2JNYA

Solution nmr structure of protein uncharacterized bcr, northeast structural genomics consortium target cgr1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPNNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized BCR
publication title Solution NMR structure of protein Uncharacterized BCR, Northeast Structural Genomics Consortium target CgR1
rcsb
source organism Corynebacterium glutamicum
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jnyA01
2R93I 1TFIA 3HOZI 1TWHI 3ESWA 3GTMI 4BY7I 3M4OI 1RLYA 4A3II 2DE6A 2JNYA 1TWGI 3GTLI 1X3ZA 3PO2I 4NB9A 2NVYI 3GTQI 3U50C 3GTJI 2E2JI 2BJOA 2J6AA 2PK7A 4X6AI 2JS4A 3GTGI 3M3YI 4Y52I 4A3BI 1SFOI 4A3EI 3VB9A 2DE7A 2F4MA 3S14I 2VUMI 1RO4A 4QTTA 1PFTA 5C4XI 3GTKI 2JR6A 5C3EI 3S16I 1I3QI 3PO3S 2E2II 4BBRI 3GCFA 3Q87A 2R92I 1K83I 4BY1I 2JA8I 1ZB9A 2K5RA 3I4NI 2JA6I 1TWCI 3GTOI 2R7ZI 3S15I 5C44I 3H3VJ 4QTUA 4NBEA 3GKQA 2E2HI 1USPA 1YUAA 4A3GI 1L1OC 3PO3I 2DE5A 2NVTI 1ZB8A 1VLAA 1Y1VS 2P3YA 4NBHA 1R9TI 2JA5I 3S1QI 2KPIA 3S1RI 4NBGA 3HOVI 3S17I 3FKII 4BXXI 3K7AI 4XX2A 5C4JI 4NB8A 5CM2M 1TWAI 3VMHA 1QYPA 3HOYI 3S2DI 1Y1VI 1I50I 3VMIA 1N2FA 1USPB 4A3KI 3S2HI 3EERA 4NBBA 4NBFA 2RBLA 2AKLA 3LUSA 1TWFI 4A3CI 1LQLA 4NBCA 4BBSI 3HOUI 5FLMI 3RZOI 4A93I 3I07A 3RZDI 2JA7I 3VMGA 5IP9I 4NOZA 2F4OA 4NBDA 3I4MI 5IP7I 2NVXI 4A3FI 2HF1A 1Y1WI 1WCMI 1X3WA 2YU9I 3CQZI 1DL6A 3D6WA 4A3DI 4A3LI 3HOXI 2B63I 1I6HI 3GTMS 4A3JI 1ML8A 1WW9A 3S1NI 3HOWI 4A3MI 3H0GI 3S1MI 4NBAA 3GTPI 4Y7NI 1NUIA 2NVQI 4MH4A
chains in the Genus database with same CATH superfamily
2JIPA 3CCL1 3TE5B 3G71Z 3HOZI 1KQSZ 2QRDB 3F3PC 3CCJ1 1VQL1 3G6E1 1N8R1 4E2YA 2W04A 3GTLI 2M6NA 3CC4Z 1Z03A 4NB9A 3CCVZ 2JUBA 3GTQI 3KIHA 3CCQZ 2J6AA 3J81b 1YJ91 3M3YI 5FLXf 4A3BI 3FQQA 4A3EI 1Q7Y1 2VPXA 3G4S1 2LIYA 2DE7A 2V8JA 1VQ4Z 3MZLB 2VUMI 3BG0B 5C4XI 1Q822 1P9NA 3PO3S 2E2II 4BBRI 3CCLZ 2E9HA 3CD61 3Q87A 1NJI1 3CCJZ 1QVGY 2JA6I 1VQLZ 3G6EZ 1JJ2Z 1Q862 2OZKA 5C44I 3H3VJ 3I561 3CMA1 2R6MA 2QA41 1KC82 4MRIA 4HGZA 1VQN1 4E33A 2NVTI 1YJ9Z 2LFUA 4MXUA 5T6BA 3G4SZ 3S17I 4BXXI 3K7AI 2IV2X 4XX2A 3CPWY 1QYPA 2VPZA 3CD6Z 2OTJ1 3J80b 5A2Qf 1N8R2 1YJW1 2OTL1 2WAQA 3I56Z 1TWFI 2QA4Z 3NH5A 3HOUI 5FLMI 3RZOI 1VQNZ 4NH1C 1VQ71 