 4XAQA 4FMBB 4OP3A 3OIGA 3W8DA 2ZP1A 1E3QA 1TTHA 1CDOA 1AVTA 2BEWB 5KUTA 3FYSA 2Q46A 3BSFA 4HF7A 1QPGA 3IVAA 3L93A 1YL6A 1Y8ZA 3T4NB 4LF7B 3R9XB 3NV7A 2A9OA 2P5YA 3H16A 5FJIA 3RKSA 2XWBF 5DN9A 2DH6A 3I52A 4EB6B 2G83A 3SX2A 1UL1X 3MQ2A 1EVEA 4BE7B 2Q99A 4YN3A 2UZ1B 4JU9A 2J08A 5JQWA 3A58B 5L4LA 1NWCA 1TAQA 4GYWA 4KMOA 3D8SA 1CZHA 2RJ3A 4NH4A 1OKKD 3OW2Y 3KEMA 3OMLA 1GAJA 4WINA 1OU4A 3CRVA 5AHKA 3WLAA 4C76A 4MS4A 4LBVA 5LP1A 1OGYA 1KK0A 2QV7A 1NW3A 2ZI4A 4NYMQ 4CM3A 3OZEA 2CMDA 1M66A 4WACA 4HDNA 5D5HA 2QNRA 3DF9A 1LSSA 1JQJC 4WZ6A 4ZT7A 2R47A 3STXA 3AJRA 1E1RD 2VJMA 3RYIA 1Y48E 1GDDA 3UAYA 4DG8A 5FB3A 2C4HA 3Q0IA 5CFNA 1GZ3A 3HXTA 3GLRA 1FP2A 1G18A 2G72A 5ELMA 4TUYF 2OESA 5AVOA 2VHZA 5C8DA 4DN6A 4A6DA 5JS7A 4ZKEA 1T1RA 3AP2A 1DFIA 2AOXA 3CH6A 1NIPA 4HLQB 4MVJD 4IW3B 2HW8A 5TPWB 4ZYXA 2NVYI 4PEVA 4AKSA 3LUAA 3ROQA 3A6FA 3OETA 1T3TA 1ZUIA 4BO9A 2YVLA 1KHHA 4JCCA 4Q18A 1YZLA 2AG1A 2R1VA 5KJ1A 3JARB 2QJTA 2C9MA 4MNTA 1KWKA 4KQ6A 4CYMA 1REQA 3AR6A 4NZNA 1DAOA 3NHUA 2XUKA 3G2MA 4K9DA 5ALNA 3B7PA 3V1YA 1YOVA 3W9YA 4FMCB 5LP6B 3M4YA 5CT8A 1XZKA 2PTGA 3CA8A 3GRUA 4WRRA 1Q84A 2QR3A 3SC6A 3EGDA 3B5IA 3LFUA 3R24A 4DLLA 3SVTA 1PN3A 5DM70 1YE3A 2C4TA 4E2XA 2VJPA 1HTWA 1IEQA 1RE1A 4FNMA 2NO4A 5BR4A 8ABPA 4LYGA 3O4IA 2BI4A 4TLLB 1BMTA 2C7VA 4Z4FA 1BE6A 5GQSA 4D44A 3IAM6 5K4HA 1IK6A 5JD4A 1SVIA 1KVSA 2W2LD 2X4LA 3IUEA 4HNHA 4EI2A 1X38A 5A7GA 3AH8A 3IJPA 3HEBA 4HG2A 2R7MA 5TC4A 3BD7A 3L0OA 1QC5B 3RLFA 1V26A 1SPXA 2XVXA 2PPVA 1KXJA 4XB2A 4D4IA 3VX3A 4JLUA 4CN9A 3NJ8A 4OBXA 3AI1A 2GYYA 4JIMA 1PVVA 2WHPB 2AI3A 4P4SB 3RSLA 2D0DA 4CG0A 5KX5A 4BJ5A 1J7KA 1H9AA 1KZYC 5JUWA 1AD2A 1HWYA 1FX0A 4K9OA 4ONEA 5JY6A 5A9SA 5JQGB 1FSGA 2HMAA 1I4WA 4WOBA 5AW5A 4F92B 1WZEA 3I5YA 2PTHA 1D03A 1PVDA 2VA9A 3UT5A 5KYXA 1AMOA 5K8TA 4S04A 2W2KA 2NV2B 1N5DA 2VHXA 1CIJA 1H94A 3E8MA 4IQGA 2XUJA 2VAPA 4JA2A 4LOJA 4YRTA 3PQ3A 3K92A 2I0FA 3QVWA 1PR0A 3UV7A 3IPLA 2YC2C 3PQ8A 1D2GA 4Q9JA 3CXCY 1H5QA 5J4LA 3AL2A 3OLVA 2FZLA 1Q7Y2 2DCMA 2ZVQX 3WK5A 4F5EA 4X8HA 3B1YA 2GCOA 1LF0A 4FKMA 3TR6A 2X14A 1VLZA 5B57C 1KZ7B 3UPTA 3FPJA 4PC1A 3SYMA 2BDTA 1OBCA 3KYCA 4FMCF 4DLTA 1SXJC 3N28A 1QIIA 3RTAA 1DOHA 1WKCA 5HQJA 3WWEA 5E8RA 4JI5B 2ZIWB 1DCFA 4OCZA 2RHWA 1LSJA 1NX9A 3I8OA 3KZOA 2WTUA 2GN2A 5LXTB 1VKJA 1SKUA 3QG1A 5CD9A 2QMUA 3HZOA 3Q12A 1NLYA 1OXUA 2QX9A 1WMFA 4DZTA 4B76A 2VK8A 2Z2JA 4K9SA 4TTSA 3O83A 4KXNA 3E1KA 3CZMA 4FJ0A 3VU8A 1RM5A 3W34A 1U80A 1K27A 4MKGA 3LUHA 1V8DA 5BN4B 4Y6LA 3X1KA 3NC4A 2CVFA 4BB9A 3DVSX 3WLKX 3GJ8A 1NV8A 1SA0A 3DOIA 4CW7A 5BWLA 5JH7A 1ZCFA 2UZAA 1CJUC 2ONZA 1P2FA 1F8XA 5JZ9A 2AXQA 1SBYA 2Y6VA 4OHMA 3DVRX 3E58A 4BNFA 2JFPA 3QTTA 4BVBA 4BJ1A 2W5UA 1QPZA 1ZD4A 3LC1O 2OYRA 4TL9A 4ND3A 3RT1A 2NXWA 1NF2A 5A4KA 3I2GA 5DBIA 4TZTA 2F90A 5CBPB 1W0KD 1L4HA 3WLEA 2HDOA 4DA9A 4CG3A 5IJZA 1ORWA 1KD12 1KY3A 3PNKA 3NAQA 4ZAXA 1P31A 1SR8A 1E3EA 2P4HX 4D9CA 2Z9BA 2GH1A 4QX6A 4AYWA 4CMAA 2Z8ZA 3EF3A 2GCIA 4GWKA 4FWBA 4NG4A 4ENQA 4K7JA 1C29B 5EJ5A 2FR0A 3LVRE 5EMMA 3FXAA 1JYSA 4F45A 5CFPA 3PXAA 5HK9A 3PC3A 3QOWA 1ADJA 3BGWA 2I3BA 3QKRB 1P18A 2Y1OA 1WZNA 