2JNYA

Solution nmr structure of protein uncharacterized bcr, northeast structural genomics consortium target cgr1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
b'MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPNNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized BCR
publication title Solution NMR structure of protein Uncharacterized BCR, Northeast Structural Genomics Consortium target CgR1
rcsb
source organism Corynebacterium glutamicum
molecule tags Structural genomics, unknown function
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jnyA01
1TWHI 4QTTA 3M3YI 4A3DI 5C3EI 3HOVI 1L1OC 2NVTI 1LQLA 4A3CI 5C44I 1X3WA 3GTKI 4NBDA 3GCFA 3Q87A 3GTMI 1ML8A 1I50I 1K83I 2R7ZI 2JNYA 1ZB8A 5IP9I 4NBAA 1Y1VS 3ESWA 2JR6A 3VMIA 3S1RI 5C4JI 2E2HI 2VUMI 4NBBA 2NVXI 3CQZI 1YUAA 4NBFA 1ZB9A 2KPIA 1R9TI 4A3GI 3S15I 4BY1I 4NB9A 2RBLA 2NVQI 1WCMI 3GTLI 4NOZA 4A3II 1I6HI 2DE5A 2J6AA 4QTUA 3VMGA 2F4MA 2AKLA 2K5RA 1Y1VI 2F4OA 3U50C 3VMHA 3PO3I 1TWFI 4A3KI 1PFTA 3I4NI 3I4MI 2P3YA 3GTGI 3S1NI 3GTJI 1WW9A 3S2HI 1X3ZA 4A3FI 1VLAA 4Y7NI 4XX2A 4A3EI 3S1MI 1N2FA 3GTPI 3GTOI 3HOWI 1I3QI 4Y52I 3S1QI 3RZDI 3M4OI 1Y1WI 1RLYA 4A93I 3I07A 4A3JI 3S2DI 3GTQI 2E2JI 4A3MI 2DE6A 3K7AI 4NBHA 4BY7I 1TWCI 4NBGA 3HOYI 3S14I 3H3VJ 3FKII 4BXXI 3LUSA 1USPA 2YU9I 2HF1A 2DE7A 2R93I 3GTMS 3HOUI 3HOZI 4A3LI 5C4XI 3EERA 4NB8A 4NBEA 4X6AI 5IP7I 1TWGI 4BBSI 1DL6A 3H0GI 3GKQA 1TFIA 1RO4A 2JA5I 1TWAI 1NUIA 2R92I 4BBRI 4NBCA 2E2II 3PO2I 2PK7A 2JA8I 2NVYI 3HOXI 4MH4A 2JA6I 3S16I 1USPB 4A3BI 5CM2M 3VB9A 2JS4A 2JA7I 5FLMI 3PO3S 2BJOA 3D6WA 3RZOI 2B63I 1SFOI 1QYPA 3S17I
chains in the Genus database with same CATH superfamily
3M3YI 5D1OA 4A3DI 3HOVI 4A3CI 3G71Z 1JWHC 3GTKI 3GCFA 1QVGY 2OOYB 3QWUA 1I50I 2VF1A 1RNIA 4RVGA 2V8IA 2R7ZI 1Y1VS 1VQOZ 3FQQA 1Q821 2VUMI 3S1RI 5C4JI 2OOXB 2NVXI 2KPIA 3F3FC 1ZH1A 3CCL1 1RO2A 5A2Qf 1I6HI 2J6AA 2K5RA 1NP6A 1Y1VI 2RT9A 3VMHA 3PO3I 2H85A 2OTJ1 4A3KI 3I4MI 2P3YA 5AN9F 3IF8A 2ZAEB 3J80f 3I551 1X3ZA 2NAPA 2VPYA 2WB1A 4Y7NI 1WZNA 4XX2A 3CCJ1 3S1MI 2OTJZ 5D1OB 3HOWI 3J81f 3RZDI 1Q811 3CXCZ 3I561 3I55Z 3I07A 3GTQI 4A3MI 2DE6A 1VQ41 3CMAZ 1TWCI 3NH4A 4NBGA 3CCJZ 2JUBA 4MXUA 1KD11 3NH5A 1VQP1 5T6BA 5T67A 2IZ3A 1USPA 