1Q7Y2 1RNIA 2NVXI 4A3FI 2HF1A 1WZNA 3BG1B 1DL6A 2E7ZA 4RV9A 3HOXI 2B63I 1I6HI 1ML8A 3NDIA 3GTPI 4Y7NI 1YJWZ 3MONA 3ESWA 4BY7I 4HH4A 3MZKB 2DE6A 2JIOA 3JAMb 1TWGI 1VQ7Z 1X3ZA 1M1K1 3U50C 1QF8A 2E2JI 2K3RA 2PK7A 4DK1A 1K731 5IT9b 3VB9A 1QXFA 1RO2A 3S16I 1FDIA 4E32A 1K83I 2K5RA 3CCE1 2R7ZI 4NBEA 1YUAA 3I55Z 1L1OC 1QVGZ 3TDHB 3PO3I 3T4NB 2DE5A 1ZB8A 3J81f 5T64A 2P3YA 1FDOA 2ZAEB 1R9TI 1NP6A 1KD11 3S1RI 2JIRA 1M902 4NB8A 2HU9A 1TWAI 3HOYI 3IF8A 1Z02A 1S721 5FLXb 2M48A 3VMIA 3CPWZ 1Q16A 3CCEZ 2KI7B 1RQFA 3LUSA 1K8A1 1LQLA 4MONA 4DQYB 1SIWA 2W03A 2Q51A 3VTNA 1K732 4RS4A 2GTHA 1K9M2 2QKDA 5IP7I 4MD9A 4E31A 1QVFY 3F3FC 2QR1B 4A3DI 3GTMS 1WW9A 2O53A 1S72Z 2VUGA 3HOWI 3H0GI 3J80f 4NBAA 3CMAZ 4MH4A 1YJN1 2R93I 2IZ3A 4RVDA 1TFIA 1VQK1 2OOXB 3D2LA 1RLYA 4A3II 1ZH1A 5D1PA 2JNYA 5D1OB 4RVFA 1S7MA 2O4HA 3GTJI 2VPWA 2BJOA 4X6AI 2JS4A 3GTGI 2OTJZ 4Y52I 1NJI2 2F4MA 2OTLZ 3NH4A 1RO4A 3CCS1 3GTKI 3CCM1 2JR6A 5C3EI 2PMZA 1I3QI 1YJNZ 2QRCB 1Q811 3GCFA 2P28A 3QWUA 1VQKZ 2JA8I 3P5JB 3I4NI 1YUKA 3NFZA 3JAMf 3S15I 4TNUA 4QTUA 1Q821 2E2HI 4A3GI 1VQM1 1VLAA 5IT9f 1Y1VS 4NBHA 1W2BZ 2JA5I 3S1QI 2KPIA 4NBGA 4EWCA 4RVHA 3VMHA 3CCSZ 3D9XA 2PM9A 2IZ4A 2JMOA 2OOYB 3FQMA 2NAPA 1N2FA 1USPB 1Z01A 4A3KI 1W2BY 3S2HI 2QREB 3EERA 4NBFA 2RBLA 2GTIA 4A3CI 4NBCA 3OW2Y 2WB1A 1VQMZ 3I07A 3J7A4 2JA7I 3VMGA 3CXCY 1VQP1 2QLVB 1KRLA 2VF1A 2YADA 4NBDA 2G2KA 3I4MI 5D1OA 4AYBA 1Y1WI 3CQZI 1X0TA 2V3VA 4A3LI 3CC21 1Q812 1YI21 1QVFZ 3S1NI 2VPYA 1WJ2A 1KQSY 3S1MI 4CL1A 1M1K2 2NVQI 3CME1 1TWHI 3GTMI 3M4OI 2RHBA 3CC71 1VQPZ 3PO2I 4E2WA 2RT9A 1YIT1 2NVYI 3KIFA 1VQ51 1VQ61 1YHQ1 2H85A 3CC2Z 1SFOI 1YI2Z 1VQ91 3S14I 2Y0SA 4QTTA 1PFTA 1JJ2Y 4MD7A 2V8IA 3CMEZ 4E2XA 3CCU1 2R92I 3HKZA 1VQO1 4BY1I 1ZB9A 3NH8A 5T67A 1TWCI 3CCR1 5A2Qb 3IR7A 1KD12 3GTOI 1RO0A 3CC7Z 3GKQA 1USPA 1YITZ 5LL6f 3IX0A 1Y8CA 1VQ5Z 1VQ81 3IFUA 1VQ6Z 2V45A 4MD8A 1YHQZ 4NFRA 4E30A 3HOVI 2I3CA 4RVGA 2QEX1 3FKII 1VQ9Z 5C4JI 5CM2M 1K8A2 2EGTA 1WIIA 4S1TA 3S2DI 2JIMA 3CCUZ 1Y1VI 1I50I 3EEDA 1VQOZ 3CCRZ 4NBBA 1YIJ1 1M901 2AKLA 3G711 4DGLA 4BBSI 2RIQA 4A93I 3RZDI 1Q861 1VQ8Z 2GU2A 2Q4ZA 4E2ZA 5IP9I 3CC41 2V8KA 4NOZA 3CCV1 3OW2Z 2F4OA 2AYDA 1KC81 2LEXA 3CCQ1 2QEXZ 1JWHC 3CCMZ 4HGYA 3I551 1WCMI 1X3WA 2YU9I 1AA6A 3CXCZ 3D6WA 3NDJA 4A3JI 1K9M1 1VQ41 4A3MI 2RPRA 2JIQA 5AN9F 1NUIA 1YIJZ
