2JNYA

Solution nmr structure of protein uncharacterized bcr, northeast structural genomics consortium target cgr1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPNNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized BCR
publication title Solution NMR structure of protein Uncharacterized BCR, Northeast Structural Genomics Consortium target CgR1
rcsb
source organism Corynebacterium glutamicum
molecule tags Structural genomics, unknown function
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jnyA01
3HOYI 3S17I 2F4OA 1X3ZA 3RZOI 4NBCA 3VMIA 3LUSA 1N2FA 1TWFI 3U50C 2JNYA 4A3BI 2KPIA 4NBHA 1LQLA 3S16I 2HF1A 2NVTI 3M3YI 1TWGI 1TFIA 1PFTA 3FKII 2F4MA 1I6HI 1SFOI 1TWCI 2R7ZI 3K7AI 2VUMI 5FLMI 4Y7NI 3I4NI 2NVYI 1WW9A 4NB8A 4BBRI 2NVXI 4Y52I 2E2II 1RO4A 1VLAA 3H0GI 3I07A 3GTJI 3Q87A 1USPA 3GTGI 4A3DI 2JS4A 1K83I 2JR6A 1NUIA 4A3FI 3HOZI 2E2JI 3HOWI 3GTPI 3S1RI 2DE5A 5CM2M 3VMGA 4NBGA 3S2HI 4BXXI 3S15I 4NBDA 3GTQI 3M4OI 4A3II 2E2HI 1I50I 2J6AA 1ZB8A 5IP9I 3D6WA 2DE6A 4QTUA 5C44I 3S1QI 3PO3I 1ZB9A 1ML8A 5C4JI 2R93I 3PO3S 2DE7A 3GTMI 3S1MI 2R92I 2JA7I 1QYPA 2NVQI 3H3VJ 3GTMS 3S1NI 3S2DI 4A3GI 1DL6A 1USPB 3S14I 4X6AI 3RZDI 4A3MI 3ESWA 2P3YA 4A3CI 3HOXI 4BBSI 4A3JI 3GCFA 3GTKI 2JA5I 4NB9A 3GTOI 1Y1WI 1TWHI 4NBBA 5C3EI 1TWAI 2YU9I 3I4MI 3VB9A 3HOUI 3GKQA 4A3KI 3PO2I 2K5RA 3HOVI 4NBEA 1YUAA 4A3EI 5C4XI 1RLYA 4QTTA 4BY1I 4NOZA 2JA6I 2AKLA 1Y1VI 4NBFA 1WCMI 2JA8I 2RBLA 2PK7A 1Y1VS 3GTLI 4MH4A 1I3QI 1X3WA 3EERA 2BJOA 4XX2A 1R9TI 3CQZI 4BY7I 5IP7I 3VMHA 1L1OC 4NBAA 4A93I 2B63I 4A3LI
chains in the Genus database with same CATH superfamily
1YJW1 1YJ9Z 1VQPZ 3FQQA 1Y8CA 3BG0B 3IR7A 3S16I 1VQ51 3I551 3FKII 4E32A 3I561 1I6HI 1TWCI 2R7ZI 3J81b 2NVXI 3CCR1 1VQ71 1YJWZ 1RO4A 3GTJI 1USPA 2JMOA 2VPXA 3FQMA 4A3FI 2E2JI 3S1RI 2P28A 1VQ5Z 3S2HI 3I55Z 2JIOA 3I56Z 1M902 3HKZA 4RVHA 3CCRZ 1QXFA 1VQ7Z 3D6WA 3OW2Y 2RPRA 4QTUA 3S1QI 1JWHC 3VTNA 1ZB9A 3NDJA 3CCJ1 4E30A 3CC41 2W03A 4E2WA 1YUKA 3KIHA 3H3VJ 1NP6A 4E2YA 4HGZA 1DL6A 1USPB 1VQL1 2OZKA 4A3MI 2IZ4A 3HOXI 3GTKI 2Y0SA 5T67A 1YIT1 3CCJZ 3CC4Z 3NDIA 3P5JB 5A2Qb 4CL1A 3IF8A 3VB9A 2OOYB 3GKQA 4A3KI 1K9M1 2OTJ1 1YUAA 1JJ2Y 1K731 4NOZA 2QRDB 1K9M2 1Y1VI 3NFZA 1SIWA 1YITZ 