2YU9I 3I56Z 4A3LI 1N8R2 1Q7Y2 5C4XI 2QKDA 3EERA 4NB8A 4NBEA 1YI2Z 1TWGI 1NUIA 2R92I 3MZLB 1YIT1 2PK7A 3OW2Y 3IX0A 3D9XA 4MH4A 1W2BY 4MRIA 2V45A 1YUKA 1YIJ1 4A3BI 5A2Qb 1VQK1 5FLXb 2M6NA 1S7MA 1N8R1 2QRCB 3VB9A 1Q7Y1 2JS4A 2Q4ZA 3CCE1 2JA7I 1YITZ 3RZOI 2B63I 4DGLA 1VQ71 4CL1A 4EWCA 1QVFY 3CC2Z 1QYPA 1YJ9Z 3S17I 3G4S1 1TWHI 1VQKZ 3CC71 4MD7A 3CCR1 3J80b 3CCEZ 1LQLA 1X3WA 4NBDA 1VQ51 2JMOA 1S72Z 3J81b 5T64A 3CC7Z 1K83I 3CPWY 4NBAA 3ESWA 4AYBA 2O4HA 2QLVB 1VQ5Z 1R9TI 2OTLZ 4BY1I 4NB9A 2RBLA 3CC41 1WCMI 3CCU1 2VPXA 3IR7A 1WIIA 2JIPA 1VQ61 4QTUA 3CCM1 2AKLA 1K732 3IFUA 2F4OA 3G6E1 3CCUZ 3CC4Z 3GTJI 1WW9A 1RO0A 1VQ6Z 1VQM1 2PMZA 2P28A 1N2FA 3G6EZ 2EGTA 3GTPI 4Y52I 1Z01A 3M4OI 4E2YA 1K731 2QREB 5FLXf 1M901 2LIYA 4NBHA 1Q812 2RIQA 3CCQ1 3S14I 3FKII 1QVGZ 4BXXI 3CCLZ 1VQ81 2DE7A 2R93I 1KD12 3GTMS 3NH8A 1KC82 3CXCY 2YADA 4E31A 4BBSI 2V3VA 1RO4A 2JA5I 1X0TA 1KQSZ 4NFRA 1M1K2 2V8JA 4DQYB 2VUGA 1JJ2Y 3CCS1 1KC81 5FLMI 2OZKA 2Q51A 3KIHA 3P5JB 1VQ4Z 4E2XA 2W04A 4QTTA 3JAMf 1FDOA 2R6MA 4E33A 1VQPZ 1L1OC 1M1K1 2NVTI 4MD8A 5C44I 1Q16A 1AA6A 2IZ4A 2JIRA 3EEDA 3FQMA 2M48A 2LEXA 3HKZA 2JNYA 1ZB8A 5IP9I 3NFZA 1Y8CA 4RV9A 4NBBA 3MZKB 2E9HA 1YUAA 4NBFA 4A3GI 1YIJZ 3S15I 2NVQI 2GTHA 4A3II 4RS4A 2QA41 5IT9b 3NDIA 1VQN1 2F4MA 1VQ7Z 3U50C 3G4SZ 1TWFI 3OW2Z 3CD61 2V8KA 3GTGI 3CCRZ 3S1NI 3S2HI 1P9NA 1VLAA 1SIWA 4MD9A 3TE5B 1YJW1 1Z03A 3BG0B 2VPZA 4RVDA 3S2DI 1VQL1 3TDHB 3K7AI 4BY7I 1YJWZ 3HOYI 3JAMb 1M902 1Q861 1FDIA 3G711 3CPWZ 4E30A 3CCMZ 2QEX1 3VTNA 1KRLA 3D2LA 2VPWA 2WAQA 5IP7I 1DL6A 1TFIA 1VQO1 4BBRI 4MONA 2E2II 1K8A2 3MONA 2QEXZ 1VQMZ 2NVYI 2JA6I 4RVFA 1K9M2 5CM2M 3PO3S 2BJOA 3D6WA 3F3PC 2GTIA 5IT9f 1SFOI 3CCQZ 1YHQ1 1KQSY 5C3EI 1VQ8Z 1K8A1 3Q87A 2JIQA 1YJN1 1K9M1 3GTMI 1ML8A 1YHQZ 2JIMA 2PM9A 4E2WA 2RHBA 2JR6A 2QRDB 2HU9A 3VMIA 2E2HI 3CMA1 1YJNZ 3CQZI 1ZB9A 3NDJA 2W03A 1QXFA 3CCSZ 3GTLI 4NOZA 4RVHA 3CME1 2DE5A 3VMGA 2O53A 1YI21 2QR1B 3I4NI 4HGZA 1PFTA 4E2ZA 3CCV1 4HH4A 3KIFA 2E7ZA 4TNUA 1QF8A 1JJ2Z 2IV2X 3CMEZ 3T4NB 4A3FI 4A3EI 1Z02A 3GTOI 1I3QI 3CCVZ 3S1QI 4S1TA 1Y1WI 1RLYA 4A93I 4A3JI 2E2JI 3CC21 1YJ91 4NH1C 4E32A 3H3VJ 2AYDA 3LUSA 2LFUA 2K3RA 4HGYA 2RPRA 1WJ2A 2HF1A 1W2BZ 3HOUI 3HOZI 2QA4Z 2I3CA 1VQNZ 3J7A4 1Q862 1S721 2KI7B 4X6AI 1NJI2 3H0GI 3CD6Z 1VQ91 3GKQA 1QVFZ 2G2KA 1TWAI 2GU2A 4NBCA 3PO2I 2JIOA 1RQFA 2JA8I 5D1PA 3HOXI 3S16I 1USPB 2OTL1 1VQ9Z 4DK1A 2Y0SA 1VQLZ 1NJI1 5LL6f 1Q822 3BG1B