chains in the Genus database with same CATH topology
3CCL1 3TE5B 3G71Z 3HOZI 1KQSZ 2QRDB 3F3PC 3CCJ1 1VQL1 3G6E1 1N8R1 4E2YA 2W04A 3GTLI 2M6NA 3CC4Z 1Z03A 4NB9A 3CCVZ 2JUBA 3GTQI 3KIHA 3CCQZ 2J6AA 3J81b 1YJ91 3M3YI 5FLXf 4A3BI 3FQQA 4A3EI 1Q7Y1 3G4S1 2LIYA 2DE7A 2V8JA 1VQ4Z 3MZLB 2VUMI 3BG0B 5C4XI 1Q822 1P9NA 3PO3S 2E2II 4BBRI 3CCLZ 2E9HA 3CD61 3Q87A 1NJI1 3CCJZ 1QVGY 2JA6I 1VQLZ 3G6EZ 1JJ2Z 1Q862 2OZKA 5C44I 3H3VJ 3I561 3CMA1 2R6MA 2QA41 1KC82 4MRIA 4HGZA 1VQN1 4E33A 2NVTI 1YJ9Z 2LFUA 4MXUA 5T6BA 3G4SZ 3S17I 4BXXI 3K7AI 4XX2A 3CPWY 1QYPA 3CD6Z 2OTJ1 3J80b 5A2Qf 1N8R2 1YJW1 2OTL1 2WAQA 3I56Z 1TWFI 2QA4Z 3NH5A 3HOUI 5FLMI 3RZOI 1VQNZ 4NH1C 1VQ71 1Q7Y2 1RNIA 2NVXI 4A3FI 2HF1A 3BG1B 1DL6A 4RV9A 3HOXI 2B63I 1I6HI 1ML8A 3NDIA 3GTPI 4Y7NI 1YJWZ 3MONA 3ESWA 4BY7I 4HH4A 3MZKB 2DE6A 3JAMb 1TWGI 1VQ7Z 1X3ZA 1M1K1 3U50C 1QF8A 2E2JI 2K3RA 2PK7A 4DK1A 1K731 5IT9b 3VB9A 1RO2A 3S16I 4E32A 1K83I 2K5RA 3CCE1 2R7ZI 4NBEA 1YUAA 3I55Z 1L1OC 1QVGZ 3TDHB 3PO3I 3T4NB 2DE5A 1ZB8A 3J81f 5T64A 2P3YA 2ZAEB 1R9TI 1NP6A 1KD11 3S1RI 1M902 4NB8A 2HU9A 1TWAI 3HOYI 3IF8A 1Z02A 1S721 5FLXb 2M48A 3VMIA 3CPWZ 3CCEZ 2KI7B 1RQFA 3LUSA 1K8A1 1LQLA 4MONA 4DQYB 2W03A 2Q51A 3VTNA 1K732 4RS4A 2GTHA 1K9M2 2QKDA 5IP7I 4MD9A 4E31A 1QVFY 3F3FC 2QR1B 4A3DI 3GTMS 1WW9A 2O53A 1S72Z 2VUGA 3HOWI 3H0GI 3J80f 4NBAA 3CMAZ 4MH4A 1YJN1 2R93I 2IZ3A 4RVDA 1TFIA 1VQK1 2OOXB 1RLYA 4A3II 1ZH1A 5D1PA 2JNYA 5D1OB 4RVFA 1S7MA 2O4HA 3GTJI 2BJOA 4X6AI 2JS4A 3GTGI 2OTJZ 4Y52I 1NJI2 2F4MA 2OTLZ 3NH4A 1RO4A 3CCS1 3GTKI 3CCM1 2JR6A 5C3EI 2PMZA 1I3QI 1YJNZ 2QRCB 1Q811 3GCFA 2P28A 3QWUA 1VQKZ 2JA8I 3P5JB 3I4NI 1YUKA 3NFZA 3JAMf 3S15I 4TNUA 4QTUA 1Q821 2E2HI 4A3GI 1VQM1 1VLAA 5IT9f 1Y1VS 4NBHA 1W2BZ 2JA5I 3S1QI 2KPIA 4NBGA 4EWCA 4RVHA 3VMHA 3CCSZ 3D9XA 2PM9A 2IZ4A 2JMOA 2OOYB 3FQMA 1N2FA 1USPB 1Z01A 4A3KI 1W2BY 3S2HI 2QREB 3EERA 4NBFA 2RBLA 2GTIA 4A3CI 4NBCA 3OW2Y 2WB1A 1VQMZ 3I07A 3J7A4 2JA7I 3VMGA 3CXCY 1VQP1 2QLVB 1KRLA 2VF1A 2YADA 4NBDA 2G2KA 3I4MI 5D1OA 4AYBA 1Y1WI 3CQZI 1X0TA 4A3LI 3CC21 1Q812 1YI21 1QVFZ 3S1NI 1KQSY 3S1MI 4CL1A 1M1K2 2NVQI 3CME1 1TWHI 3GTMI 3M4OI 2RHBA 