1Y1VS 2JIPA 3GTLI 2ZAEB 2LEXA 4XX2A 1YI21 5IP7I 1RO2A 2OTJZ 1WIIA 2B63I 4AYBA 3CME1 3CCLZ 4EWCA 2W04A 3RZOI 4NBCA 1FDIA 1Q7Y1 3G711 4A3BI 4MXUA 3TE5B 4NBHA 1Q861 4RS4A 3CPWZ 1TFIA 2LIYA 4TNUA 4E31A 1YI2Z 3NH8A 1Q7Y2 4Y7NI 1Q862 2NVYI 4NB8A 3I4NI 1FDOA 1VQO1 4Y52I 2E2II 3CMEZ 3MZLB 1VQ91 1VQ61 3IX0A 2JR6A 1NUIA 1NJI2 3HOZI 3G71Z 3HOWI 3GTPI 3S15I 1Q811 3D9XA 3J81f 3GTQI 1KC81 3M4OI 4A3II 3QWUA 1KQSY 4DQYB 1VQOZ 1Q812 1VQ9Z 1KC82 2RIQA 4RVGA 1RQFA 5T6BA 3GTMI 5LL6f 1M901 2G2KA 4HGYA 1QYPA 2NVQI 1QVFZ 3GTMS 3S1NI 5IT9b 3S2DI 4A3GI 5AN9F 3CD61 2OOXB 3ESWA 1K8A1 3T4NB 4A3CI 1RNIA 3GCFA 2RHBA 3BG1B 4NB9A 1X0TA 2PM9A 3MONA 4NBBA 2IV2X 1K8A2 3CCU1 2YU9I 3G4S1 1KRLA 4RVDA 3PO2I 2K5RA 3CXCZ 3KIFA 3IFUA 1VQ81 1RLYA 3J7A4 2AKLA 2VPZA 1QF8A 2PK7A 4MH4A 2JIRA 5A2Qf 1X3WA 3EERA 3CCUZ 1R9TI 3CQZI 3CC21 3G4SZ 5FLXf 1L1OC 1VQ8Z 1QVGZ 1YIJ1 2Q51A 3S17I 2F4OA 1X3ZA 5FLXb 1N8R1 1VQLZ 2OTL1 2JIMA 2KPIA 2R6MA 2HF1A 2NVTI 3M3YI 1W2BZ 2F4MA 3CC2Z 1YJN1 4MD9A 1N8R2 2VUMI 5FLMI 4S1TA 1WW9A 4BBRI 1Z03A 1P9NA 1YIJZ 1VLAA 3Q87A 3GTGI 2E9HA 2OTLZ 2M6NA 4E2XA 3MZKB 4NBGA 3CCM1 1YJNZ 2VPYA 5T64A 1WJ2A 5IP9I 2PMZA 1VQM1 1Q822 3PO3I 1NJI1 1ML8A 5C4JI 1AA6A 2R93I 2RT9A 3PO3S 2DE7A 2JA7I 3CCMZ 2NAPA 4HH4A 2EGTA 2QLVB 4DK1A 3CMA1 4X6AI 3J80b 4E2ZA 1VQMZ 3G6E1 2V8KA 3TDHB 1Q16A 3EEDA 2JA5I 1VQ6Z 2I3CA 3GTOI 2QA41 1Y1WI 3JAMb 3OW2Z 5C3EI 1VQN1 2E7ZA 1TWAI 3CCV1 5IT9f 3I4MI 2VF1A 3NH4A 3HOVI 5D1PA 2K3RA 4NBEA 3CMAZ 4A3EI 5C4XI 2QRCB 4QTTA 4BY1I 3G6EZ 2QEX1 2GTIA 3CPWY 1VQ41 1WZNA 3CCS1 2RBLA 1S721 3F3FC 2HU9A 2QREB 2QA4Z 1VQNZ 3CCVZ 4BY7I 2VUGA 3VMHA 5D1OA 4NBAA 4NH1C 4MD7A 1M1K1 4A93I 2QKDA 3HOYI 2QEXZ 1VQ4Z 3VMIA 3CCSZ 3LUSA 1VQK1 4DGLA 1M1K2 1N2FA 1TWFI 3CD6Z 3U50C 2H85A 1S72Z 2O4HA 2JNYA 1LQLA 4NFRA 1JJ2Z 2WB1A 1TWGI 1PFTA 3CCQ1 1SFOI 1S7MA 3K7AI 1Z01A 1RO0A 4E33A 3CCE1 3H0GI 3I07A 3CC71 4A3DI 2JS4A 1VQKZ 1K83I 1QVFY 1KD11 3NH5A 2DE5A 5CM2M 3VMGA 2LFUA 4MD8A 5D1OB 4BXXI 3CCQZ 4RV9A 4NBDA 2E2HI 1KD12 3D2LA 1I50I 2J6AA 1ZB8A 3CCEZ 2DE6A 3CC7Z 2M48A 5C44I 2V45A 3CXCY 3F3PC 3S1MI 2JIQA 2R92I 2IZ3A 3CCL1 2KI7B 2VPWA 3S14I 2Q4ZA 2V3VA 1Q821 3RZDI 2V8JA 1K732 2P3YA 4BBSI 4A3JI 4RVFA 1KQSZ 1YHQ1 4MRIA 1QVGY 1TWHI 3HOUI 2WAQA 2QR1B 1ZH1A 3J80f 2O53A 4MONA 1Z02A 1YJ91 2JA6I 1W2BY 1VQP1 4NBFA 1WCMI 2YADA 2JA8I 3JAMf 1YHQZ 1I3QI 2BJOA 2GTHA 2GU2A 2V8IA 2JUBA 2AYDA 4A3LI
