3HOUI

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 13
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI02
5C4XI 1X3WA 1Y1WI 3S1MI 4NB9A 1Y1VI 4A3MI 4MH4A 4BY1I 3VMIA 3GTLI 3RZDI 3S16I 3S2DI 2JS4A 4A93I 5IP9I 2JA8I 3HOWI 2B63I 3H0GI 4BBRI 4A3FI 3GTQI 3PO3I 2DE5A 5C44I 1X3ZA 5IP7I 4A3JI 2R93I 4NBEA 3LUSA 3GTJI 2JA6I 3ESWA 3HOUI 3I07A 1ZB9A 3VMGA 2JA7I 1R9TI 2PK7A 4QTUA 2F4MA 3K7AI 3U50C 3I4NI 3M4OI 3S1QI 1TWHI 4BXXI 1NUIA 1N2FA 2JR6A 4A3GI 1USPB 3S1NI 1TWCI 3S1RI 3S2HI 3Q87A 1Y1VS 3GTKI 4A3EI 4BY7I 1I6HI 3GTMS 1ML8A 4Y52I 1SFOI 5C4JI 3M3YI 3HOXI 3I4MI 1VLAA 2E2JI 4NBHA 4A3LI 4NBFA 3VB9A 4A3II 2RBLA 4NBAA 5C3EI 5FLMI 1LQLA 1USPA 2E2II 1TWAI 1WW9A 1RLYA 4NOZA 3PO2I 3HOVI 3HOZI 2R7ZI 2NVTI 3GTGI 4NBDA 1TWFI 1L1OC 1PFTA 2F4OA 4A3KI 3GTPI 2R92I 2VUMI 3RZOI 3PO3S 2BJOA 4QTTA 4Y7NI 3FKII 3S15I 4X6AI 3D6WA 1TFIA 4NBCA 1TWGI 2NVQI 4NB8A 3GTMI 3GTOI 2KPIA 3S14I 3S17I 4NBGA 4A3CI 1RO4A 2NVXI 5CM2M 3H3VJ 2DE6A 3GCFA 1K83I 4BBSI 1QYPA 3VMHA 1YUAA 2E2HI 2K5RA 1I3QI 4A3DI 2JNYA 2NVYI 1DL6A 3EERA 2P3YA 1I50I 3HOYI 1ZB8A 4XX2A 2YU9I 4A3BI 2J6AA 3GKQA 2JA5I 1WCMI 2HF1A 4NBBA 2DE7A 2AKLA 3CQZI
chains in the Genus database with same CATH superfamily
4E33A 3CCS1 1M1K1 4HGZA 4NB9A 3S16I 1KC81 5IP9I 3HOWI 5D1PA 1YIT1 1VQ8Z 4HH4A 3CCUZ 3PO3I 5C44I 3J7A4 3MONA 4E31A 1YJ9Z 2R93I 2H85A 3I56Z 3I551 5D1OA 1ZB9A 2JA7I 1R9TI 4BXXI 2O4HA 1Q812 2JR6A 1NJI1 4E30A 1Q821 1TWCI 2OTLZ 2QRCB 1QVGY 3GTKI 2LFUA 4A3EI 1VQPZ 1I6HI 3CCRZ 3GTMS 1ML8A 1YJN1 2ZAEB 3M3YI 3I4MI 2QEX1 4NBHA 4A3LI 2M6NA 4A3II 3CCV1 2OZKA 1Q861 4S1TA 1VQOZ 3CMA1 1RO2A 1YI21 1KC82 3HKZA 2Q4ZA 3PO2I 1VQK1 3CCJZ 1KQSZ 4E32A 2JIPA 4E2YA 1M902 3P5JB 3GTPI 2QRDB 4EWCA 1QVFY 3MZLB 3FKII 4NBCA 3I55Z 1VQ81 3FQMA 2IZ4A 3NH5A 3CCU1 4NB8A 3S14I 2KPIA 4A3CI 2RIQA 1RO4A 2NVXI 1NJI2 4MD9A 1Q822 1YJ91 2E9HA 3GCFA 3I561 3CMEZ 3MZKB 3EERA 2QR1B 3HOYI 2AYDA 4XX2A 2YU9I 1RQFA 2JIMA 3CQZI 3D9XA 1VQ7Z 4E2WA 3CC7Z 1Y1VI 1Q862 2OTL1 4MH4A 2VPWA 1QVGZ 3GTLI 3S2DI 2VF1A 3CCLZ 