3CC71 1VQPZ 3PO2I 4E2WA 2RT9A 1YIT1 2NVYI 3KIFA 1VQ51 1VQ61 1YHQ1 2H85A 3CC2Z 1SFOI 1YI2Z 1VQ91 3S14I 2Y0SA 4QTTA 1PFTA 1JJ2Y 4MD7A 2V8IA 3CMEZ 4E2XA 3CCU1 2R92I 3HKZA 1VQO1 4BY1I 1ZB9A 3NH8A 5T67A 1TWCI 3CCR1 5A2Qb 1KD12 3GTOI 1RO0A 3CC7Z 3GKQA 1USPA 1YITZ 5LL6f 3IX0A 1VQ5Z 1VQ81 3IFUA 1VQ6Z 4MD8A 1YHQZ 4NFRA 4E30A 3HOVI 2I3CA 4RVGA 2QEX1 3FKII 1VQ9Z 5C4JI 5CM2M 1K8A2 2EGTA 1WIIA 4S1TA 3S2DI 3CCUZ 1Y1VI 1I50I 3EEDA 1VQOZ 3CCRZ 4NBBA 1YIJ1 1M901 2AKLA 3G711 4DGLA 4BBSI 2RIQA 4A93I 3RZDI 1Q861 1VQ8Z 2GU2A 2Q4ZA 4E2ZA 5IP9I 3CC41 2V8KA 4NOZA 3CCV1 3OW2Z 2F4OA 1KC81 3CCQ1 2QEXZ 1JWHC 4HGYA 3CCMZ 3I551 1WCMI 1X3WA 2YU9I 3CXCZ 3D6WA 3NDJA 4A3JI 1K9M1 1VQ41 4A3MI 2RPRA 5AN9F 1NUIA 1YIJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 I;  1TFI A;  3HOZ I;  1TWH I;  3ESW A;  3GTM I;  4BY7 I;  3M4O I;  1RLY A;  4A3I I;  2DE6 A;  2JNY A;  1TWG I;  3GTL I;  1X3Z A;  3PO2 I;  4NB9 A;  2NVY I;  3GTQ I;  3U50 C;  3GTJ I;  2E2J I;  2BJO A;  2J6A A;  2PK7 A;  4X6A I;  2JS4 A;  3GTG I;  3M3Y I;  4Y52 I;  4A3B I;  1SFO I;  4A3E I;  3VB9 A;  2DE7 A;  2F4M A;  3S14 I;  2VUM I;  1RO4 A;  4QTT A;  1PFT A;  5C4X I;  3GTK I;  2JR6 A;  5C3E I;  3S16 I;  1I3Q I;  3PO3 S;  2E2I I;  4BBR I;  3GCF A;  3Q87 A;  2R92 I;  1K83 I;  4BY1 I;  2JA8 I;  1ZB9 A;  2K5R A;  3I4N I;  2JA6 I;  1TWC I;  3GTO I;  2R7Z I;  3S15 I;  5C44 I;  3H3V J;  4QTU A;  4NBE A;  3GKQ A;  2E2H I;  1USP A;  1YUA A;  4A3G I;  1L1O C;  3PO3 I;  2DE5 A;  2NVT I;  1ZB8 A;  1VLA A;  1Y1V S;  2P3Y A;  4NBH A;  1R9T I;  2JA5 I;  3S1Q I;  2KPI A;  3S1R I;  4NBG A;  3HOV I;  3S17 I;  3FKI I;  4BXX I;  3K7A I;  4XX2 A;  5C4J I;  4NB8 A;  5CM2 M;  1TWA I;  3VMH A;  1QYP A;  3HOY I;  3S2D I;  1Y1V I;  1I50 I;  3VMI A;  1N2F A;  1USP B;  4A3K I;  3S2H I;  3EER A;  4NBB A;  4NBF A;  2RBL A;  2AKL A;  3LUS A;  1TWF I;  4A3C I;  1LQL A;  4NBC A;  4BBS I;  3HOU I;  5FLM I;  3RZO I;  4A93 I;  3I07 A;  3RZD I;  2JA7 I;  3VMG A;  5IP9 I;  4NOZ A;  2F4O A;  4NBD A;  3I4M I;  5IP7 I;  2NVX I;  4A3F I;  2HF1 A;  1Y1W I;  1WCM I;  1X3W A;  2YU9 I;  3CQZ I;  1DL6 A;  3D6W A;  4A3D I;  4A3L I;  3HOX I;  2B63 I;  1I6H I;  3GTM S;  4A3J I;  1ML8 A;  1WW9 A;  3S1N I;  3HOW I;  4A3M I;  3H0G I;  3S1M I;  4NBA A;  3GTP I;  4Y7N I;  1NUI A;  2NVQ I;  4MH4 A; 