4YRQA 4FHEA 5F12A 2DFKB 3FF4A 4D9IA 4YBZA 4GDMA 1GL3A 1UT8A 2AOTA 3H13A 4UTXA 3NWJA 5DK6A 5DTRA 5I9LA 1A7JA 2WKWA 3AHHA 2X7JA 3C1TA 3UICA 4HDSB 3SQWA 2UYYA 1WHTA 1G2PA 3AESB 2AF3C 3KTOA 4HLCA 1ZVMA 2ZE5A 3F6CA 3QYPA 3WYNA 3ZGOA 4X7RA 2WF8A 4R2MA 3BFPA 3A7DA 1P9OA 1U0HC 3GO4A 5A9TA 5JEEA 3TZLA 4DR3B 1R64A 3QLVC 3P32A 3V97A 4O08A 4Y6RA 3CKMA 2RC6A 5EMJA 2VNJA 5LXTF 3Q9UA 2DBYA 4J1NA 4RADA 2NU8B 1ORHA 4FFBB 4ZVTA 3DBHB 3FTQA 1S7CA 2DE5A 1G98A 1IAVA 1OZ0A 1UKEA 3KAJA 5K3EA 3JAMb 2BGUA 5EHXA 2IXEA 2VUTA 1JAXA 5IM5A 4BMXA 3PUZA 1CUEA 4BRWA 3KQNA 2C29D 1NAIA 1XD2A 2IKQA 3BCSA 2AW3A 3OPYI 3QWFA 4IVNA 3BHNA 2C4MA 3G88A 4PX5A 1FP4B 5GV7A 3BMXA 1LEHA 1LQ2A 2QLFA 2DBQA 1U0GA 4TXJA 1SC6A 3PXDA 4W5JA 6CHYA 5KC8A 5IBPA 3FB1A 1I3LA 2HDHA 2YIJA 1M2OB 1LVHA 4KUEA 2O2DA 3DQZA 1QE0A 4LE1A 4ESEA 3SQXA 1Y0BA 3NP7A 3E9EA 3K0KA 5EHNA 1XU7A 2VHUA 4JBWA 4R1LA 1ND5A 1X92A 3HFSA 2QAIA 5LWHA 3M0EA 4BBZA 3OQMA 3J81b 2HFKA 1WCMI 4A6PA 2JLXA 2CJXA 1QORA 4XR4A 3PUIA 4Q24A 3O3OB 2B8EA 1WZIA 1GQFA 4UNNA 1QP4A 3ZNQA 1C80A 2JAXA 2O2SA 3Q7SA 1ZESA 2W6PA 3FMVA 1Z5ZA 3D4PA 1DINA 2JPDA 3D6AA 3PHJA 4Q01A 3RUDA 3UWPA 4RMJA 1IY0A 4RYLA 2FPPB 2FVYA 1RWKA 1G17A 2OHGA 2YW2A 3JQ7A 3WV5A 2GHRA 2GN0A 3DEIA 3SYRA 4D97A 4PFJA 1ZH0A 2IBMA 4HHEA 5J3JA 3EZ6A 1ELOA 3TRJA 3GP8A 1GHTA 1H5UA 3QJYA 4BKPA 3FQQA 2RGCA 4MIEA 3PUHA 3HEMA 3GRAA 3O8CA 2FOLA 1DZ3A 2EWMA 4EF4A 2XZLA 1U3TA 3EFOA 4GX0A 3H1TA 3N3BC 1G19A 1P4GA 2VWQA 5IASA 4OHRA 3I5XA 2VDWA 1Y6QA 4UFOA 5I4IA 2CNBA 2R48A 1Z01A 3FOFC 3A6PC 1DLIA 2FFBA 3SLKA 1G63A 1PO7A 2TMDA 1BX0A 1HQCA 1ZMTA 3Q2KA 1K9VF 4MDYA 1YJ9Z 2YJ6A 3I83A 3OJLA 4KACA 5FAXA 4DDMA 3GL9A 1N4AA 1E2HA 2QB5A 3HYCA 2DTDA 2QG9A 5HDQA 3NM5A 1ZXXA 2AC4A 4JP1A 5GOZA 1XF9A 2QVCA 4UTOA 1T2DA 4KDCA 1YZHA 3JRWA 4YX9A 4Y52I 2VWPA 3RYTC 4CIYA 1T36A 3FHCB 3T5CA 4QRHA 2VPTA 1E60A 1UAGA 1XWFA 2BBOA 2G28A 3HDTA 5AM0A 5F5NA 3ITNA 3UCEA 2A9KA 3CRZA 3ZY3A 1MJNA 1Z6QA 7ADHA 5F23A 4EGCB 2VDMB 1OH5A 4KNYA 2L18A 1EP1B 5FPSA 4XYMA 4LJ9A 1N2ZA 1UZNA 5EEGA 1UM9B 1I7SB 4CMJA 3A1TA 2KJQA 1S9DA 3H5WA 4V2UA 1Z17A 3ZOKA 1Y63A 1PJTA 1ZFNA 5U4QA 2RI6A 1J99A 3V1KA 2FRXA 1JL3A 3QX8A 3NX4A 3CRNA 4CTJA 1YIJZ 3IV9A 4OMFG 2JFOA 2CMKA 4DQXA 3HXMA 1D1SA 5FPHA 3DDSA 2B4QA 3RSOA 4BP3A 1NJ5A 5K09A 2IYPA 4AZSA 1IUOA 2GXQA 4N3CA 5E0OA 4NJMB 4E7OA 5AQEA 3KE8A 3QPBA 4I6JA 3M6XA 1VQOZ 1RLYA 1E4OA 1R3DA 2PZFA 2FMKA 4IH9A 5DM2A 5LYYA 3QMPA 4RKQA 4Y9TA 5CRIA 1ZWKA 2TMGA 3V00A 2C83A 2I2AA 2J85A 4FX2A 2WV7A 1RT9A 4NSNA 2DM6A 2H9AA 4P36A 4OQ4A 4RWEA 4URXR 3T1YB 3BXZA 3EIOA 1PQUA 1VJDA 3EQ9A 3O8DA 4XM1A 4DDKA 5IDWA 3HB4X 1VG0B 4TS9A 1YA4A 1BGXT 1L5YA 1GPYA 3MTQA 1E5TA 1ZBQA 4TT3D 1VQKZ 2DE0X 3CCL1 2FRDC 3N2LA 2EOAA 3UPDA 4OGGA 3DQQA 3U17A 3JVUA 2QQGA 3KZCA 1CB0A 3AR9A 3N87A 2JRLA 3QXJA 3LKZA 1M7HA 3BXHA 2DPHA 2PKWA 2Q7OE 3CBQA 2PPLA 3ZQ4A 2IK8A 4KR6A 2OHFA 2YQ5A 1NGSA 4R1PA 5FQOA 1D4OA 3ZK7A 4PINA 5CDYA 4Y1RA 2CSUA 5JD5A 1CJTC 4Y3UA 1M8JA 3Q3HA 2BFMA 3AMVA 4RAQA 5T57A 3JVIA 1GL7A 4BMSA 1H0KA 2JIQA 1PR5A 1QPBA 1XU9A 4KN5A 2UZIR 2BBTA 4ZO9A 1SD2A 4CETA 1UXHA 2E1RA 2ZPAA 4LQDA 3AO0B 4NCAA 3DTVB 