chains in the Genus database with same CATH topology
1YJW1 1YJ9Z 1VQPZ 3FQQA 3BG0B 3S16I 1VQ51 3I551 3FKII 4E32A 3I561 1I6HI 1TWCI 2R7ZI 3J81b 2NVXI 3CCR1 1VQ71 1YJWZ 1RO4A 3GTJI 1USPA 2JMOA 3FQMA 4A3FI 2E2JI 3S1RI 2P28A 1VQ5Z 3S2HI 3I55Z 3I56Z 1M902 3HKZA 4RVHA 3CCRZ 1VQ7Z 3D6WA 3OW2Y 2RPRA 4QTUA 3S1QI 1JWHC 3VTNA 1ZB9A 3NDJA 3CCJ1 4E30A 3CC41 2W03A 4E2WA 1YUKA 3KIHA 3H3VJ 1NP6A 4E2YA 4HGZA 1DL6A 1USPB 1VQL1 2OZKA 4A3MI 2IZ4A 3HOXI 3GTKI 2Y0SA 5T67A 1YIT1 3CCJZ 3CC4Z 3NDIA 3P5JB 5A2Qb 4CL1A 3IF8A 3VB9A 2OOYB 3GKQA 4A3KI 1K9M1 2OTJ1 1YUAA 1JJ2Y 1K731 4NOZA 2QRDB 1K9M2 1Y1VI 3NFZA 1YITZ 1Y1VS 3GTLI 2ZAEB 4XX2A 1YI21 5IP7I 1RO2A 2OTJZ 1WIIA 2B63I 4AYBA 3CME1 3CCLZ 4EWCA 2W04A 3RZOI 4NBCA 1Q7Y1 3G711 4A3BI 4MXUA 3TE5B 4NBHA 1Q861 4RS4A 3CPWZ 1TFIA 2LIYA 4TNUA 4E31A 1YI2Z 3NH8A 1Q7Y2 4Y7NI 1Q862 2NVYI 4NB8A 3I4NI 1VQO1 4Y52I 2E2II 3CMEZ 3MZLB 1VQ91 1VQ61 3IX0A 2JR6A 1NUIA 1NJI2 3HOZI 3G71Z 3HOWI 3GTPI 3S15I 1Q811 3D9XA 3J81f 3GTQI 1KC81 3M4OI 4A3II 3QWUA 1KQSY 4DQYB 1VQOZ 1Q812 1VQ9Z 1KC82 2RIQA 4RVGA 1RQFA 5T6BA 3GTMI 5LL6f 1M901 2G2KA 4HGYA 1QYPA 2NVQI 1QVFZ 3GTMS 3S1NI 5IT9b 3S2DI 4A3GI 5AN9F 3CD61 2OOXB 3ESWA 1K8A1 3T4NB 4A3CI 1RNIA 3GCFA 2RHBA 3BG1B 4NB9A 1X0TA 2PM9A 3MONA 4NBBA 1K8A2 3CCU1 2YU9I 3G4S1 1KRLA 4RVDA 3PO2I 2K5RA 3CXCZ 3KIFA 3IFUA 1VQ81 1RLYA 3J7A4 2AKLA 1QF8A 2PK7A 4MH4A 5A2Qf 1X3WA 3EERA 3CCUZ 1R9TI 3CQZI 3CC21 3G4SZ 5FLXf 1L1OC 1VQ8Z 1QVGZ 1YIJ1 2Q51A 3S17I 2F4OA 1X3ZA 5FLXb 1N8R1 1VQLZ 2OTL1 2KPIA 2R6MA 2HF1A 2NVTI 3M3YI 1W2BZ 2F4MA 3CC2Z 1YJN1 4MD9A 1N8R2 2VUMI 5FLMI 4S1TA 1WW9A 4BBRI 1Z03A 1P9NA 1YIJZ 1VLAA 3Q87A 3GTGI 2E9HA 2OTLZ 2M6NA 4E2XA 3MZKB 4NBGA 3CCM1 1YJNZ 5T64A 5IP9I 2PMZA 1VQM1 1Q822 3PO3I 1NJI1 1ML8A 5C4JI 2R93I 2RT9A 3PO3S 2DE7A 2JA7I 3CCMZ 4HH4A 2EGTA 2QLVB 4DK1A 3CMA1 4X6AI 3J80b 4E2ZA 1VQMZ 3G6E1 2V8KA 3TDHB 3EEDA 2JA5I 1VQ6Z 2I3CA 3GTOI 2QA41 1Y1WI 3JAMb 3OW2Z 5C3EI 1VQN1 1TWAI 3CCV1 5IT9f 3I4MI 2VF1A 3NH4A 3HOVI 5D1PA 2K3RA 4NBEA 3CMAZ 4A3EI 5C4XI 2QRCB 4QTTA 4BY1I 3G6EZ 2QEX1 2GTIA 3CPWY 1VQ41 3CCS1 2RBLA 1S721 3F3FC 2HU9A 2QREB 2QA4Z 