1Q811 2JA8I 3CCR1 3H0GI 4NFRA 3J81b 2R6MA 2JUBA 3J80f 2OOXB 3G71Z 3TDHB 3LUSA 3GTJI 3ESWA 1KQSY 4RS4A 1VQO1 3G6EZ 1FDIA 2QA4Z 2F4MA 4RV9A 2VPZA 4E2XA 1QF8A 1TWHI 1P9NA 2E7ZA 4AYBA 3CCJ1 1USPB 3FQQA 1FDOA 3S1NI 3S2HI 2JIOA 2EGTA 4RVGA 5T67A 1Q7Y2 1QVFZ 1K731 3G4SZ 1M901 2V8IA 3CXCY 4DGLA 1YJWZ 1S7MA 3JAMb 5IT9b 5C3EI 1USPA 3CME1 2QLVB 2V8KA 1TWAI 1RLYA 1Z02A 3HOVI 1VQ61 2NVTI 2Y0SA 1RNIA 1VQ9Z 1Y8CA 3CCEZ 4A3KI 5A2Qb 2R92I 1VQ71 3CC71 1YHQZ 5LL6f 2BJOA 5FLXb 4Y7NI 1W2BY 3CCL1 2YADA 4X6AI 1TFIA 5T64A 2NAPA 2RT9A 3CD6Z 3GTMI 3GTOI 5CM2M 2DE6A 2P28A 5T6BA 2OOYB 3G711 1I3QI 4A3DI 1K732 3G6E1 2JNYA 2QA41 4RVDA 2P3YA 1ZB8A 3GKQA 2O53A 1WCMI 2HF1A 3KIFA 2QREB 5C4XI 2OTJZ 1VQ51 3NH4A 3CC21 3NDIA 3S1MI 4A3MI 2JS4A 1N8R1 2PMZA 2M48A 3JAMf 2LIYA 3G4S1 2B63I 4BBRI 4A3FI 3GTQI 3CXCZ 1YJW1 4A3JI 1VQ4Z 1Q7Y1 2W03A 2GTIA 1VQ6Z 1WJ2A 3HOUI 3VMGA 4DQYB 2PK7A 4QTUA 5A2Qf 3U50C 1JWHC 1NUIA 1N2FA 3CCMZ 5FLXf 4A3GI 1VQ91 3CCE1 2RPRA 3EEDA 1Y1VS 1YHQ1 1W2BZ 4Y52I 5C4JI 4MXUA 1X0TA 1VLAA 2E2JI 1ZH1A 3CD61 3VTNA 1QXFA 4NBFA 3VB9A 3TE5B 2G2KA 4RVFA 5FLMI 1LQLA 3IFUA 2V45A 2E2II 1N8R2 1VQMZ 1VQ5Z 1KRLA 3CC2Z 2R7ZI 4MD8A 4NBDA 1VQNZ 1PFTA 2F4OA 2I3CA 3KIHA 2JMOA 2OTJ1 3RZOI 3PO3S 4NH1C 2QKDA 3T4NB 1JJ2Z 1WZNA 1AA6A 3OW2Z 2V3VA 2JIQA 1TWGI 2NVQI 3S17I 1YUKA 4NBGA 2GU2A 2RHBA 1VQ41 2HU9A 3IX0A 1KD11 3F3FC 4TNUA 3CC4Z 1WIIA 4BBSI 2E2HI 1YUAA 4DK1A 1Q16A 1I50I 3J81f 4A3BI 4NBBA 2VUGA 2V8JA 3CCM1 1X3WA 1Y1WI 2JIRA 1S72Z 2K3RA 4BY1I 3VMIA 3RZDI 1VQLZ 4A93I 3QWUA 2PM9A 2VPXA 3CCQZ 2DE5A 1X3ZA 1YIJ1 5IP7I 4CL1A 4NBEA 2JA6I 3I07A 1K9M1 1M1K2 3K7AI 1RO0A 1VQM1 3I4NI 3M4OI 3S1QI 2LEXA 3J80b 1K8A1 1VQN1 3CCSZ 1JJ2Y 3IF8A 3OW2Y 3BG1B 3CPWZ 1KD12 5IT9f 3S1RI 3Q87A 5AN9F 4BY7I 2IV2X 1YITZ 1SFOI 3HOXI 2W04A 2RBLA 2WAQA 4NBAA 1Z01A 3CC41 4E2ZA 4HGYA 1WW9A 4NOZA 3NH8A 3HOZI 3IR7A 3GTGI 2Q51A 3NFZA 1TWFI 1L1OC 2WB1A 1Z03A 3F3PC 3BG0B 4MONA 1S721 4MRIA 2GTHA 2VUMI 2IZ3A 4MD7A 1YIJZ 1K9M2 4QTTA 1VQL1 1YJNZ 3S15I 3D6WA 2VPYA 2QEXZ 3CCQ1 3NDJA 1K8A2 1VQP1 3H3VJ 3CCVZ 4RVHA 1NP6A 1K83I 3CMAZ 1QYPA 1SIWA 3VMHA 2K5RA 3D2LA 1YI2Z 2KI7B 2NVYI 1DL6A 1VQKZ 3CPWY 2J6AA 2JA5I 5D1OB 2DE7A 2AKLA