3GD5A 2IZ7A 4E13A 4XWAA 1PT5A 2GPBA 4LSWA 4M7OA 4QXAA 4WXRA 1EGAA 3MW8A 3ZZ1A 4RY2A 1EEXB 1U02A 4KLNA 1QG0A 5AFSA 1ZOPA 1PGPA 2C4KA 4GRIA 4JUDX 2Q4RA 3KJXA 3LPNA 5FO0A 2OKGA 1O6CA 2I2DA 5P8WA 2O6HA 5CB4B 4PHTA 5IAGA 3W5VA 4DZZA 4EBBA 4AYXA 3W5SA 2XXAB 4HQFA 4L4UA 4WGGA 1N25A 5C34B 2IQIA 1JE1A 2BGLA 4AXXA 4R0VA 4B8YA 1N1MA 1SVOA 3GRKA 2LTAA 3UXMA 4F91B 3CT4A 1EXMA 3RSZA 5IBCA 1MZPA 3HU5A 5CVVA 4OSOA 4EPVA 5ISMA 4HOYA 4Q4DA 4ARSA 1ZNZA 4Q9AA 1NJ8A 2WJPA 1JIJA 4RH1A 4GX2A 4MW0A 3QX9A 5BSMA 3ZVKA 1OAKA 1HG0A 3TLMA 1UBKS 1V3QE 4I8IA 2F4VB 1C3LA 3DC7A 1V16A 2XIJA 3AF1A 3FBWA 3NV9A 4UUPA 3LMKA 5CU7A 4JL8A 2P2CA 1AGYA 4D42A 4E07A 4FBLA 3ADDA 1ILEA 1W35A 5THXA 3CUKA 1GGJA 1P19A 3Q7RA 3A1DA 3K05A 1T1IA 1XEXB 2V6BA 1QHFA 5JYCA 1HA3A 3I72A 3VHXB 2EZ8A 1SVSA 3BG5A 1X14A 2IYRA 4QARA 5KSOA 4M83A 3WHKA 3LD9A 1X2BA 3BAZA 4U7HA 2RAUA 3AFMA 3AVOA 4UD2A 3HO1A 4W5TA 4EKYA 3LT0A 2A5GA 5JXJA 2QN7A 4RVHA 3MGGA 1OFIA 2ONJA 1CRZA 1XYVA 2E6KA 2CLIB 2GUGA 3K1ZA 2W71A 1WMEA 4M0PA 2E2II 5EE0A 5JCJA 1N0HA 2J9RA 2JHCA 2O2EA 4UNIA 1CUBA 1JQAA 4ZOLA 4DCGA 2W8ZA 4WZBB 2W70A 4F3TA 3DWIA 2Z0MA 3P9RA 3IIIA 5HE9A 3E61A 4RDCA 3RDPA 2XE6A 2XDAA 1LBSA 1JZTA 3DR3A 2MSKA 5ANRB 4H7JA 3WYGA 3WFIA 1RWVA 5L51A 3KT0A 4RJIA 4UJ5A 1M5TA 4WKBA 2YWBA 3EPPA 4KODA 4BGDA 1PJ2A 2GZDA 2OO5A 3OZAA 3SHQA 5CB4F 4TLDA 1TVMA 3EVNA 3RGWS 4B3DA 4BB6A 3MAJA 1XB2A 3E7WA 4LDRA 2VTBA 4BNXA 1IY1A 5JW6A 2G3YA 2VSNA 1CNEA 3T3EA 2RGDA 5G0WA 3EK2A 4V3BA 3K70C 3ZHOA 1ATIA 2TYSB 1KAOA 1N8R2 4IFBA 3HSSA 2AFVA 5IJ0B 1QE5A 4N7RA 2BTEA 1Q811 4WXMA 1R6VA 3MOSA 4B6JA 3B1KA 3ZDCA 1UQRA 4BYGA 3C7CB 4E3WA 1SXGA 2NSHA 3QENA 1CR1A 3EBOA 4WQMA 2L19A 3UANA 2J31A 4GYJA 4TXHA 4MO9A 5SYNA 2AN9A 3DCIA 4CBVA 4EJ0A 2WJVA 2PAAA 2OV4A 4FNOA 1HYHA 5K3DA 1VQM1 2EGHA 1EWQA 3PUJA 3VZBA 4BNHA 1YJW1 1R9GA 4IZIA 5IAEA 5BSGA 3GRCA 3JVEA 4RHUA 1C1XB 4LVUA 4Z2YA 3MS4A 3G85A 3PC8A 1GAQA 3BD9A 1RS0A 3VV2A 1BKYA 1M7BA 2XYGA 2A9FA 3CKKA 4Q9NA 4R9SA 2J3DA 2COKA 3AILA 3AF2A 3E70C 3R6WA 2E2HI 1EX6A 2NU6B 3NWBA 1Y1PA 3K1JA 5I9TA 1SC3A 3OLXA 4S0XA 1UJCA 2QX7A 3GEMA 5LUBA 1CZLA 3WYDA 2VZEA 5JBIA 1NNSA 4QSMA 1EJ2A 3CIFA 1JB1A 4P4LA 5EOVA 1Z13A 3RVKA 1USPA 1SQ0A 4K9NA 4C03A 2QZZA 2O54A 1LDYA 4DTCA 2XI4A 3JYPA 3KPJA 5AKIA 2J45A 3T7AA 2BWJA 3PEWA 1R0ZA 3K9LA 1D0SA 1U8EA 4C29A 3QNUA 1LVGA 1YCDA 4ZPJA 1ZIPA 3BH7A 5F7OA 2QP3A 4DV4B 2FHSA 3ZNNA 2VPQA 5EHZA 1ZA1A 4IGAA 1PZXA 4TWZA 5B4TA 4J3JA 2O0LA 5C1PA 2PX0A 2X0EA 4E5KA 5ITSA 5MN4A 5KNDH 3PJRA 3ZGVA 3DZCA 4C6SA 2J6IA 1RJGA 2H48A 3OWOA 1VMKA 2LXNA 3DXZA 3WMWA 1E69A 2V6GA 2H29A 4F0JA 3PQEA 3ZWQA 4MRNA 3OLZA 4QYSA 4LC9A 2WQ6A 5C5IA 4J07A 3RADC 1E4EB 2HHAA 3AUUA 4ZO6A 4YH1A 1F4PA 3SHWA 2WJAA 1NBEA 4KRXA 4IIVA 5H80A 3QX7A 4CKZA 4B80A 3OG9A 3SZGA 3H1PA 3AF5A 3KKLA 3LF1A 2OCLA 2GNPA 2GQ0A 2A3NA 2I34A 3N2GB 4Q4LA 3TLZA 5DTIA 1KTIA 2N1MA 5FUXA 2QRPA 3LI2A 3KELA 1QG4A 4GR5A 1JG6A 3S2UA 1OLUB 4DCJA 2O8FA 2IS2A 4P34A 4P7FA 1RI1A 2IPNA 3CUEF 3O1JC 4LA4A 4ZK6A 4GKAA 1BMQA 4K9LA 1CQJA 5GZ3A 1UPAA 1LPMA 4FCVA 4KLAA 5FWXB 2HPZA 3CZCA 4YBRA 4YJFA 4XRRA 3VDXA 1AXEA 2IU4A 2W2NA 2NGRA 3GVXA 3HUFA 