3HOUI

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 13
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI02
5CM2M 1K83I 1PFTA 3GCFA 3M4OI 1RLYA 4X6AI 3HOXI 5FLMI 3VMGA 4A3CI 1TWAI 2NVYI 4BY1I 1X3WA 4A3GI 1YUAA 2JNYA 4A3BI 1L1OC 2JR6A 3GTJI 1N2FA 2E2HI 4NBEA 4A3JI 3S15I 3S17I 2AKLA 3HOVI 3HOZI 3H3VJ 3CQZI 3K7AI 3S16I 4NBCA 1TWGI 2NVTI 3I07A 3S1NI 5C4JI 3U50C 3GTMI 2R92I 3GTLI 2NVQI 3EERA 3Q87A 4A3MI 3HOUI 3D6WA 3PO3I 3LUSA 3VB9A 4MH4A 4NBAA 4NB8A 4XX2A 1USPA 4A3FI 1ZB8A 3GKQA 3GTQI 2E2II 1LQLA 3PO2I 4NOZA 4Y7NI 1X3ZA 2J6AA 3H0GI 5IP9I 4A93I 1Y1VI 2JS4A 3GTGI 3GTMS 2E2JI 2K5RA 4QTTA 1RO4A 1TWFI 4NB9A 2JA7I 2DE5A 2BJOA 2JA6I 1I3QI 3GTOI 3PO3S 4Y52I 1SFOI 4NBDA 5C4XI 1DL6A 2F4OA 2PK7A 2JA8I 3S1RI 3HOWI 1QYPA 4BY7I 4BXXI 1Y1WI 2F4MA 4BBSI 4A3DI 3ESWA 1WCMI 1Y1VS 2DE7A 3HOYI 1I6HI 1TFIA 1VLAA 1ZB9A 2JA5I 1TWCI 5C44I 2P3YA 4NBBA 4A3II 3S1QI 4NBFA 3FKII 4A3EI 2YU9I 3M3YI 3S2DI 2R93I 2DE6A 2NVXI 2HF1A 1ML8A 3VMIA 3I4MI 4A3KI 1USPB 3S14I 3RZOI 3S2HI 2R7ZI 3S1MI 1WW9A 1I50I 3RZDI 2KPIA 4NBHA 3I4NI 1NUIA 5IP7I 2VUMI 4A3LI 1R9TI 4BBRI 2B63I 4NBGA 1TWHI 3VMHA 5C3EI 3GTKI 2RBLA 3GTPI 4QTUA
chains in the Genus database with same CATH superfamily
3CCQ1 1PFTA 2QRCB 3CCSZ 5T67A 3VMGA 1TWAI 1VQNZ 4A3GI 1JJ2Z 3IX0A 1YUAA 3HKZA 1VQ9Z 2H85A 1NP6A 1L1OC 1N2FA 4NBEA 4A3JI 3G4SZ 2AKLA 1W2BY 1SIWA 3CCRZ 3H3VJ 3F3FC 3G6EZ 2OTL1 3CQZI 3S16I 2NVTI 3S1NI 1RNIA 4NH1C 1KD11 1YIJ1 1Z01A 1QVGZ 4A3MI 1Y8CA 4HGYA 1VQO1 2QLVB 2VPZA 2LFUA 1M1K1 2WAQA 1RQFA 4NB8A 4AYBA 5D1PA 1NJI1 3GKQA 3CCQZ 2E2II 3CC4Z 3CC21 2J6AA 1VQP1 1VQKZ 4E32A 3GTMS 2GTIA 4NB9A 4RV9A 4E2XA 3J7A4 2BJOA 4Y52I 3PO3S 2Q51A 3I551 1QF8A 3J80b 3S1RI 2OOYB 1QYPA 2O4HA 4BXXI 1ZH1A 3CXCY 2F4MA 2RT9A 1Z03A 1KC81 1YIJZ 2JA5I 2W04A 3S1QI 1VQOZ 3FKII 1K9M2 4A3EI 3MZLB 5FLXb 3T4NB 4MD8A 3BG0B 2Q4ZA 4DGLA 2R93I 2DE6A 2NVXI 1K8A1 1Q811 3S1MI 1N8R1 3CC2Z 4E31A 3RZDI 4NBHA 3CCJZ 5T6BA 2RIQA 5IP7I 4E33A 2OZKA 4BBRI 3IF8A 1TWHI 4NBGA 1KQSY 1AA6A 5C3EI 3GTPI 4RVHA 5CM2M 2LEXA 3GCFA 3I55Z 5IT9f 1YIT1 1RLYA 3G6E1 5LL6f 1YI21 1VQ6Z 2JIQA 2E7ZA 3FQMA 1Q7Y1 3CPWY 2JNYA 2JR6A 3GTJI 3CXCZ 3S15I 3S17I 1Q16A 2RHBA 2VPXA 2IV2X 2QKDA 