chains in the Genus database with same CATH topology
3M3YI 5D1OA 4A3DI 3HOVI 4A3CI 3G71Z 1JWHC 3GTKI 3GCFA 1QVGY 2OOYB 3QWUA 1I50I 2VF1A 1RNIA 4RVGA 2V8IA 2R7ZI 1Y1VS 1VQOZ 3FQQA 1Q821 2VUMI 3S1RI 5C4JI 2OOXB 2NVXI 2KPIA 3F3FC 1ZH1A 3CCL1 1RO2A 5A2Qf 1I6HI 2J6AA 2K5RA 1NP6A 1Y1VI 2RT9A 3VMHA 3PO3I 2H85A 2OTJ1 4A3KI 3I4MI 2P3YA 5AN9F 3IF8A 2ZAEB 3J80f 3I551 1X3ZA 2WB1A 4Y7NI 4XX2A 3CCJ1 3S1MI 2OTJZ 5D1OB 3HOWI 3J81f 3RZDI 1Q811 3CXCZ 3I561 3I55Z 3I07A 3GTQI 4A3MI 2DE6A 1VQ41 3CMAZ 1TWCI 3NH4A 4NBGA 3CCJZ 2JUBA 4MXUA 1KD11 3NH5A 1VQP1 5T6BA 5T67A 2IZ3A 1USPA 2YU9I 3I56Z 4A3LI 1N8R2 1Q7Y2 5C4XI 2QKDA 3EERA 4NB8A 4NBEA 1YI2Z 1TWGI 1NUIA 2R92I 3MZLB 1YIT1 2PK7A 3OW2Y 3IX0A 3D9XA 4MH4A 1W2BY 4MRIA 1YUKA 1YIJ1 4A3BI 5A2Qb 1VQK1 5FLXb 2M6NA 1S7MA 1N8R1 2QRCB 3VB9A 1Q7Y1 2JS4A 2Q4ZA 3CCE1 2JA7I 1YITZ 3RZOI 2B63I 4DGLA 1VQ71 4CL1A 4EWCA 1QVFY 3CC2Z 1QYPA 1YJ9Z 3S17I 3G4S1 1TWHI 1VQKZ 3CC71 4MD7A 3CCR1 3J80b 3CCEZ 1LQLA 1X3WA 4NBDA 1VQ51 2JMOA 1S72Z 3J81b 5T64A 3CC7Z 1K83I 3CPWY 4NBAA 3ESWA 4AYBA 2O4HA 2QLVB 1VQ5Z 1R9TI 2OTLZ 4BY1I 4NB9A 2RBLA 3CC41 1WCMI 3CCU1 1WIIA 1VQ61 4QTUA 3CCM1 2AKLA 1K732 3IFUA 2F4OA 3G6E1 3CCUZ 3CC4Z 3GTJI 1WW9A 1RO0A 1VQ6Z 1VQM1 2PMZA 2P28A 1N2FA 3G6EZ 2EGTA 3GTPI 4Y52I 1Z01A 3M4OI 4E2YA 1K731 2QREB 5FLXf 1M901 2LIYA 4NBHA 1Q812 2RIQA 3CCQ1 3S14I 3FKII 1QVGZ 4BXXI 3CCLZ 1VQ81 2DE7A 2R93I 1KD12 3GTMS 3NH8A 1KC82 3CXCY 2YADA 4E31A 4BBSI 1RO4A 2JA5I 1X0TA 1KQSZ 4NFRA 1M1K2 2V8JA 4DQYB 2VUGA 1JJ2Y 3CCS1 1KC81 5FLMI 2OZKA 2Q51A 3KIHA 3P5JB 1VQ4Z 4E2XA 2W04A 4QTTA 3JAMf 2R6MA 1VQPZ 4E33A 1L1OC 1M1K1 2NVTI 4MD8A 5C44I 2IZ4A 3EEDA 3FQMA 2M48A 3HKZA 2JNYA 1ZB8A 5IP9I 3NFZA 4RV9A 4NBBA 3MZKB 2E9HA 1YUAA 4NBFA 4A3GI 1YIJZ 3S15I 2NVQI 2GTHA 4A3II 4RS4A 2QA41 5IT9b 3NDIA 1VQN1 2F4MA 1VQ7Z 3U50C 3G4SZ 1TWFI 3OW2Z 3CD61 2V8KA 3GTGI 3CCRZ 3S1NI 3S2HI 1P9NA 1VLAA 4MD9A 3TE5B 1YJW1 1Z03A 3BG0B 4RVDA 3S2DI 1VQL1 3TDHB 3K7AI 4BY7I 1YJWZ 3HOYI 3JAMb 1M902 1Q861 3G711 3CPWZ 4E30A 3CCMZ 2QEX1 3VTNA 1KRLA 2WAQA 5IP7I 1DL6A 1TFIA 1VQO1 4BBRI 4MONA 