#chains in the Genus database with same CATH topology
 2JIP A;  3CCL 1;  3TE5 B;  3G71 Z;  3HOZ I;  1KQS Z;  2QRD B;  3F3P C;  3CCJ 1;  1VQL 1;  3G6E 1;  1N8R 1;  4E2Y A;  2W04 A;  3GTL I;  2M6N A;  3CC4 Z;  1Z03 A;  4NB9 A;  3CCV Z;  2JUB A;  3GTQ I;  3KIH A;  3CCQ Z;  2J6A A;  3J81 b;  1YJ9 1;  3M3Y I;  5FLX f;  4A3B I;  3FQQ A;  4A3E I;  1Q7Y 1;  2VPX A;  3G4S 1;  2LIY A;  2DE7 A;  2V8J A;  1VQ4 Z;  3MZL B;  2VUM I;  3BG0 B;  5C4X I;  1Q82 2;  1P9N A;  3PO3 S;  2E2I I;  4BBR I;  3CCL Z;  2E9H A;  3CD6 1;  3Q87 A;  1NJI 1;  3CCJ Z;  1QVG Y;  2JA6 I;  1VQL Z;  3G6E Z;  1JJ2 Z;  1Q86 2;  2OZK A;  5C44 I;  3H3V J;  3I56 1;  3CMA 1;  2R6M A;  2QA4 1;  1KC8 2;  4MRI A;  4HGZ A;  1VQN 1;  4E33 A;  2NVT I;  1YJ9 Z;  2LFU A;  4MXU A;  5T6B A;  3G4S Z;  3S17 I;  4BXX I;  3K7A I;  2IV2 X;  4XX2 A;  3CPW Y;  1QYP A;  2VPZ A;  3CD6 Z;  2OTJ 1;  3J80 b;  5A2Q f;  1N8R 2;  1YJW 1;  2OTL 1;  2WAQ A;  3I56 Z;  1TWF I;  2QA4 Z;  3NH5 A;  3HOU I;  5FLM I;  3RZO I;  1VQN Z;  4NH1 C;  1VQ7 1;  1Q7Y 2;  1RNI A;  2NVX I;  4A3F I;  2HF1 A;  1WZN A;  3BG1 B;  1DL6 A;  2E7Z A;  4RV9 A;  3HOX I;  2B63 I;  1I6H I;  1ML8 A;  3NDI A;  3GTP I;  4Y7N I;  1YJW Z;  3MON A;  3ESW A;  4BY7 I;  4HH4 A;  3MZK B;  2DE6 A;  2JIO A;  3JAM b;  1TWG I;  1VQ7 Z;  1X3Z A;  1M1K 1;  3U50 C;  1QF8 A;  2E2J I;  2K3R A;  2PK7 A;  4DK1 A;  1K73 1;  5IT9 b;  3VB9 A;  1QXF A;  1RO2 A;  3S16 I;  1FDI A;  4E32 A;  1K83 I;  2K5R A;  3CCE 1;  2R7Z I;  4NBE A;  1YUA A;  3I55 Z;  1L1O C;  1QVG Z;  3TDH B;  3PO3 I;  3T4N B;  2DE5 A;  1ZB8 A;  3J81 f;  5T64 A;  2P3Y A;  1FDO A;  2ZAE B;  1R9T I;  1NP6 A;  1KD1 1;  3S1R I;  2JIR A;  1M90 2;  4NB8 A;  2HU9 A;  1TWA I;  3HOY I;  3IF8 A;  1Z02 A;  1S72 1;  5FLX b;  2M48 A;  3VMI A;  3CPW Z;  1Q16 A;  3CCE Z;  2KI7 B;  1RQF A;  3LUS A;  1K8A 1;  1LQL A;  4MON A;  4DQY B;  1SIW A;  2W03 A;  2Q51 A;  3VTN A;  1K73 2;  4RS4 A;  2GTH A;  1K9M 2;  2QKD A;  5IP7 I;  4MD9 A;  4E31 A;  1QVF Y;  3F3F C;  2QR1 B;  4A3D I;  3GTM S;  1WW9 A;  2O53 A;  1S72 Z;  2VUG A;  3HOW I;  3H0G I;  3J80 f;  4NBA A;  3CMA Z;  4MH4 A;  1YJN 1;  