4C5AA 2I2XB 3IQFA 1ISRA 3ZGXA 3CE9A 4EG3A 2V1UA 2QLJA 1K97A 1OASA 5CXUA 1QX4A 2QZPA 4F1JA 2QNIA 2GN9A 1CR2A 2VN8A 4RLSA 2WWYA 1V6CA 3CV3A 3BFXA 1RI3A 1MAUA 1F5NA 3K1AA 1H8EA 4JR2A 4WNIA 2I3CA 3ZC3A 3GEIA 5HQTA 2WQ7A 3DZJA 1RQNA 1P0IA 1QRUA 3C70A 1SKBA 1L1QA 4MR9A 4NAUA 4X9XA 2OV8A 2QKYA 4D8TA 1JU9A 1OMOA 1E2BA 1O7JA 3QKWA 4MP3A 4LXHA 5IK2A 3ZCQA 2ANBA 2FQ1A 4CRWB 1F3LA 4CF3A 1LPPA 3QQPA 2WMDA 1JILA 2EDAA 4GVPA 4MARA 4DHEA 3QVOA 1FMFA 3RK1A 3I9NA 4MGIR 2HY7A 4XTRA 1RYBA 1SKYE 3NYRA 1DEHA 1EM8B 4OPMA 5D3MA 3UYLA 1UDBA 4UOEA 4CQMB 1IOLA 2C8LA 4E1AA 4KVZA 2PNJA 2J67A 1CYDA 3QYAA 3OCYA 3ZVNA 1GLVA 2V59A 3OM8A 1YBMA 1S4MA 4IDCA 3BE5A 5T64A 3JX9A 4O6VA 3AC0A 4V0SA 3S6JA 1X77A 1QHNA 3K0AB 1I2ZA 1W25A 1YI1A 4BY1I 2DT5A 3EASA 3Q3VA 3NHWA 2VWHA 5FORA 3U5ZB 3DFUA 3FOZA 3FSGA 1I4DD 3GQBA 3PYMA 4IIXA 4H59A 5LOVA 3DLBA 1HQDA 4PIVA 1BA2A 1EPUA 2D7JA 1P0MA 2KB0A 3H1EA 4YQYA 4KXVA 4DYHA 3O8QB 4QBGB 3KNZA 3OCJA 4G8CA 2JGFA 3PO2I 1X7HA 2GN4A 3O21A 4H1UA 4FDLA 2CL5A 1J7JA 2Z2IA 4QOHA 4Z3DA 4AFNA 4DMKA 4R31A 4F4JA 5LIPA 2LDXA 5A5FA 1NDQA 5FBWB 3E18A 1YIAA 1EZZA 1LPBB 3QI2A 1YJQA 1QE3A 1YZGA 2FP4A 2OC4A 3IFSA 4P98A 2F3UA 4FC6A 3W7VA 4WOJA 1KQSY 4IF4A 1IOZA 2IYZA 4UHJA 1EDBA 3GGOA 1WCWA 1Y7PA 1Z83A 4I50A 3OFKA 5H81A 3T34A 3RANA 1UPCA 4F86A 2H52A 1RI5A 3OQ1A 4DUYB 2WAYA 3GUZA 4UE2A 3HUUA 1JI3A 2BTOA 4KH0A 2HBYA 3FDXA 4GYYA 4LPKA 3S5JA 1GUDA 5GINE 5IVHA 3ZY4A 2DLCX 1IN7A 1JJBA 4MUHA 1ZK0A 4B40A 4JY7A 5FPYA 4O2BB 3BRWA 5P21A 4U6SA 3CMCO 4I5DA 3ZR4B 4QXRA 5HRUA 3DBRA 4Z4QA 3HU3A 2O2ZA 2GOYA 2IZZA 1L4GA 4LNUB 3U0VA 1K75A 3NGLA 2W58A 3KTAB 1KK3A 3KYDA 5EWLA 2B25A 5JDIC 2BBSA 1WXFA 2XNSA 4PSCA 4W99A 3AFOA 3RIHA 2PD4A 1YFLA 1PWHA 2HIMA 2NZ2A 3NBMA 5B12A 1NMSA 1TW2A 3NTRA 1V45E 4XYGA 3M4ZA 5DPMA 3AZOA 3M5DA 3B20A 2YR0A 4YP6A 5A6VA 1LQTA 3G8BA 3T38A 5M2QA 4CKEA 3CLUC 3E7FA 2VPWA 3OEEA 3TEMA 2YZ7A 1IAQA 1ID1A 5I5GA 5NLLA 3B6IA 4PVDA 4DXHA 2O9JA 4FHDA 4NE9A 1YVDA 3L8ZA 1J8DA 1Z6TA 1USVA 4A92A 4XX2A 1KMHB 2R8ZA 5JZOA 2ZIAA 1A82A 1OHHD 3JYOA 2O8CA 3QVTA 2WU0A 1G291 3PE4A 1E3JA 1O89A 4UCXA 4AY5A 4ZIRA 2R25B 3WGIA 1QV7A 2YICA 4MKHA 4E15A 5G4LA 5K5EA 1ZGGA 3W8FA 2PQ6A 4KGVA 1QB7A 3O4RA 5E6SA 4EG8A 1N6PA 1LQUA 2ZM6B 3DMTC 3QE3A 2QA5A 2F67A 4NCXA 4ZT6A 3KQPA 2Q0QA 1Y9ZA 2Y71A 4MMZB 2NZUG 2QDXA 3U16A 5K20A 2AN4A 3UV6A 8AT1A 3WWOA 1J5PA 1DG1G 1TEXA 5JWRA 4A8JB 5BSEA 5LB2A 1VQN1 2CLCX 4F71A 2FI1A 3AVQA 3Q7EA 2PHZA 3C0KA 1MJGA 1PFUA 1P9NA 1E3DA 3H4TA 3K1TA 4CIAA 5A62A 1KQGA 3LGAA 2FPSA 1W8IA 4W7SA 5FNVA 2VATA 4Q34A 2FEKA 4MRSA 3GA7A 1P7CA 3R3SA 4H6XA 2O4UX 2IBTA 2WM3A 4C06A 4O2BF 5BSUA 3MPOA 2D2EA 1HT0A 3T3HA 4GKJB 2ZR0A 4B4DA 4ZMSA 4QQNA 3D8NA 4UPDA 5K99A 1GSOA 1T6YA 3W79A 3RAEC 1A4XA 2ATCA 1H6DA 2EV9A 3JSXA 1MQ9A 3KTDA 4GBED 4LYJA 4N4AA 2ERCA 4TV8B 2XB2A 1KS2A 1Q5PA 3AETB 4NMLA 4YI3A 2QDKA 5FBVB 1VLMA 3VPSA 4F9GA 5C7YA 5CB6A 1RZRA 4ARCA 5SY9A 4D80A 3B5JA 2JD0A 5D1HA 4KUGA 2EJCA 3EIFA 3GCZA 3Q3EA 1QKJA 2MR5A 1V71A 2ZZNA 4YB8A 3DR5A 1YDHA 1QONA 2NNWB 4JASB 4YUAA 2PGNA 1WVMA 1NMQA 3P4UA 5BPFA 2FPIA 1WXHA 4NBKA 2HSWA 3D81A 1IUPA 1FNNA 5DHAA 3RRYA 