2E2II 1K8A2 3MONA 2QEXZ 1VQMZ 2NVYI 2JA6I 4RVFA 1K9M2 5CM2M 3PO3S 2BJOA 3D6WA 3F3PC 2GTIA 5IT9f 1SFOI 3CCQZ 1YHQ1 1KQSY 5C3EI 1VQ8Z 1K8A1 3Q87A 1YJN1 1K9M1 3GTMI 1ML8A 1YHQZ 2PM9A 4E2WA 2RHBA 2JR6A 2QRDB 2HU9A 3VMIA 2E2HI 3CMA1 1YJNZ 3CQZI 1ZB9A 3NDJA 2W03A 3CCSZ 3GTLI 4NOZA 4RVHA 3CME1 2DE5A 3VMGA 2O53A 1YI21 2QR1B 3I4NI 4HGZA 1PFTA 4E2ZA 3CCV1 4HH4A 3KIFA 4TNUA 1QF8A 1JJ2Z 3CMEZ 3T4NB 4A3FI 4A3EI 1Z02A 3GTOI 1I3QI 3CCVZ 3S1QI 4S1TA 1Y1WI 1RLYA 4A93I 4A3JI 2E2JI 3CC21 1YJ91 4NH1C 4E32A 3H3VJ 3LUSA 2LFUA 2K3RA 4HGYA 2RPRA 2HF1A 1W2BZ 3HOUI 3HOZI 2QA4Z 2I3CA 1VQNZ 3J7A4 1Q862 1S721 2KI7B 4X6AI 1NJI2 3H0GI 3CD6Z 1VQ91 3GKQA 1QVFZ 2G2KA 1TWAI 2GU2A 4NBCA 3PO2I 1RQFA 2JA8I 5D1PA 3HOXI 3S16I 1USPB 2OTL1 1VQ9Z 4DK1A 2Y0SA 1VQLZ 1NJI1 5LL6f 1Q822 3BG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH I;  4QTT A;  3M3Y I;  4A3D I;  5C3E I;  3HOV I;  1L1O C;  2NVT I;  1LQL A;  4A3C I;  5C44 I;  1X3W A;  3GTK I;  4NBD A;  3GCF A;  3Q87 A;  3GTM I;  1ML8 A;  1I50 I;  1K83 I;  2R7Z I;  2JNY A;  1ZB8 A;  5IP9 I;  4NBA A;  1Y1V S;  3ESW A;  2JR6 A;  3VMI A;  3S1R I;  5C4J I;  2E2H I;  2VUM I;  4NBB A;  2NVX I;  3CQZ I;  1YUA A;  4NBF A;  1ZB9 A;  2KPI A;  1R9T I;  4A3G I;  3S15 I;  4BY1 I;  4NB9 A;  2RBL A;  2NVQ I;  1WCM I;  3GTL I;  4NOZ A;  4A3I I;  1I6H I;  2DE5 A;  2J6A A;  4QTU A;  3VMG A;  2F4M A;  2AKL A;  2K5R A;  1Y1V I;  2F4O A;  3U50 C;  3VMH A;  3PO3 I;  1TWF I;  4A3K I;  1PFT A;  3I4N I;  3I4M I;  2P3Y A;  3GTG I;  3S1N I;  3GTJ I;  1WW9 A;  3S2H I;  1X3Z A;  4A3F I;  1VLA A;  4Y7N I;  4XX2 A;  4A3E I;  3S1M I;  1N2F A;  3GTP I;  3GTO I;  3HOW I;  1I3Q I;  4Y52 I;  3S1Q I;  3RZD I;  3M4O I;  1Y1W I;  1RLY A;  4A93 I;  3I07 A;  4A3J I;  3S2D I;  3GTQ I;  2E2J I;  4A3M I;  2DE6 A;  3K7A I;  4NBH A;  4BY7 I;  1TWC I;  4NBG A;  3HOY I;  3S14 I;  3H3V J;  3FKI I;  4BXX I;  3LUS A;  1USP A;  2YU9 I;  2HF1 A;  2DE7 A;  2R93 I;  3GTM S;  3HOU I;  3HOZ I;  4A3L I;  5C4X I;  3EER A;  4NB8 A;  4NBE A;  4X6A I;  5IP7 I;  1TWG I;  4BBS I;  1DL6 A;  3H0G I;  3GKQ A;  1TFI A;  1RO4 A;  2JA5 I;  1TWA I;  1NUI A;  2R92 I;  4BBR I;  4NBC A;  2E2I I;  3PO2 I;  2PK7 A;  2JA8 I;  2NVY I;  3HOX I;  4MH4 A;  2JA6 I;  3S16 I;  1USP B;  4A3B I;  5CM2 M;  3VB9 A;  2JS4 A;  2JA7 I;  5FLM I;  3PO3 S;  2BJO A;  3D6W A;  3RZO I;  2B63 I;  1SFO I;  1QYP A;  3S17 I; 