1VQNZ 3CCVZ 4BY7I 2VUGA 3VMHA 5D1OA 4NBAA 4NH1C 4MD7A 1M1K1 4A93I 2QKDA 3HOYI 2QEXZ 1VQ4Z 3VMIA 3CCSZ 3LUSA 1VQK1 4DGLA 1M1K2 1N2FA 1TWFI 3CD6Z 3U50C 2H85A 1S72Z 2O4HA 2JNYA 1LQLA 4NFRA 1JJ2Z 2WB1A 1TWGI 1PFTA 3CCQ1 1SFOI 1S7MA 3K7AI 1Z01A 1RO0A 4E33A 3CCE1 3H0GI 3I07A 3CC71 4A3DI 2JS4A 1VQKZ 1K83I 1QVFY 1KD11 3NH5A 2DE5A 5CM2M 3VMGA 2LFUA 4MD8A 5D1OB 4BXXI 3CCQZ 4RV9A 4NBDA 2E2HI 1KD12 1I50I 2J6AA 1ZB8A 3CCEZ 2DE6A 3CC7Z 2M48A 5C44I 3CXCY 3F3PC 3S1MI 2R92I 2IZ3A 3CCL1 2KI7B 3S14I 2Q4ZA 1Q821 3RZDI 2V8JA 1K732 2P3YA 4BBSI 4A3JI 4RVFA 1KQSZ 1YHQ1 4MRIA 1QVGY 1TWHI 3HOUI 2WAQA 2QR1B 1ZH1A 3J80f 2O53A 4MONA 1Z02A 1YJ91 2JA6I 1W2BY 1VQP1 4NBFA 1WCMI 2YADA 2JA8I 3JAMf 1YHQZ 1I3QI 2BJOA 2GTHA 2GU2A 2V8IA 2JUBA 4A3LI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY I;  3S17 I;  2F4O A;  1X3Z A;  3RZO I;  4NBC A;  3VMI A;  3LUS A;  1N2F A;  1TWF I;  3U50 C;  2JNY A;  4A3B I;  2KPI A;  4NBH A;  1LQL A;  3S16 I;  2HF1 A;  2NVT I;  3M3Y I;  1TWG I;  1TFI A;  1PFT A;  3FKI I;  2F4M A;  1I6H I;  1SFO I;  1TWC I;  2R7Z I;  3K7A I;  2VUM I;  5FLM I;  4Y7N I;  3I4N I;  2NVY I;  1WW9 A;  4NB8 A;  4BBR I;  2NVX I;  4Y52 I;  2E2I I;  1RO4 A;  1VLA A;  3H0G I;  3I07 A;  3GTJ I;  3Q87 A;  1USP A;  3GTG I;  4A3D I;  2JS4 A;  1K83 I;  2JR6 A;  1NUI A;  4A3F I;  3HOZ I;  2E2J I;  3HOW I;  3GTP I;  3S1R I;  2DE5 A;  5CM2 M;  3VMG A;  4NBG A;  3S2H I;  4BXX I;  3S15 I;  4NBD A;  3GTQ I;  3M4O I;  4A3I I;  2E2H I;  1I50 I;  2J6A A;  1ZB8 A;  5IP9 I;  3D6W A;  2DE6 A;  4QTU A;  5C44 I;  3S1Q I;  3PO3 I;  1ZB9 A;  1ML8 A;  5C4J I;  2R93 I;  3PO3 S;  2DE7 A;  3GTM I;  3S1M I;  2R92 I;  2JA7 I;  1QYP A;  2NVQ I;  3H3V J;  3GTM S;  3S1N I;  3S2D I;  4A3G I;  1DL6 A;  1USP B;  3S14 I;  4X6A I;  3RZD I;  4A3M I;  3ESW A;  2P3Y A;  4A3C I;  3HOX I;  4BBS I;  4A3J I;  3GCF A;  3GTK I;  2JA5 I;  4NB9 A;  3GTO I;  1Y1W I;  1TWH I;  4NBB A;  5C3E I;  1TWA I;  2YU9 I;  3I4M I;  3VB9 A;  3HOU I;  3GKQ A;  4A3K I;  3PO2 I;  2K5R A;  3HOV I;  4NBE A;  1YUA A;  4A3E I;  5C4X I;  1RLY A;  4QTT A;  4BY1 I;  4NOZ A;  2JA6 I;  2AKL A;  1Y1V I;  4NBF A;  1WCM I;  2JA8 I;  2RBL A;  2PK7 A;  1Y1V S;  3GTL I;  4MH4 A;  1I3Q I;  1X3W A;  3EER A;  2BJO A;  4XX2 A;  1R9T I;  3CQZ I;  4BY7 I;  5IP7 I;  3VMH A;  1L1O C;  4NBA A;  4A93 I;  2B63 I;  4A3L I; 