1YQQA 3U44B 2ODBA 3G8AA 2P9FA 5AW2A 4GF5A 3TJRA 4A16A 3CME1 3WIOA 2E9HA 2FPLA 1IULA 1C9DB 3QA9A 4MVJE 3VKVA 3DT9A 4GPTA 4AULA 1LSOA 4BNMA 1XMOB 3DD1A 3LUCA 3K70D 3IX0A 4GX5A 2BEUA 4AN0A 1GA1A 1C81A 1NBMA 3KL4A 5ALKA 3S1LA 2X4IA 4BY9E 3NBUA 3S27A 4OHVA 4U3JB 5JSHA 3OEHA 1IHOA 5FL3A 2DWCA 2ZRFA 1ISSA 2L42A 4FW9A 1XPUA 3F0TA 2P8SA 5TMDA 3L0ZA 1OZFA 5M04A 2IPOA 3UHFA 2D0PB 4TTTS 3TXXA 1G5HA 2MYUA 3I55Z 3GEEA 1TEZA 2HU9A 2IXAA 2Q3MA 3WGQA 1P5FA 2GD0A 5BSWA 2LFUA 3LUBA 3F6RA 3VYRB 1T2FA 4HAYA 3I3SR 1XI2A 2P35A 5I7AA 4KYVA 4C7XA 4C2UA 2X42A 1M74A 3LDGA 3GZ4A 1BFUA 4RTJA 3BHJA 2ISSD 3SHFA 1CF9A 1BJKA 3EVFA 1N5RA 4G5FA 4C1NA 1OA0A 2ECKA 2R6GA 4K0RA 4Y9DA 4D26A 1FYEA 4GMGA 1LUAA 1RC8A 2VPXA 3OZ7A 4H7EA 2RHCA 4JFAA 4CM4B 4MYTA 4NBNA 4ZP1A 1T4CA 1DO2A 4CLOA 5DGXA 4TV8F 4BVEA 2BGKA 2FLVA 1A1SA 2ZT8A 3EHEA 1UOPA 4INPA 3K6RA 1ZZEA 3KKQA 4ARZA 1ZL2A 2RKOA 5SZHB 1IWPB 1DOAA 3IO5A 4QXMA 2Z43A 2IX3A 1K63A 4LZAA 5F64A 3GTMI 4G1BA 1D9XA 4AJLA 3NIGB 3HKDB 4DG5A 5A0TA 3SXUB 3B9RA 3ADKA 5DK4A 2XMRA 2QP9X 1SCBA 3RO7A 1W2BZ 1VC2A 4LS3A 1I5RA 2H65A 1UBMS 1XZEA 1XCJA 1DARA 1UXJA 3M4OI 4FLEA 2B94A 3BUSA 2OFOA 3OPYB 5ARBA 1EP3B 2OR3A 1O1YA 1PFWA 4YT5A 3NW9A 3MD9A 2AXPA 2WHEA 4RKRA 3KXDA 1Z7GA 2ZR8A 3G5MA 3ONFA 2QTHA 3P19A 3SOZA 1HEIA 3G1UA 4K88A 3SVLA 5HCIA 2BFDA 5TPZA 1BEZA 4L28A 4MW5A 3ZOZA 1KH1A 3P2EA 2BTQB 1GR0A 4A5OA 5HYVA 1Z63A 2IYQA 3HCDA 3MOGA 4WJLA 4FHZA 1UF9A 4DV5B 1KI6A 3JD3A 3IKVA 1AGXA 4LI0A 5E0KB 4GPAA 5AXCA 4J43A 1YAJA 1JH9A 1FYWA 1VL2A 3R41A 3FKII 4MJXA 1MAAA 4X1KA 3EZGA 3GJSA 5ALJA 5DRTA 3CQ9A 1W75A 2ZYSA 4DILA 3AGPA 1M1NA 5I9IA 2ZSJA 4KZKA 4AX4A 3HDHA 2XEDA 2QR1B 1Z6ZA 2O3SA 4XKJA 2VQ6A 2QYOA 5D84A 3PL1A 3QEJA 4ASUD 4Z9AA 4BC1A 3ASVA 1G8HA 2H85A 1E1CB 1GQYA 3G1WA 2BM0A 3MRSA 5CW2A 3CSDA 2FZ4A 1Z4KA 3PFCA 1DJPA 3KKEA 2C57A 4V1CI 3EIEA 3FYDA 5DDIP 3IKLA 2H7VA 4ZAYA 2G1AA 5TT1A 4YMTA 2PUEA 4RPCA 3LC2O 1LLDA 1EFHA 3PHLA 4EUHA 2PIAA 3PIIA 2QLTA 2GFHA 2XEXA 3FSRA 1LTHR 4J1TA 4DNXA 3WWYA 1OXKB 5AVKA 4R1OA 1K66A 1W1IA 2NT4A 3AVTA 1QVFY 2VOJA 2Y68A 4EHIA 4HUTA 4QVKA 5TS3A 3J81A 4ZDJA 4PG4A 4F7DA 5EXEA 1BH6A 2Q28A 1Y1QA 3LUFA 1DELA 4RBNA 2DUUA 3FIJA 4EECA 1OAOC 1GZVA 2OBMA 1JWHC 3COYA 3PRJA 4I4CA 1J97A 3T3OA 2GRUA 4GPD1 4IILA 2GRJA 2GZ1A 1NW4A 5C4GB 2IWRA 3RS0A 2P90A 5K0CA 1JFFB 1UMKA 2XCLA 2WM8A 3GD7A 3VZDA 3WYAA 1E20A 1VI2A 4X3CA 1X3SA 1B43A 1M2KA 3KZKA 1L1EA 3ENNA 5DX1A 1KZ1A 1XRQA 1KRWA 2FWJA 4R2HA 3JWIA 3LIIA 3FUVA 1JDZA 3CNQS 1YI8A 1UQUA 3ORSA 1QTQA 1TZKA 4BX2A 2Y77A 1RYNA 3II6X 4YJGB 4ARAA 3P9SA 1AV7A 2DUWA 1W96A 3ORRA 4R3WA 2CK3A 2GLUA 2REQB 4K26A 8GPBA 4FE3A 3G82C 1KI9A 2YYSA 5ENVA 3KJQA 3MJCA 5AVUA 1ZGHA 4K2AA 5FI5A 2JA5I 2IE8A 1C9MA 3LY8A 5I6DA 1QLJA 1J2TA 2LR0A 4BFWA 3SZUA 3FCEA 3J80f 3FPHA 4Y67A 3F1LA 4GICA 4BB0A 2WVGA 3K9QO 5DW3A 3SICE 1VIVA 3D7NA 4D4KA 3O4JA 2P9YA 1NRWA 1N34B 2PR7A 3RVSA 1E9RA 4DG9A 5BWNA 3GBVA 2ZBGA 1BJTA 4LYAA 2FF5A 2B5OA 1WDMA 2G8NA 2Y93A 3UQYS 3EPHA 1XL0A 4Q16A 3TGLA 4UHHA 5FV4A 1E2EA 2FX2A 4O63O 3M83A 3LPCA 5DLQC 3V4SA 4NBSA 2HNBA 2B35A 3INNA 4E70A 1W0JA 1JHUA 3KDAA 5BMVF 4G86A 4KR2A 