3K7AI 3MZKB 2O53A 2W03A 3I07A 3CC41 5AN9F 1M901 2R92I 2NAPA 1VQK1 3GTLI 2M6NA 4NBAA 2WB1A 4NFRA 3NH5A 2OTJZ 1VQ71 3CCE1 1KQSZ 1LQLA 1VQL1 3VTNA 3PO2I 4NOZA 4Y7NI 1YITZ 1X3ZA 3CCV1 1YI2Z 2JS4A 1YJNZ 2JIRA 2E2JI 5T64A 2IZ4A 4MRIA 2QA41 4NBDA 5C4XI 3CCUZ 3FQQA 2PK7A 2K3RA 3HOWI 1Y1WI 1K732 4RVDA 2Y0SA 4DQYB 1RO0A 2DE7A 3HOYI 1TFIA 1TWCI 5C44I 3CCJ1 2EGTA 1Z02A 3CD6Z 3IFUA 3S2DI 1ML8A 3S2HI 2QR1B 1USPB 2GTHA 1VQ7Z 3CCEZ 2M48A 1VQLZ 1VQ5Z 2HU9A 1I50I 1VQ61 3CCVZ 3NH8A 1KRLA 3I4NI 1W2BZ 2GU2A 2QA4Z 2QEX1 3IR7A 1YHQ1 4QTUA 3KIHA 1JWHC 3M4OI 3EEDA 2IZ3A 4X6AI 3NDIA 3J81f 4A3CI 3BG1B 2JIPA 1KD12 1Q821 3CC7Z 3HOVI 3HOZI 5IT9b 3CMEZ 1M1K2 1YUKA 2OTJ1 5C4JI 3U50C 1NJI2 2VPYA 4CL1A 5A2Qb 2NVQI 3TE5B 1YJN1 1VQ41 3HOUI 3D2LA 3D6WA 1JJ2Y 1YJW1 4S1TA 4XX2A 3CCU1 2QEXZ 2PM9A 4A3FI 1YHQZ 1WJ2A 5IP9I 3H0GI 3I56Z 1Y1VI 2K5RA 2V8JA 1RO4A 1WZNA 1KC82 2JA7I 1SFOI 1QVGY 4RVFA 3CD61 1Q861 4RS4A 4BBSI 1K8A2 3ESWA 1Q812 1FDOA 2OOXB 1I6HI 1VQ51 1N8R2 4MD7A 3JAMf 2P3YA 4MXUA 4NBBA 4A3II 1VQ4Z 1YJWZ 2YU9I 2V45A 1VQ81 3I4MI 2HF1A 3D9XA 3VMIA 1QVFY 3RZOI 2JMOA 2R7ZI 3CPWZ 3QWUA 1K9M1 1NUIA 3NDJA 2VUMI 1VQMZ 4A3LI 1R9TI 1Q7Y2 3G711 2RBLA 3CC71 1K83I 3CME1 4DK1A 3HOXI 5FLMI 2NVYI 4BY1I 1X3WA 3OW2Y 1RO2A 4A3BI 1YJ9Z 1M902 2E2HI 1S721 3CMA1 3CCM1 2JIMA 1X0TA 4HH4A 4E30A 5D1OB 4EWCA 3CCL1 1Q862 3J81b 3NH4A 1TWGI 4NBCA 1VQ8Z 2KI7B 2JIOA 4E2ZA 3GTMI 3P5JB 3I561 1QVFZ 3EERA 2V8IA 3Q87A 3PO3I 1WIIA 3LUSA 2RPRA 3VB9A 2OTLZ 4MH4A 4E2WA 3G71Z 1USPA 1ZB8A 3GTQI 3J80f 2YADA 2VPWA 3GTGI 2JUBA 5D1OA 4RVGA 4QTTA 1TWFI 2VF1A 2DE5A 3GTOI 2JA6I 1I3QI 1DL6A 1S72Z 3CMAZ 3OW2Z 3CCMZ 2F4OA 1S7MA 2R6MA 2QREB 1FDIA 2AYDA 2G2KA 2V8KA 5FLXf 3CCS1 2JA8I 2VUGA 3CCLZ 3F3PC 3MONA 1VQPZ 4BY7I 4TNUA 2I3CA 1VQN1 2PMZA 4MONA 2ZAEB 1VQ91 4A3DI 1WCMI 1Y1VS 1VLAA 1ZB9A 3G4S1 2V3VA 3KIFA 4NBFA 3CCR1 1VQM1 1QXFA 4HGZA 1K731 3M3YI 3NFZA 3TDHB 3S14I 2E9HA 4A3KI 1WW9A 4E2YA 5A2Qf 2LIYA 2P28A 3JAMb 2KPIA 4MD9A 1P9NA 2QRDB 2B63I 1YJ91 3VMHA 3GTKI 4A93I 1Q822
chains in the Genus database with same CATH topology