chains in the Genus database with same CATH topology
4E33A 3CCS1 1M1K1 4HGZA 4NB9A 3S16I 1KC81 5IP9I 3HOWI 5D1PA 1YIT1 1VQ8Z 4HH4A 3CCUZ 3PO3I 5C44I 3J7A4 3MONA 4E31A 1YJ9Z 2R93I 2H85A 3I56Z 3I551 5D1OA 1ZB9A 2JA7I 1R9TI 4BXXI 2O4HA 1Q812 2JR6A 1NJI1 4E30A 1Q821 1TWCI 2OTLZ 2QRCB 1QVGY 3GTKI 2LFUA 4A3EI 1VQPZ 1I6HI 3CCRZ 3GTMS 1ML8A 1YJN1 2ZAEB 3M3YI 3I4MI 2QEX1 4NBHA 4A3LI 2M6NA 4A3II 3CCV1 2OZKA 1Q861 4S1TA 1VQOZ 3CMA1 1RO2A 1YI21 1KC82 3HKZA 2Q4ZA 3PO2I 1VQK1 3CCJZ 1KQSZ 4E32A 1M902 4E2YA 3P5JB 3GTPI 2QRDB 4EWCA 1QVFY 3MZLB 3FKII 4NBCA 3I55Z 1VQ81 3FQMA 2IZ4A 3NH5A 3CCU1 4NB8A 3S14I 2KPIA 4A3CI 2RIQA 1RO4A 2NVXI 1NJI2 4MD9A 1Q822 1YJ91 2E9HA 3GCFA 3I561 3CMEZ 3MZKB 3EERA 2QR1B 3HOYI 4XX2A 2YU9I 1RQFA 3CQZI 3D9XA 1VQ7Z 4E2WA 3CC7Z 1Y1VI 1Q862 2OTL1 4MH4A 1QVGZ 3GTLI 3S2DI 2VF1A 3CCLZ 1Q811 2JA8I 3CCR1 3H0GI 4NFRA 3J81b 2R6MA 2JUBA 3J80f 2OOXB 3G71Z 3TDHB 3LUSA 3GTJI 3ESWA 1KQSY 4RS4A 1VQO1 3G6EZ 2QA4Z 2F4MA 4RV9A 4E2XA 1QF8A 1TWHI 1P9NA 4AYBA 3CCJ1 1USPB 3FQQA 3S1NI 3S2HI 2EGTA 4RVGA 5T67A 1Q7Y2 1QVFZ 1K731 3G4SZ 1M901 2V8IA 3CXCY 4DGLA 1YJWZ 1S7MA 3JAMb 5IT9b 5C3EI 1USPA 3CME1 2QLVB 2V8KA 1TWAI 1RLYA 1Z02A 3HOVI 1VQ61 2NVTI 2Y0SA 1RNIA 1VQ9Z 3CCEZ 4A3KI 5A2Qb 2R92I 1VQ71 3CC71 1YHQZ 5LL6f 2BJOA 5FLXb 4Y7NI 1W2BY 3CCL1 2YADA 4X6AI 1TFIA 5T64A 2RT9A 3CD6Z 3GTMI 3GTOI 5CM2M 2DE6A 2P28A 5T6BA 2OOYB 3G711 1I3QI 4A3DI 1K732 3G6E1 2JNYA 2QA41 4RVDA 2P3YA 1ZB8A 3GKQA 2O53A 1WCMI 2HF1A 3KIFA 2QREB 5C4XI 2OTJZ 1VQ51 3NH4A 3CC21 3NDIA 3S1MI 4A3MI 2JS4A 1N8R1 2PMZA 2M48A 3JAMf 2LIYA 3G4S1 2B63I 4BBRI 4A3FI 3GTQI 3CXCZ 1YJW1 4A3JI 1VQ4Z 1Q7Y1 2W03A 2GTIA 1VQ6Z 3HOUI 3VMGA 4DQYB 2PK7A 4QTUA 5A2Qf 3U50C 1JWHC 1NUIA 1N2FA 3CCMZ 5FLXf 4A3GI 1VQ91 3CCE1 2RPRA 3EEDA 1Y1VS 1YHQ1 1W2BZ 4Y52I 5C4JI 4MXUA 1X0TA 1VLAA 2E2JI 1ZH1A 3CD61 3VTNA 4NBFA 3VB9A 3TE5B 2G2KA 4RVFA 5FLMI 