#chains in the Genus database with same CATH topology
 1YJW 1;  1YJ9 Z;  1VQP Z;  3FQQ A;  1Y8C A;  3BG0 B;  3IR7 A;  3S16 I;  1VQ5 1;  3I55 1;  3FKI I;  4E32 A;  3I56 1;  1I6H I;  1TWC I;  2R7Z I;  3J81 b;  2NVX I;  3CCR 1;  1VQ7 1;  1YJW Z;  1RO4 A;  3GTJ I;  1USP A;  2JMO A;  2VPX A;  3FQM A;  4A3F I;  2E2J I;  3S1R I;  2P28 A;  1VQ5 Z;  3S2H I;  3I55 Z;  2JIO A;  3I56 Z;  1M90 2;  3HKZ A;  4RVH A;  3CCR Z;  1QXF A;  1VQ7 Z;  3D6W A;  3OW2 Y;  2RPR A;  4QTU A;  3S1Q I;  1JWH C;  3VTN A;  1ZB9 A;  3NDJ A;  3CCJ 1;  4E30 A;  3CC4 1;  2W03 A;  4E2W A;  1YUK A;  3KIH A;  3H3V J;  1NP6 A;  4E2Y A;  4HGZ A;  1DL6 A;  1USP B;  1VQL 1;  2OZK A;  4A3M I;  2IZ4 A;  3HOX I;  3GTK I;  2Y0S A;  5T67 A;  1YIT 1;  3CCJ Z;  3CC4 Z;  3NDI A;  3P5J B;  5A2Q b;  4CL1 A;  3IF8 A;  3VB9 A;  2OOY B;  3GKQ A;  4A3K I;  1K9M 1;  2OTJ 1;  1YUA A;  1JJ2 Y;  1K73 1;  4NOZ A;  2QRD B;  1K9M 2;  1Y1V I;  3NFZ A;  1SIW A;  1YIT Z;  1Y1V S;  2JIP A;  3GTL I;  2ZAE B;  2LEX A;  4XX2 A;  1YI2 1;  5IP7 I;  1RO2 A;  2OTJ Z;  1WII A;  2B63 I;  4AYB A;  3CME 1;  3CCL Z;  4EWC A;  2W04 A;  3RZO I;  4NBC A;  1FDI A;  1Q7Y 1;  3G71 1;  4A3B I;  4MXU A;  3TE5 B;  4NBH A;  1Q86 1;  4RS4 A;  3CPW Z;  1TFI A;  2LIY A;  4TNU A;  4E31 A;  1YI2 Z;  3NH8 A;  1Q7Y 2;  4Y7N I;  1Q86 2;  2NVY I;  4NB8 A;  3I4N I;  1FDO A;  1VQO 1;  4Y52 I;  2E2I I;  3CME Z;  3MZL B;  1VQ9 1;  1VQ6 1;  3IX0 A;  2JR6 A;  1NUI A;  1NJI 2;  3HOZ I;  3G71 Z;  3HOW I;  3GTP I;  3S15 I;  1Q81 1;  3D9X A;  3J81 f;  3GTQ I;  1KC8 1;  3M4O I;  4A3I I;  3QWU A;  1KQS Y;  4DQY B;  1VQO Z;  1Q81 2;  1VQ9 Z;  1KC8 2;  2RIQ A;  4RVG A;  1RQF A;  5T6B A;  3GTM I;  5LL6 f;  1M90 1;  2G2K A;  4HGY A;  1QYP A;  2NVQ I;  1QVF Z;  3GTM S;  3S1N I;  5IT9 b;  3S2D I;  4A3G I;  5AN9 F;  3CD6 1;  2OOX B;  3ESW A;  1K8A 1;  3T4N B;  4A3C I;  1RNI A;  3GCF A;  2RHB A;  3BG1 B;  4NB9 A;  1X0T A;  2PM9 A;  3MON A;  4NBB A;  2IV2 X;  1K8A 2;  3CCU 1;  2YU9 I;  3G4S 1;  1KRL A;  4RVD A;  3PO2 I;  2K5R A;  3CXC Z;  3KIF A;  3IFU A;  1VQ8 1;  1RLY A;  3J7A 4;  2AKL A;  2VPZ A;  1QF8 A;  