3CCQ1 1PFTA 2QRCB 3CCSZ 5T67A 3VMGA 1TWAI 1VQNZ 4A3GI 1JJ2Z 3IX0A 1YUAA 3HKZA 1VQ9Z 2H85A 1NP6A 1L1OC 1N2FA 4NBEA 4A3JI 3G4SZ 2AKLA 1W2BY 3CCRZ 3H3VJ 3F3FC 3G6EZ 2OTL1 3CQZI 3S16I 2NVTI 3S1NI 1RNIA 4NH1C 1KD11 1YIJ1 1Z01A 1QVGZ 4A3MI 4HGYA 1VQO1 2QLVB 2LFUA 1M1K1 2WAQA 1RQFA 4NB8A 4AYBA 5D1PA 1NJI1 3GKQA 3CCQZ 2E2II 3CC4Z 3CC21 2J6AA 1VQP1 1VQKZ 4E32A 3GTMS 2GTIA 4NB9A 4RV9A 4E2XA 3J7A4 2BJOA 4Y52I 3PO3S 2Q51A 3I551 1QF8A 3J80b 3S1RI 2OOYB 1QYPA 2O4HA 4BXXI 1ZH1A 3CXCY 2F4MA 2RT9A 1Z03A 1KC81 1YIJZ 2JA5I 2W04A 3S1QI 1VQOZ 3FKII 1K9M2 4A3EI 3MZLB 5FLXb 3T4NB 4MD8A 3BG0B 2Q4ZA 4DGLA 2R93I 2DE6A 2NVXI 1K8A1 1Q811 3S1MI 1N8R1 3CC2Z 4E31A 3RZDI 4NBHA 3CCJZ 5T6BA 2RIQA 5IP7I 4E33A 2OZKA 4BBRI 3IF8A 1TWHI 4NBGA 1KQSY 5C3EI 3GTPI 4RVHA 5CM2M 3GCFA 3I55Z 5IT9f 1YIT1 1RLYA 3G6E1 5LL6f 1YI21 1VQ6Z 3FQMA 1Q7Y1 3CPWY 2JNYA 2JR6A 3GTJI 3CXCZ 3S15I 3S17I 2RHBA 2QKDA 3K7AI 3MZKB 2O53A 2W03A 3I07A 3CC41 5AN9F 1M901 2R92I 1VQK1 3GTLI 2M6NA 4NBAA 2WB1A 4NFRA 3NH5A 2OTJZ 1VQ71 3CCE1 1KQSZ 1LQLA 1VQL1 3VTNA 3PO2I 4NOZA 4Y7NI 1YITZ 1X3ZA 3CCV1 1YI2Z 2JS4A 1YJNZ 2E2JI 5T64A 2IZ4A 4MRIA 2QA41 4NBDA 5C4XI 3CCUZ 3FQQA 2PK7A 2K3RA 3HOWI 1Y1WI 1K732 4RVDA 2Y0SA 4DQYB 1RO0A 2DE7A 3HOYI 1TFIA 1TWCI 5C44I 3CCJ1 2EGTA 1Z02A 3CD6Z 3IFUA 3S2DI 1ML8A 3S2HI 2QR1B 1USPB 2GTHA 1VQ7Z 3CCEZ 2M48A 1VQLZ 1VQ5Z 2HU9A 1I50I 1VQ61 3CCVZ 3NH8A 1KRLA 3I4NI 1W2BZ 2GU2A 2QA4Z 2QEX1 1YHQ1 4QTUA 3KIHA 1JWHC 3M4OI 3EEDA 2IZ3A 4X6AI 3NDIA 3J81f 4A3CI 3BG1B 1KD12 1Q821 3CC7Z 3HOVI 3HOZI 5IT9b 3CMEZ 1M1K2 1YUKA 2OTJ1 5C4JI 3U50C 1NJI2 4CL1A 5A2Qb 2NVQI 3TE5B 1YJN1 1VQ41 3HOUI 3D6WA 1JJ2Y 1YJW1 4S1TA 4XX2A 3CCU1 2QEXZ 2PM9A 4A3FI 1YHQZ 5IP9I 3H0GI 3I56Z 1Y1VI 2K5RA 2V8JA 1RO4A 1KC82 2JA7I 1SFOI 1QVGY 4RVFA 3CD61 1Q861 4RS4A 4BBSI 1K8A2 3ESWA 1Q812 2OOXB 1I6HI 1VQ51 1N8R2 4MD7A 3JAMf 2P3YA 4MXUA 4NBBA 4A3II 1VQ4Z 1YJWZ 2YU9I 1VQ81 3I4MI 2HF1A 3D9XA 3VMIA 1QVFY 3RZOI 2JMOA 2R7ZI 3CPWZ 3QWUA 1K9M1 1NUIA 3NDJA 2VUMI 1VQMZ 4A3LI 1R9TI 1Q7Y2 3G711 2RBLA 3CC71 1K83I 3CME1 4DK1A 3HOXI 5FLMI 2NVYI 4BY1I 1X3WA 3OW2Y 1RO2A 4A3BI 1YJ9Z 1M902 2E2HI 1S721 3CMA1 3CCM1 1X0TA 4HH4A 4E30A 5D1OB 4EWCA 3CCL1 1Q862 3J81b 3NH4A 1TWGI 4NBCA 1VQ8Z 2KI7B 4E2ZA 3GTMI 3P5JB 3I561 1QVFZ 3EERA 2V8IA 3Q87A 3PO3I 1WIIA 3LUSA 2RPRA 3VB9A 2OTLZ 4MH4A 4E2WA 