#chains in the Genus database with same CATH topology
 3M3Y I;  5D1O A;  4A3D I;  3HOV I;  4A3C I;  3G71 Z;  1JWH C;  3GTK I;  3GCF A;  1QVG Y;  2OOY B;  3QWU A;  1I50 I;  2VF1 A;  1RNI A;  4RVG A;  2V8I A;  2R7Z I;  1Y1V S;  1VQO Z;  3FQQ A;  1Q82 1;  2VUM I;  3S1R I;  5C4J I;  2OOX B;  2NVX I;  2KPI A;  3F3F C;  1ZH1 A;  3CCL 1;  1RO2 A;  5A2Q f;  1I6H I;  2J6A A;  2K5R A;  1NP6 A;  1Y1V I;  2RT9 A;  3VMH A;  3PO3 I;  2H85 A;  2OTJ 1;  4A3K I;  3I4M I;  2P3Y A;  5AN9 F;  3IF8 A;  2ZAE B;  3J80 f;  3I55 1;  1X3Z A;  2NAP A;  2VPY A;  2WB1 A;  4Y7N I;  1WZN A;  4XX2 A;  3CCJ 1;  3S1M I;  2OTJ Z;  5D1O B;  3HOW I;  3J81 f;  3RZD I;  1Q81 1;  3CXC Z;  3I56 1;  3I55 Z;  3I07 A;  3GTQ I;  4A3M I;  2DE6 A;  1VQ4 1;  3CMA Z;  1TWC I;  3NH4 A;  4NBG A;  3CCJ Z;  2JUB A;  4MXU A;  1KD1 1;  3NH5 A;  1VQP 1;  5T6B A;  5T67 A;  2IZ3 A;  1USP A;  2YU9 I;  3I56 Z;  4A3L I;  1N8R 2;  1Q7Y 2;  5C4X I;  2QKD A;  3EER A;  4NB8 A;  4NBE A;  1YI2 Z;  1TWG I;  1NUI A;  2R92 I;  3MZL B;  1YIT 1;  2PK7 A;  3OW2 Y;  3IX0 A;  3D9X A;  4MH4 A;  1W2B Y;  4MRI A;  2V45 A;  1YUK A;  1YIJ 1;  4A3B I;  5A2Q b;  1VQK 1;  5FLX b;  2M6N A;  1S7M A;  1N8R 1;  2QRC B;  3VB9 A;  1Q7Y 1;  2JS4 A;  2Q4Z A;  3CCE 1;  2JA7 I;  1YIT Z;  3RZO I;  2B63 I;  4DGL A;  1VQ7 1;  4CL1 A;  4EWC A;  1QVF Y;  3CC2 Z;  1QYP A;  1YJ9 Z;  3S17 I;  3G4S 1;  1TWH I;  1VQK Z;  3CC7 1;  4MD7 A;  3CCR 1;  3J80 b;  3CCE Z;  1LQL A;  1X3W A;  4NBD A;  1VQ5 1;  2JMO A;  1S72 Z;  3J81 b;  5T64 A;  3CC7 Z;  1K83 I;  3CPW Y;  4NBA A;  3ESW A;  4AYB A;  2O4H A;  2QLV B;  1VQ5 Z;  1R9T I;  2OTL Z;  4BY1 I;  4NB9 A;  2RBL A;  3CC4 1;  1WCM I;  3CCU 1;  2VPX A;  3IR7 A;  1WII A;  2JIP A;  1VQ6 1;  4QTU A;  3CCM 1;  2AKL A;  1K73 2;  3IFU A;  2F4O A;  3G6E 1;  3CCU Z;  3CC4 Z;  3GTJ I;  1WW9 A;  1RO0 A;  1VQ6 Z;  1VQM 1;  2PMZ A;  2P28 A;  1N2F A;  3G6E Z;  2EGT A;  3GTP I;  4Y52 I;  1Z01 A;  3M4O I;  4E2Y A;  1K73 1;  2QRE B;  5FLX f;  1M90 1;  2LIY A;  4NBH A;  1Q81 2;  2RIQ A;  3CCQ 1;  3S14 I;  3FKI I;  1QVG Z;  4BXX I;  3CCL Z;  1VQ8 