2R93 I;  2IZ3 A;  4RVD A;  1TFI A;  1VQK 1;  2OOX B;  3D2L A;  1RLY A;  4A3I I;  1ZH1 A;  5D1P A;  2JNY A;  5D1O B;  4RVF A;  1S7M A;  2O4H A;  3GTJ I;  2VPW A;  2BJO A;  4X6A I;  2JS4 A;  3GTG I;  2OTJ Z;  4Y52 I;  1NJI 2;  2F4M A;  2OTL Z;  3NH4 A;  1RO4 A;  3CCS 1;  3GTK I;  3CCM 1;  2JR6 A;  5C3E I;  2PMZ A;  1I3Q I;  1YJN Z;  2QRC B;  1Q81 1;  3GCF A;  2P28 A;  3QWU A;  1VQK Z;  2JA8 I;  3P5J B;  3I4N I;  1YUK A;  3NFZ A;  3JAM f;  3S15 I;  4TNU A;  4QTU A;  1Q82 1;  2E2H I;  4A3G I;  1VQM 1;  1VLA A;  5IT9 f;  1Y1V S;  4NBH A;  1W2B Z;  2JA5 I;  3S1Q I;  2KPI A;  4NBG A;  4EWC A;  4RVH A;  3VMH A;  3CCS Z;  3D9X A;  2PM9 A;  2IZ4 A;  2JMO A;  2OOY B;  3FQM A;  2NAP A;  1N2F A;  1USP B;  1Z01 A;  4A3K I;  1W2B Y;  3S2H I;  2QRE B;  3EER A;  4NBF A;  2RBL A;  2GTI A;  4A3C I;  4NBC A;  3OW2 Y;  2WB1 A;  1VQM Z;  3I07 A;  3J7A 4;  2JA7 I;  3VMG A;  3CXC Y;  1VQP 1;  2QLV B;  1KRL A;  2VF1 A;  2YAD A;  4NBD A;  2G2K A;  3I4M I;  5D1O A;  4AYB A;  1Y1W I;  3CQZ I;  1X0T A;  2V3V A;  4A3L I;  3CC2 1;  1Q81 2;  1YI2 1;  1QVF Z;  3S1N I;  2VPY A;  1WJ2 A;  1KQS Y;  3S1M I;  4CL1 A;  1M1K 2;  2NVQ I;  3CME 1;  1TWH I;  3GTM I;  3M4O I;  2RHB A;  3CC7 1;  1VQP Z;  3PO2 I;  4E2W A;  2RT9 A;  1YIT 1;  2NVY I;  3KIF A;  1VQ5 1;  1VQ6 1;  1YHQ 1;  2H85 A;  3CC2 Z;  1SFO I;  1YI2 Z;  1VQ9 1;  3S14 I;  2Y0S A;  4QTT A;  1PFT A;  1JJ2 Y;  4MD7 A;  2V8I A;  3CME Z;  4E2X A;  3CCU 1;  2R92 I;  3HKZ A;  1VQO 1;  4BY1 I;  1ZB9 A;  3NH8 A;  5T67 A;  1TWC I;  3CCR 1;  5A2Q b;  3IR7 A;  1KD1 2;  3GTO I;  1RO0 A;  3CC7 Z;  3GKQ A;  1USP A;  1YIT Z;  5LL6 f;  3IX0 A;  1Y8C A;  1VQ5 Z;  1VQ8 1;  3IFU A;  1VQ6 Z;  2V45 A;  4MD8 A;  1YHQ Z;  4NFR A;  4E30 A;  3HOV I;  2I3C A;  4RVG A;  2QEX 1;  3FKI I;  1VQ9 Z;  5C4J I;  5CM2 M;  1K8A 2;  2EGT A;  1WII A;  4S1T A;  3S2D I;  2JIM A;  3CCU Z;  1Y1V I;  1I50 I;  3EED A;  1VQO Z;  3CCR Z;  4NBB A;  1YIJ 1;  1M90 1;  2AKL A;  3G71 1;  4DGL A;  4BBS I;  2RIQ A;  4A93 I;  3RZD I;  1Q86 1;  1VQ8 Z;  2GU2 A;  2Q4Z A;  4E2Z A;  5IP9 I;  3CC4 1;  2V8K A;  4NOZ A;  3CCV 1;  3OW2 Z;  2F4O A;  2AYD A;  1KC8 1;  2LEX A;  3CCQ 1;  2QEX Z;  1JWH C;  3CCM Z;  4HGY A;  3I55 1;  1WCM I;  1X3W A;  2YU9 I;  1AA6 A;  3CXC Z;  3D6W A;  3NDJ A;  4A3J I;  1K9M 1;  1VQ4 1;  4A3M I;  2RPR A;  2JIQ A;  5AN9 F;  1NUI A;  1YIJ Z; 