3G71Z 1USPA 1ZB8A 3GTQI 3J80f 2YADA 3GTGI 2JUBA 5D1OA 4RVGA 4QTTA 1TWFI 2VF1A 2DE5A 3GTOI 2JA6I 1I3QI 1DL6A 1S72Z 3CMAZ 3OW2Z 3CCMZ 2F4OA 1S7MA 2R6MA 2QREB 2G2KA 5FLXf 2V8KA 3CCS1 2JA8I 2VUGA 3CCLZ 3F3PC 3MONA 1VQPZ 4BY7I 4TNUA 2I3CA 1VQN1 2PMZA 4MONA 2ZAEB 1VQ91 4A3DI 1WCMI 1Y1VS 1VLAA 1ZB9A 3G4S1 3KIFA 4NBFA 3CCR1 1VQM1 4HGZA 1K731 3M3YI 3NFZA 3TDHB 3S14I 2E9HA 4A3KI 1WW9A 4E2YA 5A2Qf 2LIYA 2P28A 3JAMb 2KPIA 4MD9A 1P9NA 2QRDB 2B63I 1YJ91 3VMHA 3GTKI 4A93I 1Q822
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CM2 M;  1K83 I;  1PFT A;  3GCF A;  3M4O I;  1RLY A;  4X6A I;  3HOX I;  5FLM I;  3VMG A;  4A3C I;  1TWA I;  2NVY I;  4BY1 I;  1X3W A;  4A3G I;  1YUA A;  2JNY A;  4A3B I;  1L1O C;  2JR6 A;  3GTJ I;  1N2F A;  2E2H I;  4NBE A;  4A3J I;  3S15 I;  3S17 I;  2AKL A;  3HOV I;  3HOZ I;  3H3V J;  3CQZ I;  3K7A I;  3S16 I;  4NBC A;  1TWG I;  2NVT I;  3I07 A;  3S1N I;  5C4J I;  3U50 C;  3GTM I;  2R92 I;  3GTL I;  2NVQ I;  3EER A;  3Q87 A;  4A3M I;  3HOU I;  3D6W A;  3PO3 I;  3LUS A;  3VB9 A;  4MH4 A;  4NBA A;  4NB8 A;  4XX2 A;  1USP A;  4A3F I;  1ZB8 A;  3GKQ A;  3GTQ I;  2E2I I;  1LQL A;  3PO2 I;  4NOZ A;  4Y7N I;  1X3Z A;  2J6A A;  3H0G I;  5IP9 I;  4A93 I;  1Y1V I;  2JS4 A;  3GTG I;  3GTM S;  2E2J I;  2K5R A;  4QTT A;  1RO4 A;  1TWF I;  4NB9 A;  2JA7 I;  2DE5 A;  2BJO A;  2JA6 I;  1I3Q I;  3GTO I;  3PO3 S;  4Y52 I;  1SFO I;  4NBD A;  5C4X I;  1DL6 A;  2F4O A;  2PK7 A;  2JA8 I;  3S1R I;  3HOW I;  1QYP A;  4BY7 I;  4BXX I;  1Y1W I;  2F4M A;  4BBS I;  4A3D I;  3ESW A;  1WCM I;  1Y1V S;  2DE7 A;  3HOY I;  1I6H I;  1TFI A;  1VLA A;  1ZB9 A;  2JA5 I;  1TWC I;  5C44 I;  2P3Y A;  4NBB A;  4A3I I;  3S1Q I;  4NBF A;  3FKI I;  4A3E I;  2YU9 I;  3M3Y I;  3S2D I;  2R93 I;  2DE6 A;  2NVX I;  2HF1 A;  1ML8 A;  3VMI A;  3I4M I;  4A3K I;  1USP B;  3S14 I;  3RZO I;  3S2H I;  2R7Z I;  3S1M I;  1WW9 A;  1I50 I;  3RZD I;  2KPI A;  4NBH A;  3I4N I;  1NUI A;  5IP7 I;  2VUM I;  4A3L I;  1R9T I;  4BBR I;  2B63 I;  4NBG A;  1TWH I;  3VMH A;  5C3E I;  3GTK I;  2RBL A;  3GTP I;  4QTU A; 
#chains in the Genus database with same CATH topology