1;  2DE7 A;  2R93 I;  1KD1 2;  3GTM S;  3NH8 A;  1KC8 2;  3CXC Y;  2YAD A;  4E31 A;  4BBS I;  2V3V A;  1RO4 A;  2JA5 I;  1X0T A;  1KQS Z;  4NFR A;  1M1K 2;  2V8J A;  4DQY B;  2VUG A;  1JJ2 Y;  3CCS 1;  1KC8 1;  5FLM I;  2OZK A;  2Q51 A;  3KIH A;  3P5J B;  1VQ4 Z;  4E2X A;  2W04 A;  4QTT A;  3JAM f;  1FDO A;  2R6M A;  4E33 A;  1VQP Z;  1L1O C;  1M1K 1;  2NVT I;  4MD8 A;  5C44 I;  1Q16 A;  1AA6 A;  2IZ4 A;  2JIR A;  3EED A;  3FQM A;  2M48 A;  2LEX A;  3HKZ A;  2JNY A;  1ZB8 A;  5IP9 I;  3NFZ A;  1Y8C A;  4RV9 A;  4NBB A;  3MZK B;  2E9H A;  1YUA A;  4NBF A;  4A3G I;  1YIJ Z;  3S15 I;  2NVQ I;  2GTH A;  4A3I I;  4RS4 A;  2QA4 1;  5IT9 b;  3NDI A;  1VQN 1;  2F4M A;  1VQ7 Z;  3U50 C;  3G4S Z;  1TWF I;  3OW2 Z;  3CD6 1;  2V8K A;  3GTG I;  3CCR Z;  3S1N I;  3S2H I;  1P9N A;  1VLA A;  1SIW A;  4MD9 A;  3TE5 B;  1YJW 1;  1Z03 A;  3BG0 B;  2VPZ A;  4RVD A;  3S2D I;  1VQL 1;  3TDH B;  3K7A I;  4BY7 I;  1YJW Z;  3HOY I;  3JAM b;  1M90 2;  1Q86 1;  1FDI A;  3G71 1;  3CPW Z;  4E30 A;  3CCM Z;  2QEX 1;  3VTN A;  1KRL A;  3D2L A;  2VPW A;  2WAQ A;  5IP7 I;  1DL6 A;  1TFI A;  1VQO 1;  4BBR I;  4MON A;  2E2I I;  1K8A 2;  3MON A;  2QEX Z;  1VQM Z;  2NVY I;  2JA6 I;  4RVF A;  1K9M 2;  5CM2 M;  3PO3 S;  2BJO A;  3D6W A;  3F3P C;  2GTI A;  5IT9 f;  1SFO I;  3CCQ Z;  1YHQ 1;  1KQS Y;  5C3E I;  1VQ8 Z;  1K8A 1;  3Q87 A;  2JIQ A;  1YJN 1;  1K9M 1;  3GTM I;  1ML8 A;  1YHQ Z;  2JIM A;  2PM9 A;  4E2W A;  2RHB A;  2JR6 A;  2QRD B;  2HU9 A;  3VMI A;  2E2H I;  3CMA 1;  1YJN Z;  3CQZ I;  1ZB9 A;  3NDJ A;  2W03 A;  1QXF A;  3CCS Z;  3GTL I;  4NOZ A;  4RVH A;  3CME 1;  2DE5 A;  3VMG A;  2O53 A;  1YI2 1;  2QR1 B;  3I4N I;  4HGZ A;  1PFT A;  4E2Z A;  3CCV 1;  4HH4 A;  3KIF A;  2E7Z A;  4TNU A;  1QF8 A;  1JJ2 Z;  2IV2 X;  3CME Z;  3T4N B;  4A3F I;  4A3E I;  1Z02 A;  3GTO I;  1I3Q I;  3CCV Z;  3S1Q I;  4S1T A;  1Y1W I;  1RLY A;  4A93 I;  4A3J I;  2E2J I;  3CC2 1;  1YJ9 1;  4NH1 C;  4E32 A;  3H3V J;  2AYD A;  3LUS A;  2LFU A;  2K3R A;  4HGY A;  2RPR A;  1WJ2 A;  2HF1 A;  1W2B Z;  3HOU I;  3HOZ I;  2QA4 Z;  2I3C A;  1VQN Z;  3J7A 4;  1Q86 2;  1S72 1;  2KI7 B;  4X6A I;  1NJI 2;  3H0G I;  3CD6 Z;  1VQ9 1;  3GKQ A;  1QVF Z;  2G2K A;  1TWA I;  2GU2 A;  4NBC A;  3PO2 I;  2JIO A;  1RQF A;  2JA8 I;  5D1P A;  3HOX I;  3S16 I;  1USP B;  2OTL 1;  1VQ9 Z;  4DK1 A;  2Y0S A;  1VQL Z;  1NJI 1;  5LL6 f;  1Q82 2;  3BG1 B; 