4CPDA 4WKGA 4XIFA 4JP2A 3WWPA 1N2FA 3A3YA 1R6AA 1J0CA 4HLDA 1KK1A 4CV2A 2CHVA 2EHJA 3A6HA 3REQB 5AW6A 1YU9A 2C1XA 3IILA 4QUBA 3AEUA 4MGZR 1SAYA 3RH0A 1BEUB 4OJTA 3FHLA 3IA7A 3O9MA 2ZM5A 4N6GA 3KWLA 5CPFA 1NSTA 3DM9B 3I6QA 4XWGA 3ABOB 3H2HA 2I4IA 1XGKA 4RD2A 1V9SA 3DZDA 2CNOA 3QWHA 2X0DA 5JTTA 1RACA 3JAWA 3O4FA 4KQ2A 2WNHA 3C6XA 2BFBB 3NOXA 3OZSA 4U2EA 2ZWMA 2B1QA 3UMYA 3MLAA 3HH8A 2YYAA 4RC9A 3TGWA 3KV1A 5L7TA 2G1KA 4MRRA 1O08A 5C18A 3GTQI 1WTAA 4ZYLA 2IRWA 2UVDA 4RCZA 3DVLA 2QUIA 1J49A 2CUTA 3V1TC 3A1EA 4IIBA 4LHWA 1M1UA 3K4QA 4F3RA 1BWSA 1ODIA 1ZOIA 2HCRA 1JJ7A 4IDDA 2WUEA 3R5JA 5AW0A 3MJDA 3G68A 4LF4B 4P5EA 3HKBB 4OHCA 5KNCA 3AUAA 4KX5A 1Z6YA 2FN9A 3R3JA 1WOYA 1D6SA 4RVUA 4DZRA 1G3MA 5DTJA 3PFIA 4I1VA 1O54A 5LKAA 3T12A 3BMCA 3TLXA 2O0JA 3NEJA 1GXSB 1Y9AA 1ZGBA 4D4MA 5B2EA 3CLTD 3SSMA 4P58A 1MA0A 1OC4A 2P6UA 3K8OE 5JALA 4QQ8A 3F1KA 1KXZA 1FNSA 1T2EA 3P9NA 2AK2A 3IC5A 3K0CA 2FW8A 3OX4A 3VTKA 4JI4B 4MR7B 1TM7E 1YBHA 2X2EA 1Y9DA 3CKYA 3H18A 1K7CA 1XBTA 4AP9A 4FNAA 4NFLA 3D6FA 1XLUA 5C80A 4QUAA 3FYUB 4TWJA 4U6NA 2WB2A 2QKDA 1U0SY 1N6OA 1P7ZA 2Q7DA 3JASA 1QIHA 4FJ2A 1TXGA 4E1BA 2QW0X 4PGGA 1CR4A 2F4OA 1U0RA 1C50A 1C9KA 1KIAA 4B82A 2ARKA 1SU7A 1RXYA 2JG3A 3QLUA 4I1OA 5K3OA 3RHZA 3U49A 5H9VA 2F3TA 3K31A 4MKXA 3GNSA 3DLTA 3N5KA 5DNVA 1GT91 1DUIA 1YT5A 2JFNA 5KJ6A 4MW4A 2BY4A 4PAMA 1IN5A 2AV6A 1F20A 3WQSB 2A5LA 3B60A 3Q2OA 4DM4A 1R4NB 4UM9B 2C7RA 3NCTA 1M1ZA 4WW0A 1K8A2 5DT2A 1L1OC 2I4LA 4Z9XA 5ICMA 2VFAA 3M6FA 1SG6A 2KYRA 5TX7A 3ET4A 4RK6A 1QRTA 3GARA 4C87A 4NOZA 1NF3A 4CMBA 5AM3A 2RT9A 3FG9A 3LFTA 3MLBA 4DUGA 4NXNB 1YRQA 3OZTA 2PUHA 1I3NA 1DKPA 3PFBA 4NOLA 2BW0A 4EABA 3R5XA 5JNTA 4UULA 4B4OA 2QT1A 5KQGA 1PR2A 3RRFA 2QBYA 1HNZB 3F74A 1NZJA 2Y8EA 3U7GA 5LMZA 4OUDB 1R18A 1VMDA 1BRTA 1B16A 4I19A 1RAGA 3NBQA 4D3ZA 5JAZA 4MIOA 1A9YA 3TAHA 4KWTA 4N0PA 5JD6A 2Y05A 5T41A 3E3MA 3CC71 2A4KA 2AMVA 3U2QA 3LDAA 3OZDA 1DTWA 3AV3A 3E5RA 2A9VA 3OT5A 4JLSA 4FQ5A 3MZLB 4X6YA 4B47A 4KFSA 5KOJA 4Y9RA 1VQ7Z 3LO5A 1Y6FA 4H1TA 1GYQA 2PBFA 2SCUB 4U8HA 5ICEA 4RTPA 3RAFC 1JIQA 1U2ZA 5K8UA 4GNKA 2ZJ1A 2Q6KA 1CUHA 1FYFA 5T8KA 5YASA 1YB6A 4DA0A 1RBYA 2DCUA 1WB6A 4M21A 1RWNA 1U2TA 4WT7A 1HH4A 1ZKMA 4AAYA 1NVEA 2I1LA 5E1OA 1PWEA 3S1AA 1SXIA 3I4MI 1Z7BA 1XZHA 2PANA 2HQBA 2TS1A 3FSEA 2FWIA 3U7JA 1KRXA 4DJJA 5HMMA 3RC1A 3ZBPA 2IS4A 5ARDA 1QH0A 2X3FA 2WZDA 5J2UF 1ZNYA 3SXJA 3VSBA 4FZ3A 1HEYA 1WXXA 3PX3A 2RGRA 3BJEA 2L2QA 4YJHB 4OKIA 4QOEA 3AKYA 3BCRA 3CONA 3L6UA 1CY6A 1X1CA 3OQJA 4ND8A 3VSEA 2FPMA 3VR4H 4BMZA 4LZNA 4ZODA 4RIFA 2R4TA 5TQJA 3UWDA 4RHFA 4PHFA 5DLDA 3FIUA 3L43A 3NDPA 4P2GA 4OI4A 4ZCTA 1PNQA 2FUNB 2OD2A 5E1MA 2RBLA 4NS4A 1ORIA 1JJ2Z 3TM4A 2REOA 3DCYA 2Q27A 1Z68A 1G1AA 4KVGA 2G1PA 3CNEA 1TKAA 3H9QA 1GU1A 5CNKA 3D4NA 2RSLA 1FS4A 3ACBA 3MGKA 4RNDB 2YY5A 5EE1A 2VC2B 2DFNA 4KC0A 1TUIA 1M0SA 3T1TA 3C3WA 3VH1A 3RV3A 4YRSA 2O2GA 3BK7A 4TWAA 1JPJA 2HKIA 2G9ZA 3EXEB 3WQQA 4C4SA 4Y2QA 1Z45A 2QEX1 2HH9A 3BRCA 1KJWA 5AK6A 4C3OB 2F55A 1XPRA 3IX7A 1D3AA 9MHTA 2O1SA 1GRCA 1MCZA 4DA6A 2F1RA 5ADHA 1JYFA 3H11A 1UMDA 5DNYB 1M34A 5JC8A 2R8OA 1JSCA 