1LQLA 3IFUA 2E2II 1N8R2 1VQMZ 1VQ5Z 1KRLA 3CC2Z 2R7ZI 4MD8A 4NBDA 1VQNZ 1PFTA 2F4OA 2I3CA 3KIHA 2JMOA 2OTJ1 3RZOI 3PO3S 4NH1C 2QKDA 3T4NB 1JJ2Z 3OW2Z 1TWGI 2NVQI 3S17I 1YUKA 4NBGA 2GU2A 2RHBA 1VQ41 2HU9A 3IX0A 1KD11 3F3FC 4TNUA 3CC4Z 1WIIA 4BBSI 2E2HI 1YUAA 4DK1A 1I50I 3J81f 4A3BI 4NBBA 2VUGA 2V8JA 3CCM1 1X3WA 1Y1WI 1S72Z 2K3RA 4BY1I 3VMIA 3RZDI 1VQLZ 4A93I 3QWUA 2PM9A 3CCQZ 2DE5A 1X3ZA 1YIJ1 5IP7I 4CL1A 4NBEA 2JA6I 3I07A 1K9M1 1M1K2 3K7AI 1RO0A 1VQM1 3I4NI 3M4OI 3S1QI 3J80b 1K8A1 1VQN1 3CCSZ 1JJ2Y 3IF8A 3OW2Y 3BG1B 3CPWZ 1KD12 5IT9f 3S1RI 3Q87A 5AN9F 4BY7I 1YITZ 1SFOI 3HOXI 2W04A 2RBLA 2WAQA 4NBAA 1Z01A 3CC41 4E2ZA 4HGYA 1WW9A 4NOZA 3NH8A 3HOZI 3GTGI 2Q51A 3NFZA 1TWFI 1L1OC 2WB1A 1Z03A 3F3PC 3BG0B 4MONA 1S721 4MRIA 2GTHA 2VUMI 2IZ3A 4MD7A 1YIJZ 1K9M2 4QTTA 1VQL1 1YJNZ 3S15I 3D6WA 2QEXZ 3CCQ1 3NDJA 1K8A2 1VQP1 3H3VJ 3CCVZ 4RVHA 1NP6A 1K83I 3CMAZ 1QYPA 3VMHA 2K5RA 1YI2Z 2KI7B 2NVYI 1DL6A 1VQKZ 3CPWY 2J6AA 2JA5I 5D1OB 2DE7A 2AKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X I;  1X3W A;  1Y1W I;  3S1M I;  4NB9 A;  1Y1V I;  4A3M I;  4MH4 A;  4BY1 I;  3VMI A;  3GTL I;  3RZD I;  3S16 I;  3S2D I;  2JS4 A;  4A93 I;  5IP9 I;  2JA8 I;  3HOW I;  2B63 I;  3H0G I;  4BBR I;  4A3F I;  3GTQ I;  3PO3 I;  2DE5 A;  5C44 I;  1X3Z A;  5IP7 I;  4A3J I;  2R93 I;  4NBE A;  3LUS A;  3GTJ I;  2JA6 I;  3ESW A;  3HOU I;  3I07 A;  1ZB9 A;  3VMG A;  2JA7 I;  1R9T I;  2PK7 A;  4QTU A;  2F4M A;  3K7A I;  3U50 C;  3I4N I;  3M4O I;  3S1Q I;  1TWH I;  4BXX I;  1NUI A;  1N2F A;  2JR6 A;  4A3G I;  1USP B;  3S1N I;  1TWC I;  3S1R I;  3S2H I;  3Q87 A;  1Y1V S;  3GTK I;  4A3E I;  4BY7 I;  1I6H I;  3GTM S;  1ML8 A;  4Y52 I;  1SFO I;  5C4J I;  3M3Y I;  3HOX I;  3I4M I;  1VLA A;  2E2J I;  4NBH A;  4A3L I;  4NBF A;  3VB9 A;  4A3I I;  2RBL A;  4NBA A;  5C3E I;  5FLM I;  1LQL A;  1USP A;  2E2I I;  1TWA I;  1WW9 A;  1RLY A;  4NOZ A;  3PO2 I;  3HOV I;  3HOZ I;  2R7Z I;  2NVT I;  3GTG I;  4NBD A;  1TWF I;  1L1O C;  1PFT A;  2F4O A;  