#chains in the Genus database with same CATH homology
 3CCL 1;  3TE5 B;  3G71 Z;  3HOZ I;  1KQS Z;  2QRD B;  3F3P C;  3CCJ 1;  1VQL 1;  3G6E 1;  1N8R 1;  4E2Y A;  2W04 A;  3GTL I;  2M6N A;  3CC4 Z;  1Z03 A;  4NB9 A;  3CCV Z;  2JUB A;  3GTQ I;  3KIH A;  3CCQ Z;  2J6A A;  3J81 b;  1YJ9 1;  3M3Y I;  5FLX f;  4A3B I;  3FQQ A;  4A3E I;  1Q7Y 1;  3G4S 1;  2LIY A;  2DE7 A;  2V8J A;  1VQ4 Z;  3MZL B;  2VUM I;  3BG0 B;  5C4X I;  1Q82 2;  1P9N A;  3PO3 S;  2E2I I;  4BBR I;  3CCL Z;  2E9H A;  3CD6 1;  3Q87 A;  1NJI 1;  3CCJ Z;  1QVG Y;  2JA6 I;  1VQL Z;  3G6E Z;  1JJ2 Z;  1Q86 2;  2OZK A;  5C44 I;  3H3V J;  3I56 1;  3CMA 1;  2R6M A;  2QA4 1;  1KC8 2;  4MRI A;  4HGZ A;  1VQN 1;  4E33 A;  2NVT I;  1YJ9 Z;  2LFU A;  4MXU A;  5T6B A;  3G4S Z;  3S17 I;  4BXX I;  3K7A I;  4XX2 A;  3CPW Y;  1QYP A;  3CD6 Z;  2OTJ 1;  3J80 b;  5A2Q f;  1N8R 2;  1YJW 1;  2OTL 1;  2WAQ A;  3I56 Z;  1TWF I;  2QA4 Z;  3NH5 A;  3HOU I;  5FLM I;  3RZO I;  1VQN Z;  4NH1 C;  1VQ7 1;  1Q7Y 2;  1RNI A;  2NVX I;  4A3F I;  2HF1 A;  3BG1 B;  1DL6 A;  4RV9 A;  3HOX I;  2B63 I;  1I6H I;  1ML8 A;  3NDI A;  3GTP I;  4Y7N I;  1YJW Z;  3MON A;  3ESW A;  4BY7 I;  4HH4 A;  3MZK B;  2DE6 A;  3JAM b;  1TWG I;  1VQ7 Z;  1X3Z A;  1M1K 1;  3U50 C;  1QF8 A;  2E2J I;  2K3R A;  2PK7 A;  4DK1 A;  1K73 1;  5IT9 b;  3VB9 A;  1RO2 A;  3S16 I;  4E32 A;  1K83 I;  2K5R A;  3CCE 1;  2R7Z I;  4NBE A;  1YUA A;  3I55 Z;  1L1O C;  1QVG Z;  3TDH B;  3PO3 I;  3T4N B;  2DE5 A;  1ZB8 A;  3J81 f;  5T64 A;  2P3Y A;  2ZAE B;  1R9T I;  1NP6 A;  1KD1 1;  3S1R I;  1M90 2;  4NB8 A;  2HU9 A;  1TWA I;  3HOY I;  3IF8 A;  1Z02 A;  1S72 1;  5FLX b;  2M48 A;  3VMI A;  3CPW Z;  3CCE Z;  2KI7 B;  1RQF A;  3LUS A;  1K8A 1;  1LQL A;  4MON A;  4DQY B;  2W03 A;  2Q51 A;  3VTN A;  1K73 2;  4RS4 A;  2GTH A;  1K9M 2;  2QKD A;  5IP7 I;  4MD9 A;  4E31 A;  1QVF Y;  3F3F C;  2QR1 B;  4A3D I;  3GTM S;  1WW9 A;  2O53 A;  1S72 Z;  2VUG A;  3HOW I;  3H0G I;  3J80 f;  4NBA A;  3CMA Z;  4MH4 A;  1YJN 1;  2R93 I;  2IZ3 A;  4RVD A;  1TFI A;  1VQK 1;  2OOX B;  1RLY A;  