 3CCQ 1;  1PFT A;  2QRC B;  3CCS Z;  5T67 A;  3VMG A;  1TWA I;  1VQN Z;  4A3G I;  1JJ2 Z;  3IX0 A;  1YUA A;  3HKZ A;  1VQ9 Z;  2H85 A;  1NP6 A;  1L1O C;  1N2F A;  4NBE A;  4A3J I;  3G4S Z;  2AKL A;  1W2B Y;  1SIW A;  3CCR Z;  3H3V J;  3F3F C;  3G6E Z;  2OTL 1;  3CQZ I;  3S16 I;  2NVT I;  3S1N I;  1RNI A;  4NH1 C;  1KD1 1;  1YIJ 1;  1Z01 A;  1QVG Z;  4A3M I;  1Y8C A;  4HGY A;  1VQO 1;  2QLV B;  2VPZ A;  2LFU A;  1M1K 1;  2WAQ A;  1RQF A;  4NB8 A;  4AYB A;  5D1P A;  1NJI 1;  3GKQ A;  3CCQ Z;  2E2I I;  3CC4 Z;  3CC2 1;  2J6A A;  1VQP 1;  1VQK Z;  4E32 A;  3GTM S;  2GTI A;  4NB9 A;  4RV9 A;  4E2X A;  3J7A 4;  2BJO A;  4Y52 I;  3PO3 S;  2Q51 A;  3I55 1;  1QF8 A;  3J80 b;  3S1R I;  2OOY B;  1QYP A;  2O4H A;  4BXX I;  1ZH1 A;  3CXC Y;  2F4M A;  2RT9 A;  1Z03 A;  1KC8 1;  1YIJ Z;  2JA5 I;  2W04 A;  3S1Q I;  1VQO Z;  3FKI I;  1K9M 2;  4A3E I;  3MZL B;  5FLX b;  3T4N B;  4MD8 A;  3BG0 B;  2Q4Z A;  4DGL A;  2R93 I;  2DE6 A;  2NVX I;  1K8A 1;  1Q81 1;  3S1M I;  1N8R 1;  3CC2 Z;  4E31 A;  3RZD I;  4NBH A;  3CCJ Z;  5T6B A;  2RIQ A;  5IP7 I;  4E33 A;  2OZK A;  4BBR I;  3IF8 A;  1TWH I;  4NBG A;  1KQS Y;  1AA6 A;  5C3E I;  3GTP I;  4RVH A;  5CM2 M;  2LEX A;  3GCF A;  3I55 Z;  5IT9 f;  1YIT 1;  1RLY A;  3G6E 1;  5LL6 f;  1YI2 1;  1VQ6 Z;  2JIQ A;  2E7Z A;  3FQM A;  1Q7Y 1;  3CPW Y;  2JNY A;  2JR6 A;  3GTJ I;  3CXC Z;  3S15 I;  3S17 I;  1Q16 A;  2RHB A;  2VPX A;  2IV2 X;  2QKD A;  3K7A I;  3MZK B;  2O53 A;  2W03 A;  3I07 A;  3CC4 1;  5AN9 F;  1M90 1;  2R92 I;  2NAP A;  1VQK 1;  3GTL I;  2M6N A;  4NBA A;  2WB1 A;  4NFR A;  3NH5 A;  2OTJ Z;  1VQ7 1;  3CCE 1;  1KQS Z;  1LQL A;  1VQL 1;  3VTN A;  3PO2 I;  4NOZ A;  4Y7N I;  1YIT Z;  1X3Z A;  3CCV 1;  1YI2 Z;  2JS4 A;  1YJN Z;  2JIR A;  2E2J I;  5T64 A;  2IZ4 A;  4MRI A;  2QA4 1;  4NBD A;  5C4X I;  3CCU Z;  3FQQ A;  2PK7 A;  2K3R A;  3HOW I;  1Y1W I;  1K73 2;  4RVD A;  2Y0S A;  4DQY B;  1RO0 A;  2DE7 A;  3HOY I;  1TFI A;  1TWC I;  5C44 I;  3CCJ 1;  2EGT A;  1Z02 A;  3CD6 Z;  3IFU A;  3S2D I;  1ML8 A;  3S2H I;  2QR1 B;  1USP B;  2GTH A;  1VQ7 Z;  3CCE Z;  2M48 A;  1VQL Z;  1VQ5 Z;  2HU9 A;  1I50 I;  1VQ6 1;  3CCV Z;  3NH8 A;  1KRL A;  3I4N I;  1W2B Z;  2GU2 