4A3K I;  3GTP I;  2R92 I;  2VUM I;  3RZO I;  3PO3 S;  2BJO A;  4QTT A;  4Y7N I;  3FKI I;  3S15 I;  4X6A I;  3D6W A;  1TFI A;  4NBC A;  1TWG I;  2NVQ I;  4NB8 A;  3GTM I;  3GTO I;  2KPI A;  3S14 I;  3S17 I;  4NBG A;  4A3C I;  1RO4 A;  2NVX I;  5CM2 M;  3H3V J;  2DE6 A;  3GCF A;  1K83 I;  4BBS I;  1QYP A;  3VMH A;  1YUA A;  2E2H I;  2K5R A;  1I3Q I;  4A3D I;  2JNY A;  2NVY I;  1DL6 A;  3EER A;  2P3Y A;  1I50 I;  3HOY I;  1ZB8 A;  4XX2 A;  2YU9 I;  4A3B I;  2J6A A;  3GKQ A;  2JA5 I;  1WCM I;  2HF1 A;  4NBB A;  2DE7 A;  2AKL A;  3CQZ I; 
#chains in the Genus database with same CATH topology
 4E33 A;  3CCS 1;  1M1K 1;  4HGZ A;  4NB9 A;  3S16 I;  1KC8 1;  5IP9 I;  3HOW I;  5D1P A;  1YIT 1;  1VQ8 Z;  4HH4 A;  3CCU Z;  3PO3 I;  5C44 I;  3J7A 4;  3MON A;  4E31 A;  1YJ9 Z;  2R93 I;  2H85 A;  3I56 Z;  3I55 1;  5D1O A;  1ZB9 A;  2JA7 I;  1R9T I;  4BXX I;  2O4H A;  1Q81 2;  2JR6 A;  1NJI 1;  4E30 A;  1Q82 1;  1TWC I;  2OTL Z;  2QRC B;  1QVG Y;  3GTK I;  2LFU A;  4A3E I;  1VQP Z;  1I6H I;  3CCR Z;  3GTM S;  1ML8 A;  1YJN 1;  2ZAE B;  3M3Y I;  3I4M I;  2QEX 1;  4NBH A;  4A3L I;  2M6N A;  4A3I I;  3CCV 1;  2OZK A;  1Q86 1;  4S1T A;  1VQO Z;  3CMA 1;  1RO2 A;  1YI2 1;  1KC8 2;  3HKZ A;  2Q4Z A;  3PO2 I;  1VQK 1;  3CCJ Z;  1KQS Z;  4E32 A;  2JIP A;  4E2Y A;  1M90 2;  3P5J B;  3GTP I;  2QRD B;  4EWC A;  1QVF Y;  3MZL B;  3FKI I;  4NBC A;  3I55 Z;  1VQ8 1;  3FQM A;  2IZ4 A;  3NH5 A;  3CCU 1;  4NB8 A;  3S14 I;  2KPI A;  4A3C I;  2RIQ A;  1RO4 A;  2NVX I;  1NJI 2;  4MD9 A;  1Q82 2;  1YJ9 1;  2E9H A;  3GCF A;  3I56 1;  3CME Z;  3MZK B;  3EER A;  2QR1 B;  3HOY I;  2AYD A;  4XX2 A;  2YU9 I;  1RQF A;  2JIM A;  3CQZ I;  3D9X A;  1VQ7 Z;  4E2W A;  3CC7 Z;  1Y1V I;  1Q86 2;  2OTL 1;  4MH4 A;  2VPW A;  1QVG Z;  3GTL I;  3S2D I;  2VF1 A;  3CCL Z;  1Q81 1;  2JA8 I;  3CCR 1;  3H0G I;  4NFR A;  3J81 b;  2R6M A;  2JUB A;  3J80 f;  2OOX B;  3G71 Z;  3TDH B;  3LUS A;  3GTJ I;  3ESW A;  1KQS Y;  4RS4 A;  1VQO 1;  3G6E Z;  1FDI A;  