4A3I I;  1ZH1 A;  5D1P A;  2JNY A;  5D1O B;  4RVF A;  1S7M A;  2O4H A;  3GTJ I;  2BJO A;  4X6A I;  2JS4 A;  3GTG I;  2OTJ Z;  4Y52 I;  1NJI 2;  2F4M A;  2OTL Z;  3NH4 A;  1RO4 A;  3CCS 1;  3GTK I;  3CCM 1;  2JR6 A;  5C3E I;  2PMZ A;  1I3Q I;  1YJN Z;  2QRC B;  1Q81 1;  3GCF A;  2P28 A;  3QWU A;  1VQK Z;  2JA8 I;  3P5J B;  3I4N I;  1YUK A;  3NFZ A;  3JAM f;  3S15 I;  4TNU A;  4QTU A;  1Q82 1;  2E2H I;  4A3G I;  1VQM 1;  1VLA A;  5IT9 f;  1Y1V S;  4NBH A;  1W2B Z;  2JA5 I;  3S1Q I;  2KPI A;  4NBG A;  4EWC A;  4RVH A;  3VMH A;  3CCS Z;  3D9X A;  2PM9 A;  2IZ4 A;  2JMO A;  2OOY B;  3FQM A;  1N2F A;  1USP B;  1Z01 A;  4A3K I;  1W2B Y;  3S2H I;  2QRE B;  3EER A;  4NBF A;  2RBL A;  2GTI A;  4A3C I;  4NBC A;  3OW2 Y;  2WB1 A;  1VQM Z;  3I07 A;  3J7A 4;  2JA7 I;  3VMG A;  3CXC Y;  1VQP 1;  2QLV B;  1KRL A;  2VF1 A;  2YAD A;  4NBD A;  2G2K A;  3I4M I;  5D1O A;  4AYB A;  1Y1W I;  3CQZ I;  1X0T A;  4A3L I;  3CC2 1;  1Q81 2;  1YI2 1;  1QVF Z;  3S1N I;  1KQS Y;  3S1M I;  4CL1 A;  1M1K 2;  2NVQ I;  3CME 1;  1TWH I;  3GTM I;  3M4O I;  2RHB A;  3CC7 1;  1VQP Z;  3PO2 I;  4E2W A;  2RT9 A;  1YIT 1;  2NVY I;  3KIF A;  1VQ5 1;  1VQ6 1;  1YHQ 1;  2H85 A;  3CC2 Z;  1SFO I;  1YI2 Z;  1VQ9 1;  3S14 I;  2Y0S A;  4QTT A;  1PFT A;  1JJ2 Y;  4MD7 A;  2V8I A;  3CME Z;  4E2X A;  3CCU 1;  2R92 I;  3HKZ A;  1VQO 1;  4BY1 I;  1ZB9 A;  3NH8 A;  5T67 A;  1TWC I;  3CCR 1;  5A2Q b;  1KD1 2;  3GTO I;  1RO0 A;  3CC7 Z;  3GKQ A;  1USP A;  1YIT Z;  5LL6 f;  3IX0 A;  1VQ5 Z;  1VQ8 1;  3IFU A;  1VQ6 Z;  4MD8 A;  1YHQ Z;  4NFR A;  4E30 A;  3HOV I;  2I3C A;  4RVG A;  2QEX 1;  3FKI I;  1VQ9 Z;  5C4J I;  5CM2 M;  1K8A 2;  2EGT A;  1WII A;  4S1T A;  3S2D I;  3CCU Z;  1Y1V I;  1I50 I;  3EED A;  1VQO Z;  3CCR Z;  4NBB A;  1YIJ 1;  1M90 1;  2AKL A;  3G71 1;  4DGL A;  4BBS I;  2RIQ A;  4A93 I;  3RZD I;  1Q86 1;  1VQ8 Z;  2GU2 A;  2Q4Z A;  4E2Z A;  5IP9 I;  3CC4 1;  2V8K A;  4NOZ A;  3CCV 1;  3OW2 Z;  2F4O A;  1KC8 1;  3CCQ 1;  2QEX Z;  1JWH C;  4HGY A;  3CCM Z;  3I55 1;  1WCM I;  1X3W A;  2YU9 I;  3CXC Z;  3D6W A;  3NDJ A;  4A3J I;  1K9M 1;  1VQ4 1;  4A3M I;  2RPR A;  5AN9 F;  1NUI A;  1YIJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...