A;  2QA4 Z;  2QEX 1;  3IR7 A;  1YHQ 1;  4QTU A;  3KIH A;  1JWH C;  3M4O I;  3EED A;  2IZ3 A;  4X6A I;  3NDI A;  3J81 f;  4A3C I;  3BG1 B;  2JIP A;  1KD1 2;  1Q82 1;  3CC7 Z;  3HOV I;  3HOZ I;  5IT9 b;  3CME Z;  1M1K 2;  1YUK A;  2OTJ 1;  5C4J I;  3U50 C;  1NJI 2;  2VPY A;  4CL1 A;  5A2Q b;  2NVQ I;  3TE5 B;  1YJN 1;  1VQ4 1;  3HOU I;  3D2L A;  3D6W A;  1JJ2 Y;  1YJW 1;  4S1T A;  4XX2 A;  3CCU 1;  2QEX Z;  2PM9 A;  4A3F I;  1YHQ Z;  1WJ2 A;  5IP9 I;  3H0G I;  3I56 Z;  1Y1V I;  2K5R A;  2V8J A;  1RO4 A;  1WZN A;  1KC8 2;  2JA7 I;  1SFO I;  1QVG Y;  4RVF A;  3CD6 1;  1Q86 1;  4RS4 A;  4BBS I;  1K8A 2;  3ESW A;  1Q81 2;  1FDO A;  2OOX B;  1I6H I;  1VQ5 1;  1N8R 2;  4MD7 A;  3JAM f;  2P3Y A;  4MXU A;  4NBB A;  4A3I I;  1VQ4 Z;  1YJW Z;  2YU9 I;  2V45 A;  1VQ8 1;  3I4M I;  2HF1 A;  3D9X A;  3VMI A;  1QVF Y;  3RZO I;  2JMO A;  2R7Z I;  3CPW Z;  3QWU A;  1K9M 1;  1NUI A;  3NDJ A;  2VUM I;  1VQM Z;  4A3L I;  1R9T I;  1Q7Y 2;  3G71 1;  2RBL A;  3CC7 1;  1K83 I;  3CME 1;  4DK1 A;  3HOX I;  5FLM I;  2NVY I;  4BY1 I;  1X3W A;  3OW2 Y;  1RO2 A;  4A3B I;  1YJ9 Z;  1M90 2;  2E2H I;  1S72 1;  3CMA 1;  3CCM 1;  2JIM A;  1X0T A;  4HH4 A;  4E30 A;  5D1O B;  4EWC A;  3CCL 1;  1Q86 2;  3J81 b;  3NH4 A;  1TWG I;  4NBC A;  1VQ8 Z;  2KI7 B;  2JIO A;  4E2Z A;  3GTM I;  3P5J B;  3I56 1;  1QVF Z;  3EER A;  2V8I A;  3Q87 A;  3PO3 I;  1WII A;  3LUS A;  2RPR A;  3VB9 A;  2OTL Z;  4MH4 A;  4E2W A;  3G71 Z;  1USP A;  1ZB8 A;  3GTQ I;  3J80 f;  2YAD A;  2VPW A;  3GTG I;  2JUB A;  5D1O A;  4RVG A;  4QTT A;  1TWF I;  2VF1 A;  2DE5 A;  3GTO I;  2JA6 I;  1I3Q I;  1DL6 A;  1S72 Z;  3CMA Z;  3OW2 Z;  3CCM Z;  2F4O A;  1S7M A;  2R6M A;  2QRE B;  1FDI A;  2AYD A;  2G2K A;  2V8K A;  5FLX f;  3CCS 1;  2JA8 I;  2VUG A;  3CCL Z;  3F3P C;  3MON A;  1VQP Z;  4BY7 I;  4TNU A;  2I3C A;  1VQN 1;  2PMZ A;  4MON A;  2ZAE B;  1VQ9 1;  4A3D I;  1WCM I;  1Y1V S;  1VLA A;  1ZB9 A;  3G4S 1;  2V3V A;  3KIF A;  4NBF A;  3CCR 1;  1VQM 1;  1QXF A;  4HGZ A;  1K73 1;  3M3Y I;  3NFZ A;  3TDH B;  3S14 I;  2E9H A;  4A3K I;  1WW9 A;  4E2Y A;  5A2Q f;  2LIY A;  2P28 A;  3JAM b;  2KPI A;  4MD9 A;  1P9N A;  2QRD B;  2B63 I;  1YJ9 1;  3VMH A;  3GTK I;  4A93 I;  1Q82 2; 