4HFMA 2GTPA 1P17A 2OSVA 2HX1A 4DLPA 3VZSA 1KBQA 5DW0A 5KWVA 4JNCA 4DY4A 3DBIA 2ORIA 3CWZA 1YI2Z 5HA5A 1HNWB 4BOYA 2X9LA 1PBNA 2WAAA 4UUNA 1NT2A 4W6QA 5TR9A 1L5WA 1T15A 1GCAA 2DHQA 1DC3A 4TOIA 1A04A 1Y7TA 4NBRA 3C7KA 3VPDA 2YN2A 1I2MA 2QSZA 4I6GA 4EKIA 1G8JA 1Z03A 3VH3A 1NOKA 2WIDA 5M5BA 3P0JA 5BW8A 4IUYA 5HFNA 3E3OA 4CKBB 1UWKA 2WB4A 1WPXA 4JEMA 5C8YB 1YZNA 1ZZGA 3G7UA 4RIIA 4BLWA 4ZKDA 1D2EA 2WNSA 4Y6OA 1CS4C 4IR7A 1Z35A 4QGHA 2F9FA 3EQ2A 3G2NA 2WHRA 1N57A 2P75A 4Q9HA 1ZITA 4P82A 4M37A 3R7NA 2Q41A 3OQVA 4LEIA 4BWGA 2EFEB 2Z4SA 4V0KA 1O0CA 2R79A 2BISA 4FCCA 2WF9A 1WLYA 1Y8QA 3IOBA 3OQIA 4E5PA 3B1VA 4GOXA 3OY2A 2ASVA 3KVNA 4EQ6A 4EATA 4JJ8A 1A76A 1FMLA 3F78A 3QH4A 5BSTA 3QPVA 4A3GI 3VO8A 3L79A 2AE1A 2YC4C 4I9FA 4X8OA 2HSDA 3WLNA 1I2DA 1YHNA 2ECPA 2HO4A 4OAPA 5ETJA 5KIAA 1NG9A 2HQ1A 3HJFA 4PBRA 4MUYA 4MCHA 2D00A 4GLJA 2X0FA 1CF2O 3OOJA 3SZ3A 4QEZA 4EL5A 3V8EA 1N1GA 1SNYA 2GPYA 3HZZA 3MJTA 2M6SA 3ZGYA 2I2WA 3GWZA 3ER6A 3M6AA 1E2LA 2W04A 1DMRA 2WKSA 4LYHA 3VFDA 4AMVA 1EDEA 3MXTA 3A9UA 5ALXA 3G8CA 4BAZA 4C0JA 1DNPA 2C96A 3ELBA 4ZD6A 1DAHA 1GKKA 3KZNA 3L4EA 4INZA 4OBWA 3SK0A 3ZIAA 3FSJX 4C2BA 1ZJJA 4BRUA 1GKYA 3MJEA 4ZCLA 4YDSA 1G20A 4ES6A 1PCXA 1XJQA 4K40A 2OXFA 2P2ZA 4YAWA 1E79D 4MDEA 2JI6A 3CX7A 3RI3A 1FEZA 1DC6A 4PGFA 4NXMB 1WDWB 1AH2A 3AWIA 1UINA 2XXJA 2ZR9A 4AYTA 3P2KA 4R98A 3GEGA 1TM2A 1DFGA 2BEKA 4CEIA 4KDFA 1MJHA 1KI3A 2B1RA 2C2BA 4JOQA 2QE7A 3P5SA 2G04A 5HJ5A 3Q40A 3ISJA 3H9BA 4BVFA 4G3XA 4IY1A 3X1XA 2IA5A 4GI2A 1H69A 4N9WA 1GV1A 2D59A 1TU4A 1CE8A 1FUKA 1NUSA 1SKAA 2E4ZA 4N8EA 4CLRA 1AY0A 1R88A 1TEHA 4UHKA 3WB9A 1Q83A 4JLNA 2OECA 4KKXB 5SY4A 1XUOA 1G21A 2A35A 3H9GA 3ZGNA 4GI3A 4EG5A 4Y2XA 5JJLA 1MHTA 1ZB8A 2I03A 2YFKA 4EG1A 2VT6A 2UAGA 3IVMA 5EKTA 3RFFA 3T0FA 1NMYA 1U7DA 3GLFA 1VKNA 3OZXA 3R9WA 1YMVA 5K9ZA 5KEIA 3EG9B 4DSAA 5FTJA 2OG1A 5LZ7A 1B7GO 3TRFA 2WSSD 3M8KA 4F97A 2IYNA 3N2NA 3NASA 2XVZA 3DUFA 3PUWA 3A31A 3CEAA 4ZWNA 1QCDA 3RBZA 2LZ0A 3KRTA 2E3JA 4IHJB 1RMTA 3TQIA 2D2XA 2FG5A 1E2IA 2SKDA 5DISB 2D0IA 2V45A 1OX4B 3IVGA 4BO7A 1FB5A 3K94A 4HB4A 4J7AA 1XMQB 2VK4A 1Z6XA 1PP4A 2UYOA 4OQFA 5JECA 4M9QA 1T2CA 1N5LA 2ZI6A 2BGWA 4HVTA 1AHNA 1M83A 1ZSVA 2VAVA 3AW8A 3PUVA 3SFTA 4Q4CA 1O8BA 2JAHA 2NAFA 1DO0A 3PQ4A 2QYTA 4EB0A 4EG6A 3NRJA 2OQRA 3CGGA 3TKYA 1OY1A 1RCTE 4UBLA 3L5OA 1U4SA 2KM1A 3NQ41 4WI1A 1MHPA 4D45A 2EJTA 4XLTA 2WD7A 1KYZA 4HPXB 5DTEA 1J07A 1CJVC 4IYRA 4J0CA 1LV7A 5T7BA 1ML8A 3A32A 1FA9A 1A8QA 2C4UA 1M1YB 1Y1TA 3DDZX 4LJAA 4TMTA 4JJ7A 1NXXA 1XHEA 2DFPA 5ALRA 4E94A 2TECE 4PRYA 1KP2A 4ANFA 5J9FA 4YMVA 1LZKA 1V4BA 2R6CA 4RKFA 5H3HA 2VHTA 5KTKA 2Y9MB 2JAPA 5KWSA 2GUWA 1VIDA 1Z15A 2SECE 3SZRA 1IM5A 4MP8A 3VGPA 4RHYA 1GPNA 4JYZA 1J8FA 1RQFA 1JTFA 3GLGE 3D7RA 1BD4A 3E2PA 4PN3A 4W5HA 1TWAI 1Y81A 2I2CA 4IIJB 2AMJA 1E6EA 4J2OA 4XM2A 5EWJA 1GGFA 3U62A 4GNRA 5AH0A 3EVDA 1SOMA 3MWDB 1MG5A 5E6RB 4DB2A 4DJEC 2D5IA 4C21A 2XLCA 4BAUA 2NUAB 1V4NA 3SX0A 1K5GA 1KO5A 3L0DA 3RD5A 3IAHA 1HDOA 1SHJA 1GKLA 1SOWA 2WDZA 3DP9A 3V6LA 4B3GA 1QF6A 3ZY5A 4O2AA 1TJ3A 4C5CA 1ISMA 1IYZA 1QO9A 2CVQA 2YDYA 1FRZA 1EGHA 4I99A 5KVQA 