2QA4 Z;  2F4M A;  4RV9 A;  2VPZ A;  4E2X A;  1QF8 A;  1TWH I;  1P9N A;  2E7Z A;  4AYB A;  3CCJ 1;  1USP B;  3FQQ A;  1FDO A;  3S1N I;  3S2H I;  2JIO A;  2EGT A;  4RVG A;  5T67 A;  1Q7Y 2;  1QVF Z;  1K73 1;  3G4S Z;  1M90 1;  2V8I A;  3CXC Y;  4DGL A;  1YJW Z;  1S7M A;  3JAM b;  5IT9 b;  5C3E I;  1USP A;  3CME 1;  2QLV B;  2V8K A;  1TWA I;  1RLY A;  1Z02 A;  3HOV I;  1VQ6 1;  2NVT I;  2Y0S A;  1RNI A;  1VQ9 Z;  1Y8C A;  3CCE Z;  4A3K I;  5A2Q b;  2R92 I;  1VQ7 1;  3CC7 1;  1YHQ Z;  5LL6 f;  2BJO A;  5FLX b;  4Y7N I;  1W2B Y;  3CCL 1;  2YAD A;  4X6A I;  1TFI A;  5T64 A;  2NAP A;  2RT9 A;  3CD6 Z;  3GTM I;  3GTO I;  5CM2 M;  2DE6 A;  2P28 A;  5T6B A;  2OOY B;  3G71 1;  1I3Q I;  4A3D I;  1K73 2;  3G6E 1;  2JNY A;  2QA4 1;  4RVD A;  2P3Y A;  1ZB8 A;  3GKQ A;  2O53 A;  1WCM I;  2HF1 A;  3KIF A;  2QRE B;  5C4X I;  2OTJ Z;  1VQ5 1;  3NH4 A;  3CC2 1;  3NDI A;  3S1M I;  4A3M I;  2JS4 A;  1N8R 1;  2PMZ A;  2M48 A;  3JAM f;  2LIY A;  3G4S 1;  2B63 I;  4BBR I;  4A3F I;  3GTQ I;  3CXC Z;  1YJW 1;  4A3J I;  1VQ4 Z;  1Q7Y 1;  2W03 A;  2GTI A;  1VQ6 Z;  1WJ2 A;  3HOU I;  3VMG A;  4DQY B;  2PK7 A;  4QTU A;  5A2Q f;  3U50 C;  1JWH C;  1NUI A;  1N2F A;  3CCM Z;  5FLX f;  4A3G I;  1VQ9 1;  3CCE 1;  2RPR A;  3EED A;  1Y1V S;  1YHQ 1;  1W2B Z;  4Y52 I;  5C4J I;  4MXU A;  1X0T A;  1VLA A;  2E2J I;  1ZH1 A;  3CD6 1;  3VTN A;  1QXF A;  4NBF A;  3VB9 A;  3TE5 B;  2G2K A;  4RVF A;  5FLM I;  1LQL A;  3IFU A;  2V45 A;  2E2I I;  1N8R 2;  1VQM Z;  1VQ5 Z;  1KRL A;  3CC2 Z;  2R7Z I;  4MD8 A;  4NBD A;  1VQN Z;  1PFT A;  2F4O A;  2I3C A;  3KIH A;  2JMO A;  2OTJ 1;  3RZO I;  3PO3 S;  4NH1 C;  2QKD A;  3T4N B;  1JJ2 Z;  1WZN A;  1AA6 A;  3OW2 Z;  2V3V A;  2JIQ A;  1TWG I;  2NVQ I;  3S17 I;  1YUK A;  4NBG A;  2GU2 A;  2RHB A;  1VQ4 1;  2HU9 A;  3IX0 A;  1KD1 1;  3F3F C;  4TNU A;  3CC4 Z;  1WII A;  4BBS I;  2E2H I;  1YUA A;  4DK1 A;  1Q16 A;  1I50 I;  3J81 f;  4A3B I;  4NBB A;  2VUG A;  2V8J A;  3CCM 1;  1X3W A;  1Y1W I;  2JIR A;  1S72 