2PK7 A;  4MH4 A;  2JIR A;  5A2Q f;  1X3W A;  3EER A;  3CCU Z;  1R9T I;  3CQZ I;  3CC2 1;  3G4S Z;  5FLX f;  1L1O C;  1VQ8 Z;  1QVG Z;  1YIJ 1;  2Q51 A;  3S17 I;  2F4O A;  1X3Z A;  5FLX b;  1N8R 1;  1VQL Z;  2OTL 1;  2JIM A;  2KPI A;  2R6M A;  2HF1 A;  2NVT I;  3M3Y I;  1W2B Z;  2F4M A;  3CC2 Z;  1YJN 1;  4MD9 A;  1N8R 2;  2VUM I;  5FLM I;  4S1T A;  1WW9 A;  4BBR I;  1Z03 A;  1P9N A;  1YIJ Z;  1VLA A;  3Q87 A;  3GTG I;  2E9H A;  2OTL Z;  2M6N A;  4E2X A;  3MZK B;  4NBG A;  3CCM 1;  1YJN Z;  2VPY A;  5T64 A;  1WJ2 A;  5IP9 I;  2PMZ A;  1VQM 1;  1Q82 2;  3PO3 I;  1NJI 1;  1ML8 A;  5C4J I;  1AA6 A;  2R93 I;  2RT9 A;  3PO3 S;  2DE7 A;  2JA7 I;  3CCM Z;  2NAP A;  4HH4 A;  2EGT A;  2QLV B;  4DK1 A;  3CMA 1;  4X6A I;  3J80 b;  4E2Z A;  1VQM Z;  3G6E 1;  2V8K A;  3TDH B;  1Q16 A;  3EED A;  2JA5 I;  1VQ6 Z;  2I3C A;  3GTO I;  2QA4 1;  1Y1W I;  3JAM b;  3OW2 Z;  5C3E I;  1VQN 1;  2E7Z A;  1TWA I;  3CCV 1;  5IT9 f;  3I4M I;  2VF1 A;  3NH4 A;  3HOV I;  5D1P A;  2K3R A;  4NBE A;  3CMA Z;  4A3E I;  5C4X I;  2QRC B;  4QTT A;  4BY1 I;  3G6E Z;  2QEX 1;  2GTI A;  3CPW Y;  1VQ4 1;  1WZN A;  3CCS 1;  2RBL A;  1S72 1;  3F3F C;  2HU9 A;  2QRE B;  2QA4 Z;  1VQN Z;  3CCV Z;  4BY7 I;  2VUG A;  3VMH A;  5D1O A;  4NBA A;  4NH1 C;  4MD7 A;  1M1K 1;  4A93 I;  2QKD A;  3HOY I;  2QEX Z;  1VQ4 Z;  3VMI A;  3CCS Z;  3LUS A;  1VQK 1;  4DGL A;  1M1K 2;  1N2F A;  1TWF I;  3CD6 Z;  3U50 C;  2H85 A;  1S72 Z;  2O4H A;  2JNY A;  1LQL A;  4NFR A;  1JJ2 Z;  2WB1 A;  1TWG I;  1PFT A;  3CCQ 1;  1SFO I;  1S7M A;  3K7A I;  1Z01 A;  1RO0 A;  4E33 A;  3CCE 1;  3H0G I;  3I07 A;  3CC7 1;  4A3D I;  2JS4 A;  1VQK Z;  1K83 I;  1QVF Y;  1KD1 1;  3NH5 A;  2DE5 A;  5CM2 M;  3VMG A;  2LFU A;  4MD8 A;  5D1O B;  4BXX I;  3CCQ Z;  4RV9 A;  4NBD A;  2E2H I;  1KD1 2;  3D2L A;  1I50 I;  2J6A A;  1ZB8 A;  3CCE Z;  2DE6 A;  3CC7 Z;  2M48 A;  5C44 I;  2V45 A;  3CXC Y;  3F3P C;  3S1M I;  2JIQ A;  2R92 I;  2IZ3 A;  3CCL 1;  2KI7 B;  2VPW A;  3S14 I;  2Q4Z A;  2V3V A;  1Q82 1;  3RZD I;  2V8J A;  1K73 2;  2P3Y A;  4BBS I;  4A3J I;  4RVF A;  1KQS Z;  1YHQ 1;  4MRI A;  1QVG Y;  1TWH I;  3HOU I;  2WAQ A;  2QR1 B;  1ZH1 A;  3J80 f;  2O53 A;  4MON A;  1Z02 A;  1YJ9 1;  2JA6 I;  1W2B Y;  1VQP 1;  4NBF A;  1WCM I;  2YAD A;  2JA8 I;  3JAM f;  1YHQ Z;  1I3Q I;  2BJO A;  2GTH A;  2GU2 A;  2V8I A;  2JUB A;  2AYD A;  4A3L I; 