#chains in the Genus database with same CATH homology
 3M3Y I;  5D1O A;  4A3D I;  3HOV I;  4A3C I;  3G71 Z;  1JWH C;  3GTK I;  3GCF A;  1QVG Y;  2OOY B;  3QWU A;  1I50 I;  2VF1 A;  1RNI A;  4RVG A;  2V8I A;  2R7Z I;  1Y1V S;  1VQO Z;  3FQQ A;  1Q82 1;  2VUM I;  3S1R I;  5C4J I;  2OOX B;  2NVX I;  2KPI A;  3F3F C;  1ZH1 A;  3CCL 1;  1RO2 A;  5A2Q f;  1I6H I;  2J6A A;  2K5R A;  1NP6 A;  1Y1V I;  2RT9 A;  3VMH A;  3PO3 I;  2H85 A;  2OTJ 1;  4A3K I;  3I4M I;  2P3Y A;  5AN9 F;  3IF8 A;  2ZAE B;  3J80 f;  3I55 1;  1X3Z A;  2WB1 A;  4Y7N I;  4XX2 A;  3CCJ 1;  3S1M I;  2OTJ Z;  5D1O B;  3HOW I;  3J81 f;  3RZD I;  1Q81 1;  3CXC Z;  3I56 1;  3I55 Z;  3I07 A;  3GTQ I;  4A3M I;  2DE6 A;  1VQ4 1;  3CMA Z;  1TWC I;  3NH4 A;  4NBG A;  3CCJ Z;  2JUB A;  4MXU A;  1KD1 1;  3NH5 A;  1VQP 1;  5T6B A;  5T67 A;  2IZ3 A;  1USP A;  2YU9 I;  3I56 Z;  4A3L I;  1N8R 2;  1Q7Y 2;  5C4X I;  2QKD A;  3EER A;  4NB8 A;  4NBE A;  1YI2 Z;  1TWG I;  1NUI A;  2R92 I;  3MZL B;  1YIT 1;  2PK7 A;  3OW2 Y;  3IX0 A;  3D9X A;  4MH4 A;  1W2B Y;  4MRI A;  1YUK A;  1YIJ 1;  4A3B I;  5A2Q b;  1VQK 1;  5FLX b;  2M6N A;  1S7M A;  1N8R 1;  2QRC B;  3VB9 A;  1Q7Y 1;  2JS4 A;  2Q4Z A;  3CCE 1;  2JA7 I;  1YIT Z;  3RZO I;  2B63 I;  4DGL A;  1VQ7 1;  4CL1 A;  4EWC A;  1QVF Y;  3CC2 Z;  1QYP A;  1YJ9 Z;  3S17 I;  3G4S 1;  1TWH I;  1VQK Z;  3CC7 1;  4MD7 A;  3CCR 1;  3J80 b;  3CCE Z;  1LQL A;  1X3W A;  4NBD A;  1VQ5 1;  2JMO A;  1S72 Z;  3J81 b;  5T64 A;  3CC7 Z;  1K83 I;  3CPW Y;  4NBA A;  3ESW A;  4AYB A;  2O4H A;  2QLV B;  1VQ5 Z;  1R9T I;  2OTL Z;  4BY1 I;  4NB9 A;  2RBL A;  3CC4 1;  1WCM I;  3CCU 1;  1WII A;  1VQ6 1;  4QTU A;  3CCM 1;  2AKL A;  1K73 2;  3IFU A;  2F4O A;  3G6E 1;  3CCU Z;  3CC4 Z;  3GTJ I;  1WW9 A;  1RO0 A;  1VQ6 Z;  1VQM 1;  2PMZ A;  2P28 A;  1N2F A;  3G6E Z;  2EGT A;  3GTP I;  4Y52 I;  1Z01 A;  3M4O I;  4E2Y A;  1K73 1;  2QRE B;  5FLX f;  1M90 1;  2LIY A;  4NBH A;  1Q81 2;  2RIQ A;  3CCQ 1;  3S14 I;  3FKI I;  1QVG Z;  4BXX I;  3CCL Z;  1VQ8 1;  2DE7 A;  2R93 I;  1KD1 2;  3GTM S;  3NH8 A;  1KC8 2;  3CXC Y;  2YAD A;  4E31 A;  4BBS I;  1RO4 A;  2JA5 I;  1X0T A;  1KQS Z;  4NFR A;  1M1K 2;  2V8J A;  4DQY B;  2VUG A;  1JJ2 Y;  3CCS 1;  1KC8 1;  5FLM I;  2OZK A;  2Q51 A;  3KIH A;  3P5J B;  1VQ4 Z;  4E2X A;  2W04 A;  4QTT A;  3JAM f;  2R6M A;  1VQP Z;  4E33 A;  1L1O C;  1M1K 1;  2NVT I;  4MD8 A;  5C44 I;  2IZ4 A;  3EED A;  3FQM A;  2M48 A;  3HKZ A;  2JNY A;  1ZB8 A;  5IP9 I;  3NFZ A;  4RV9 A;  4NBB A;  3MZK B;  2E9H A;  1YUA A;  4NBF A;  4A3G I;  1YIJ Z;  3S15 I;  2NVQ I;  2GTH A;  4A3I I;  4RS4 A;  2QA4 1;  5IT9 b;  3NDI A;  1VQN 1;  2F4M A;  1VQ7 Z;  3U50 C;  3G4S Z;  1TWF I;  3OW2 Z;  3CD6 1;  2V8K A;  3GTG I;  3CCR Z;  3S1N I;  3S2H I;  1P9N A;  1VLA A;  4MD9 A;  3TE5 B;  1YJW 1;  1Z03 A;  3BG0 B;  4RVD A;  3S2D I;  1VQL 1;  3TDH B;  3K7A I;  4BY7 I;  1YJW Z;  3HOY I;  3JAM b;  1M90 2;  1Q86 1;  3G71 1;  3CPW Z;  4E30 A;  3CCM Z;  2QEX 1;  3VTN A;  1KRL A;  2WAQ A;  5IP7 I;  1DL6 A;  1TFI A;  1VQO 1;  4BBR I;  4MON A;  2E2I I;  1K8A 2;  3MON A;  2QEX Z;  1VQM Z;  2NVY I;  2JA6 I;  4RVF A;  1K9M 2;  5CM2 M;  3PO3 S;  2BJO A;  3D6W A;  3F3P C;  2GTI A;  5IT9 f;  1SFO I;  3CCQ Z;  1YHQ 1;  1KQS Y;  5C3E I;  1VQ8 Z;  1K8A 1;  3Q87 A;  1YJN 1;  1K9M 1;  3GTM I;  1ML8 A;  1YHQ Z;  2PM9 A;  4E2W A;  2RHB A;  2JR6 A;  2QRD B;  2HU9 A;  3VMI A;  2E2H I;  3CMA 1;  1YJN Z;  3CQZ I;  1ZB9 A;  3NDJ A;  2W03 A;  3CCS Z;  3GTL I;  4NOZ A;  4RVH A;  3CME 1;  2DE5 A;  3VMG A;  2O53 A;  1YI2 1;  2QR1 B;  3I4N I;  4HGZ A;  1PFT A;  4E2Z A;  3CCV 1;  4HH4 A;  3KIF A;  4TNU A;  1QF8 A;  1JJ2 Z;  3CME Z;  3T4N B;  4A3F I;  4A3E I;  1Z02 A;  3GTO I;  1I3Q I;  3CCV Z;  3S1Q I;  4S1T A;  1Y1W I;  1RLY A;  4A93 I;  4A3J I;  2E2J I;  3CC2 1;  1YJ9 1;  4NH1 C;  4E32 A;  3H3V J;  3LUS A;  2LFU A;  2K3R A;  4HGY A;  2RPR A;  2HF1 A;  1W2B Z;  3HOU I;  3HOZ I;  2QA4 Z;  2I3C A;  1VQN Z;  3J7A 4;  1Q86 2;  1S72 1;  2KI7 B;  4X6A I;  1NJI 2;  3H0G I;  3CD6 Z;  1VQ9 1;  3GKQ A;  1QVF Z;  2G2K A;  1TWA I;  2GU2 A;  4NBC A;  3PO2 I;  1RQF A;  2JA8 I;  5D1P A;  3HOX I;  3S16 I;  1USP B;  2OTL 1;  1VQ9 Z;  4DK1 A;  2Y0S A;  1VQL Z;  1NJI 1;  5LL6 f;  1Q82 2;  3BG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...