#chains in the Genus database with same CATH homology
 3CCQ 1;  1PFT A;  2QRC B;  3CCS Z;  5T67 A;  3VMG A;  1TWA I;  1VQN Z;  4A3G I;  1JJ2 Z;  3IX0 A;  1YUA A;  3HKZ A;  1VQ9 Z;  2H85 A;  1NP6 A;  1L1O C;  1N2F A;  4NBE A;  4A3J I;  3G4S Z;  2AKL A;  1W2B Y;  3CCR Z;  3H3V J;  3F3F C;  3G6E Z;  2OTL 1;  3CQZ I;  3S16 I;  2NVT I;  3S1N I;  1RNI A;  4NH1 C;  1KD1 1;  1YIJ 1;  1Z01 A;  1QVG Z;  4A3M I;  4HGY A;  1VQO 1;  2QLV B;  2LFU A;  1M1K 1;  2WAQ A;  1RQF A;  4NB8 A;  4AYB A;  5D1P A;  1NJI 1;  3GKQ A;  3CCQ Z;  2E2I I;  3CC4 Z;  3CC2 1;  2J6A A;  1VQP 1;  1VQK Z;  4E32 A;  3GTM S;  2GTI A;  4NB9 A;  4RV9 A;  4E2X A;  3J7A 4;  2BJO A;  4Y52 I;  3PO3 S;  2Q51 A;  3I55 1;  1QF8 A;  3J80 b;  3S1R I;  2OOY B;  1QYP A;  2O4H A;  4BXX I;  1ZH1 A;  3CXC Y;  2F4M A;  2RT9 A;  1Z03 A;  1KC8 1;  1YIJ Z;  2JA5 I;  2W04 A;  3S1Q I;  1VQO Z;  3FKI I;  1K9M 2;  4A3E I;  3MZL B;  5FLX b;  3T4N B;  4MD8 A;  3BG0 B;  2Q4Z A;  4DGL A;  2R93 I;  2DE6 A;  2NVX I;  1K8A 1;  1Q81 1;  3S1M I;  1N8R 1;  3CC2 Z;  4E31 A;  3RZD I;  4NBH A;  3CCJ Z;  5T6B A;  2RIQ A;  5IP7 I;  4E33 A;  2OZK A;  4BBR I;  3IF8 A;  1TWH I;  4NBG A;  1KQS Y;  5C3E I;  3GTP I;  4RVH A;  5CM2 M;  3GCF A;  3I55 Z;  5IT9 f;  1YIT 1;  1RLY A;  3G6E 1;  5LL6 f;  1YI2 1;  1VQ6 Z;  3FQM A;  1Q7Y 1;  3CPW Y;  2JNY A;  2JR6 A;  3GTJ I;  3CXC Z;  3S15 I;  3S17 I;  2RHB A;  2QKD A;  3K7A I;  3MZK B;  2O53 A;  2W03 A;  3I07 A;  3CC4 1;  5AN9 F;  1M90 1;  2R92 I;  1VQK 1;  3GTL I;  2M6N A;  4NBA A;  2WB1 A;  4NFR A;  3NH5 A;  2OTJ Z;  1VQ7 1;  3CCE 1;  1KQS Z;  1LQL A;  1VQL 1;  3VTN A;  3PO2 I;  4NOZ A;  4Y7N I;  1YIT Z;  1X3Z A;  3CCV 1;  1YI2 Z;  2JS4 A;  1YJN Z;  2E2J I;  5T64 A;  2IZ4 A;  4MRI A;  2QA4 1;  4NBD A;  5C4X I;  3CCU Z;  3FQQ A;  2PK7 A;  2K3R A;  3HOW I;  1Y1W I;  1K73 2;  4RVD A;  2Y0S A;  4DQY B;  1RO0 A;  2DE7 A;  3HOY I;  1TFI A;  1TWC I;  5C44 I;  3CCJ 1;  2EGT A;  1Z02 A;  3CD6 Z;  3IFU A;  3S2D I;  1ML8 A;  3S2H I;  2QR1 B;  1USP B;  2GTH A;  1VQ7 Z;  3CCE Z;  2M48 A;  1VQL Z;  1VQ5 Z;  2HU9 A;  1I50 I;  1VQ6 1;  3CCV Z;  3NH8 A;  