#chains in the Genus database with same CATH homology
 1YJW 1;  1YJ9 Z;  1VQP Z;  3FQQ A;  3BG0 B;  3S16 I;  1VQ5 1;  3I55 1;  3FKI I;  4E32 A;  3I56 1;  1I6H I;  1TWC I;  2R7Z I;  3J81 b;  2NVX I;  3CCR 1;  1VQ7 1;  1YJW Z;  1RO4 A;  3GTJ I;  1USP A;  2JMO A;  3FQM A;  4A3F I;  2E2J I;  3S1R I;  2P28 A;  1VQ5 Z;  3S2H I;  3I55 Z;  3I56 Z;  1M90 2;  3HKZ A;  4RVH A;  3CCR Z;  1VQ7 Z;  3D6W A;  3OW2 Y;  2RPR A;  4QTU A;  3S1Q I;  1JWH C;  3VTN A;  1ZB9 A;  3NDJ A;  3CCJ 1;  4E30 A;  3CC4 1;  2W03 A;  4E2W A;  1YUK A;  3KIH A;  3H3V J;  1NP6 A;  4E2Y A;  4HGZ A;  1DL6 A;  1USP B;  1VQL 1;  2OZK A;  4A3M I;  2IZ4 A;  3HOX I;  3GTK I;  2Y0S A;  5T67 A;  1YIT 1;  3CCJ Z;  3CC4 Z;  3NDI A;  3P5J B;  5A2Q b;  4CL1 A;  3IF8 A;  3VB9 A;  2OOY B;  3GKQ A;  4A3K I;  1K9M 1;  2OTJ 1;  1YUA A;  1JJ2 Y;  1K73 1;  4NOZ A;  2QRD B;  1K9M 2;  1Y1V I;  3NFZ A;  1YIT Z;  1Y1V S;  3GTL I;  2ZAE B;  4XX2 A;  1YI2 1;  5IP7 I;  1RO2 A;  2OTJ Z;  1WII A;  2B63 I;  4AYB A;  3CME 1;  3CCL Z;  4EWC A;  2W04 A;  3RZO I;  4NBC A;  1Q7Y 1;  3G71 1;  4A3B I;  4MXU A;  3TE5 B;  4NBH A;  1Q86 1;  4RS4 A;  3CPW Z;  1TFI A;  2LIY A;  4TNU A;  4E31 A;  1YI2 Z;  3NH8 A;  1Q7Y 2;  4Y7N I;  1Q86 2;  2NVY I;  4NB8 A;  3I4N I;  1VQO 1;  4Y52 I;  2E2I I;  3CME Z;  3MZL B;  1VQ9 1;  1VQ6 1;  3IX0 A;  2JR6 A;  1NUI A;  1NJI 2;  3HOZ I;  3G71 Z;  3HOW I;  3GTP I;  3S15 I;  1Q81 1;  3D9X A;  3J81 f;  3GTQ I;  1KC8 1;  3M4O I;  4A3I I;  3QWU A;  1KQS Y;  4DQY B;  1VQO Z;  1Q81 2;  1VQ9 Z;  1KC8 2;  2RIQ A;  4RVG A;  1RQF A;  5T6B A;  3GTM I;  5LL6 f;  1M90 1;  2G2K A;  4HGY A;  1QYP A;  2NVQ I;  1QVF Z;  3GTM S;  3S1N I;  5IT9 b;  3S2D I;  4A3G I;  5AN9 F;  3CD6 1;  2OOX B;  3ESW A;  1K8A 1;  3T4N B;  4A3C I;  1RNI A;  3GCF A;  2RHB A;  3BG1 B;  4NB9 A;  1X0T A;  2PM9 A;  3MON A;  4NBB A;  1K8A 2;  3CCU 1;  2YU9 I;  3G4S 1;  1KRL A;  4RVD A;  3PO2 I;  2K5R A;  3CXC Z;  3KIF A;  3IFU A;  1VQ8 1;  1RLY A;  3J7A 4;  2AKL A;  1QF8 A;  2PK7 A;  4MH4 A;  5A2Q f;  1X3W A;  3EER A;  3CCU Z;  1R9T I;  3CQZ I;  3CC2 1;  3G4S Z;  5FLX f;  1L1O C;  1VQ8 Z;  1QVG Z;  1YIJ 1;  2Q51 A;  3S17 I;  2F4O A;  1X3Z A;  5FLX b;  1N8R 1;  1VQL Z;  2OTL 1;  2KPI A;  2R6M A;  2HF1 A;  2NVT I;  3M3Y I;  1W2B Z;  2F4M A;  3CC2 Z;  1YJN 1;  4MD9 A;  1N8R 2;  2VUM I;  5FLM I;  4S1T A;  1WW9 A;  4BBR I;  1Z03 A;  1P9N A;  1YIJ Z;  1VLA A;  3Q87 A;  3GTG I;  2E9H A;  2OTL Z;  2M6N A;  4E2X A;  3MZK B;  4NBG A;  3CCM 1;  1YJN Z;  5T64 A;  5IP9 I;  2PMZ A;  1VQM 1;  1Q82 2;  3PO3 I;  1NJI 1;  1ML8 A;  5C4J I;  2R93 I;  2RT9 A;  3PO3 S;  2DE7 A;  2JA7 I;  3CCM Z;  4HH4 A;  2EGT A;  2QLV B;  4DK1 A;  3CMA 1;  4X6A I;  3J80 b;  4E2Z A;  1VQM Z;  3G6E 1;  2V8K A;  3TDH B;  3EED A;  2JA5 I;  1VQ6 Z;  2I3C A;  3GTO I;  2QA4 1;  1Y1W I;  3JAM b;  3OW2 Z;  5C3E I;  1VQN 1;  1TWA I;  3CCV 1;  5IT9 f;  3I4M I;  2VF1 A;  3NH4 A;  3HOV I;  5D1P A;  2K3R A;  4NBE A;  3CMA Z;  4A3E I;  5C4X I;  2QRC B;  4QTT A;  4BY1 I;  3G6E Z;  2QEX 1;  2GTI A;  3CPW Y;  1VQ4 1;  3CCS 1;  2RBL A;  1S72 1;  3F3F C;  2HU9 A;  2QRE B;  2QA4 Z;  1VQN Z;  3CCV Z;  4BY7 I;  2VUG A;  3VMH A;  5D1O A;  4NBA A;  4NH1 C;  4MD7 A;  1M1K 1;  4A93 I;  2QKD A;  3HOY I;  2QEX Z;  1VQ4 Z;  3VMI A;  3CCS Z;  3LUS A;  1VQK 1;  4DGL A;  1M1K 2;  1N2F A;  1TWF I;  3CD6 Z;  3U50 C;  2H85 A;  1S72 Z;  2O4H A;  2JNY A;  1LQL A;  4NFR A;  1JJ2 Z;  2WB1 A;  1TWG I;  1PFT A;  3CCQ 1;  1SFO I;  1S7M A;  3K7A I;  1Z01 A;  1RO0 A;  4E33 A;  3CCE 1;  3H0G I;  3I07 A;  3CC7 1;  4A3D I;  2JS4 A;  1VQK Z;  1K83 I;  1QVF Y;  1KD1 1;  3NH5 A;  2DE5 A;  5CM2 M;  3VMG A;  2LFU A;  4MD8 A;  5D1O B;  4BXX I;  3CCQ Z;  4RV9 A;  4NBD A;  2E2H I;  1KD1 2;  1I50 I;  2J6A A;  1ZB8 A;  3CCE Z;  2DE6 A;  3CC7 Z;  2M48 A;  5C44 I;  3CXC Y;  3F3P C;  3S1M I;  2R92 I;  2IZ3 A;  3CCL 1;  2KI7 B;  3S14 I;  2Q4Z A;  1Q82 1;  3RZD I;  2V8J A;  1K73 2;  2P3Y A;  4BBS I;  4A3J I;  4RVF A;  1KQS Z;  1YHQ 1;  4MRI A;  1QVG Y;  1TWH I;  3HOU I;  2WAQ A;  2QR1 B;  1ZH1 A;  3J80 f;  2O53 A;  4MON A;  1Z02 A;  1YJ9 1;  2JA6 I;  1W2B Y;  1VQP 1;  4NBF A;  1WCM I;  2YAD A;  2JA8 I;  3JAM f;  1YHQ Z;  1I3Q I;  2BJO A;  2GTH A;  2GU2 A;  2V8I A;  2JUB A;  4A3L I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...