3PPIA 5HIJA 1A5AB 2Q3DA 3HVKA 4URFA 1VMAA 2YS6A 3SEQA 3J7A4 2XOKD 5JT1A 4IHJF 1MEOA 5HK8A 4YJ2A 3HJRA 5FBHA 1QIFA 1XTUA 3H2IA 2I9KA 3C1UA 5IU6A 1PE0A 1YQTA 4NCHA 1T9GS 2BAGA 4Q48A 3HOZI 1DKQA 2EC5A 2OBXA 2OC9A 2FN8A 3L01A 1A9OA 1ADBA 1DEXA 2QTZA 2VSXA 3IVCA 1ZUD1 2DBRA 4YPOA 1RLMA 3D7MA 2G9NA 1U9IA 4MQLA 8LDHA 3ICOA 4LHZA 1OXMA 2ZRCA 5KSWB 2AWOA 2HUNA 5A71A 4K81B 2IDKA 3QPCA 3O26A 5IC6A 4DQLA 3S8MA 1MA3A 3TDHB 1XZFA 2AGVA 1HOXA 2BPOA 3OIDA 3RJ9A 5I7VA 2O7RA 4UNQA 5FFNA 3P9IA 4WN9A 3LO8A 5AO9A 4UHFA 4ZYZA 5AJHA 4MB0A 2BRUA 2FMXA 3WO0A 5KNBH 2OO7A 1US8A 4ENVA 4OD0A 3ZZNA 5CTJA 1LCIA 2EZUA 3WGZA 4ZOQI 4M1WA 1Q6ZA 4CI0B 5DHPA 4D4GA 4CMCA 1X94A 3R3WA 2F1IA 2I91A 3VU1A 3FPEA 4IIJF 1MTZA 4CG1A 1DIBA 1DRVA 1Y4AE 3OQHA 3WIVA 5JS1A 4TYWA 3BE8A 1PR3A 1QH8B 4WCFA 1HORA 3LA6A 1LLCA 1Q92A 2EQ5A 2WJZB 1VQ8Z 3EGVA 1VCMA 5ENZA 1ZI6A 1QO7A 4B1FA 3VR6A 4FHCA 3IBTA 3WAJA 5G0UA 3IIJA 2Y27A 1CQWA 2XV1A 3T4EA 3TOSA 1UDAA 3WLOA 3OE7A 3NWEA 3I1YA 3MJRA 2XNDA 3H6GA 3W0LB 1I7DA 2LV8A 2NQTA 2W7TA 3CM0A 1PSDA 1Z39A 3K2IA 4N1AA 5EXDA 4CL0A 4HAIA 1BS9A 1C7ZA 4OQXA 1RI2A 3A14A 5HZHA 4JA0A 5IFKA 3NS7A 2QZSA 3O4VA 2VJCA 3NBKA 5I7OA 1MVLA 1PNTA 3JQRA 4FX5A 1B8UA 4CKCA 3DF7A 3W1WA 2BV3A 4Y1EA 2FK8A 3F98A 3EF1A 3PQ6A 1Y3IA 4O4IA 1R6XA 2D4AA 1Y1VI 1JHPA 1EBFA 3G7NA 1R1DA 2IXBA 3GYBA 3IQWA 3NJ4A 5CAEA 5LZ2A 1R16A 3DXFA 5KCZA 2OO5C 2NXCA 4I0WB 4FN4A 1XZBA 3CGWA 4PYIA 2BMVA 2QSUA 5JSZB 3ZE7A 2RI1A 2UYHA 2Y0BA 1UADA 2CVZA 2ORVA 1HTTA 1JHZA 5KAPA 4MUKA 2KPOA 1GTZA 4N48A 1U04A 2YWXA 2CB9A 3ICCA 5IC5A 3F5MA 1HBJA 2B8TA 2CW5A 2HK6A 1L7AA 3RUCA 1WU7A 4EPXA 3P20A 4XVRA 5K8CA 3I4NI 4GXRA 4FFSA 4J76A 1GZ5A 1L4EA 2XE8A 1QMGA 5IABA 2P1RA 2N47A 1MJ5A 2R8BA 4U9UA 3LGXA 2RBGA 4GOOD 4UNSA 4XD2A 4JNKA 1U1IA 3RS5A 4QU5A 4QAJA 4POAA 5MGNA 2W6IA 4KTTE 4C2TA 2QU8A 2HRQA 3IIMA 4ENPA 4J7UA 4V1CB 5JYEA 1QM5A 2BI7A 4FYMA 2C59A 1XCBA 4XUDA 4DV3B 1S02A 3HABA 3L7OA 1E9EA 2LCIA 1CG6A 2BL4A 3AEQB 3E6AA 3OBBA 1TW3A 4QBTA 5ALUA 1EK6A 3PC8C 1T8YA 3RYHB 3SKXA 1Z6GA 3KKZA 1Y3AA 5BSRA 1RWBA 3HSKA 3KU4A 1Z2OX 4CCYA 2GFIA 2WBLC 2E5FA 2ZPUA 5FR2A 5BWBA 1EWVA 4J9UE 5K0NA 4EYOA 5EHQA 3LT2A 2X41A 4G8JA 1RQXA 4OA5A 2B4KA 1UBFA 3DOOA 2YV1A 3EMDA 2ZQZA 4BFTA 3DEZA 1GARA 2XRMA 1YFZA 1EX1A 3TINA 4OGFA 3R3VA 3A28A 1BCRA 2CXTA 3DDUA 4GLLA 1QCCA 4DQKA 2GEJA 3THXA 1A0OA 1P2SA 4R1QA 3NHAA 1GILA 2QX8A 4JUBA 3WB0A 5JJ5A 3S2EA 5L8VA 3L9XA 3H0CA 3LPAA 4CT4B 5CLLA 4JJGA 3UM9A 4U7GA 1C8KA 3EHDA 4OMCA 3L4JA 3K9HA 1QGED 4BCDA 2GESA 4KAFA 4BWVA 5EWMA 3QV1A 1P2UA 1N6RA 3TK1A 1NQWA 3W7AA 3ZU6A 5KPDA 1PKXA 3M49A 1FIUA 1GNQA 4BKQA 1IHDA 2DQYA 3AOEC 3A9VA 4FLFA 3C4VA 4JB3A 5MHTA 3FTFA 4MIKA 3E03A 1OFVA 3HU1A 4F12A 1CU1A 4ZEOA 2NVQI 1J0EA 3A4YA 2R4QA 3GHYA 2WF6A 3RSSA 1NVAA 3U39A 3OOSA 2PSJA 1Q1BA 5BVHB 1FDSA 2E4WA 2JVJA 3O91A 4GW3A 4Y0VA 2WKPA 3RUPA 3V7NA 1ABEA 5JZBA 1QUFA 1BVYF 1WB4A 2BCJQ 2CUNA 2EYQA 4PQRA 1TZ2A 3R0XA 3KK0A 4X3PA 2EL9A 1B73A 2FPGA 2NSDA 2K7FA 1E61A 1K3FA 5CMLA 2FJUA 2GSWA 5JI2E 3A3OA 3ZWPA 2GTIA 1TFIA 1BXRA 1SUFA 1OYYA 3X1YA 5IPFA 2AXEA 1R9TI 2AJ8A 2JBWA 3C3EA 4QYIB 1DG9A 5DI3B 3V33A