1KRL A;  3I4N I;  1W2B Z;  2GU2 A;  2QA4 Z;  2QEX 1;  1YHQ 1;  4QTU A;  3KIH A;  1JWH C;  3M4O I;  3EED A;  2IZ3 A;  4X6A I;  3NDI A;  3J81 f;  4A3C I;  3BG1 B;  1KD1 2;  1Q82 1;  3CC7 Z;  3HOV I;  3HOZ I;  5IT9 b;  3CME Z;  1M1K 2;  1YUK A;  2OTJ 1;  5C4J I;  3U50 C;  1NJI 2;  4CL1 A;  5A2Q b;  2NVQ I;  3TE5 B;  1YJN 1;  1VQ4 1;  3HOU I;  3D6W A;  1JJ2 Y;  1YJW 1;  4S1T A;  4XX2 A;  3CCU 1;  2QEX Z;  2PM9 A;  4A3F I;  1YHQ Z;  5IP9 I;  3H0G I;  3I56 Z;  1Y1V I;  2K5R A;  2V8J A;  1RO4 A;  1KC8 2;  2JA7 I;  1SFO I;  1QVG Y;  4RVF A;  3CD6 1;  1Q86 1;  4RS4 A;  4BBS I;  1K8A 2;  3ESW A;  1Q81 2;  2OOX B;  1I6H I;  1VQ5 1;  1N8R 2;  4MD7 A;  3JAM f;  2P3Y A;  4MXU A;  4NBB A;  4A3I I;  1VQ4 Z;  1YJW Z;  2YU9 I;  1VQ8 1;  3I4M I;  2HF1 A;  3D9X A;  3VMI A;  1QVF Y;  3RZO I;  2JMO A;  2R7Z I;  3CPW Z;  3QWU A;  1K9M 1;  1NUI A;  3NDJ A;  2VUM I;  1VQM Z;  4A3L I;  1R9T I;  1Q7Y 2;  3G71 1;  2RBL A;  3CC7 1;  1K83 I;  3CME 1;  4DK1 A;  3HOX I;  5FLM I;  2NVY I;  4BY1 I;  1X3W A;  3OW2 Y;  1RO2 A;  4A3B I;  1YJ9 Z;  1M90 2;  2E2H I;  1S72 1;  3CMA 1;  3CCM 1;  1X0T A;  4HH4 A;  4E30 A;  5D1O B;  4EWC A;  3CCL 1;  1Q86 2;  3J81 b;  3NH4 A;  1TWG I;  4NBC A;  1VQ8 Z;  2KI7 B;  4E2Z A;  3GTM I;  3P5J B;  3I56 1;  1QVF Z;  3EER A;  2V8I A;  3Q87 A;  3PO3 I;  1WII A;  3LUS A;  2RPR A;  3VB9 A;  2OTL Z;  4MH4 A;  4E2W A;  3G71 Z;  1USP A;  1ZB8 A;  3GTQ I;  3J80 f;  2YAD A;  3GTG I;  2JUB A;  5D1O A;  4RVG A;  4QTT A;  1TWF I;  2VF1 A;  2DE5 A;  3GTO I;  2JA6 I;  1I3Q I;  1DL6 A;  1S72 Z;  3CMA Z;  3OW2 Z;  3CCM Z;  2F4O A;  1S7M A;  2R6M A;  2QRE B;  2G2K A;  5FLX f;  2V8K A;  3CCS 1;  2JA8 I;  2VUG A;  3CCL Z;  3F3P C;  3MON A;  1VQP Z;  4BY7 I;  4TNU A;  2I3C A;  1VQN 1;  2PMZ A;  4MON A;  2ZAE B;  1VQ9 1;  4A3D I;  1WCM I;  1Y1V S;  1VLA A;  1ZB9 A;  3G4S 1;  3KIF A;  4NBF A;  3CCR 1;  1VQM 1;  4HGZ A;  1K73 1;  3M3Y I;  3NFZ A;  3TDH B;  3S14 I;  2E9H A;  4A3K I;  1WW9 A;  4E2Y A;  5A2Q f;  2LIY A;  2P28 A;  3JAM b;  2KPI A;  4MD9 A;  1P9N A;  2QRD B;  2B63 I;  1YJ9 1;  3VMH A;  3GTK I;  4A93 I;  1Q82 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...