Z;  2K3R A;  4BY1 I;  3VMI A;  3RZD I;  1VQL Z;  4A93 I;  3QWU A;  2PM9 A;  2VPX A;  3CCQ Z;  2DE5 A;  1X3Z A;  1YIJ 1;  5IP7 I;  4CL1 A;  4NBE A;  2JA6 I;  3I07 A;  1K9M 1;  1M1K 2;  3K7A I;  1RO0 A;  1VQM 1;  3I4N I;  3M4O I;  3S1Q I;  2LEX A;  3J80 b;  1K8A 1;  1VQN 1;  3CCS Z;  1JJ2 Y;  3IF8 A;  3OW2 Y;  3BG1 B;  3CPW Z;  1KD1 2;  5IT9 f;  3S1R I;  3Q87 A;  5AN9 F;  4BY7 I;  2IV2 X;  1YIT Z;  1SFO I;  3HOX I;  2W04 A;  2RBL A;  2WAQ A;  4NBA A;  1Z01 A;  3CC4 1;  4E2Z A;  4HGY A;  1WW9 A;  4NOZ A;  3NH8 A;  3HOZ I;  3IR7 A;  3GTG I;  2Q51 A;  3NFZ A;  1TWF I;  1L1O C;  2WB1 A;  1Z03 A;  3F3P C;  3BG0 B;  4MON A;  1S72 1;  4MRI A;  2GTH A;  2VUM I;  2IZ3 A;  4MD7 A;  1YIJ Z;  1K9M 2;  4QTT A;  1VQL 1;  1YJN Z;  3S15 I;  3D6W A;  2VPY A;  2QEX Z;  3CCQ 1;  3NDJ A;  1K8A 2;  1VQP 1;  3H3V J;  3CCV Z;  4RVH A;  1NP6 A;  1K83 I;  3CMA Z;  1QYP A;  1SIW A;  3VMH A;  2K5R A;  3D2L A;  1YI2 Z;  2KI7 B;  2NVY I;  1DL6 A;  1VQK Z;  3CPW Y;  2J6A A;  2JA5 I;  5D1O B;  2DE7 A;  2AKL A; 
#chains in the Genus database with same CATH homology
 4E33 A;  3CCS 1;  1M1K 1;  4HGZ A;  4NB9 A;  3S16 I;  1KC8 1;  5IP9 I;  3HOW I;  5D1P A;  1YIT 1;  1VQ8 Z;  4HH4 A;  3CCU Z;  3PO3 I;  5C44 I;  3J7A 4;  3MON A;  4E31 A;  1YJ9 Z;  2R93 I;  2H85 A;  3I56 Z;  3I55 1;  5D1O A;  1ZB9 A;  2JA7 I;  1R9T I;  4BXX I;  2O4H A;  1Q81 2;  2JR6 A;  1NJI 1;  4E30 A;  1Q82 1;  1TWC I;  2OTL Z;  2QRC B;  1QVG Y;  3GTK I;  2LFU A;  4A3E I;  1VQP Z;  1I6H I;  3CCR Z;  3GTM S;  1ML8 A;  1YJN 1;  2ZAE B;  3M3Y I;  3I4M I;  2QEX 1;  4NBH A;  4A3L I;  2M6N A;  4A3I I;  3CCV 1;  2OZK A;  1Q86 1;  4S1T A;  1VQO Z;  3CMA 1;  1RO2 A;  1YI2 1;  1KC8 2;  3HKZ A;  2Q4Z A;  3PO2 I;  1VQK 1;  3CCJ Z;  1KQS Z;  4E32 A;  1M90 2;  4E2Y A;  3P5J B;  3GTP I;  2QRD B;  4EWC A;  1QVF Y;  3MZL B;  3FKI I;  4NBC A;  3I55 Z;  1VQ8 1;  3FQM A;  2IZ4 A;  3NH5 A;  3CCU 1;  4NB8 A;  3S14 I;  2KPI A;  4A3C I;  2RIQ A;  1RO4 A;  2NVX I;  1NJI 2;  4MD9 A;  1Q82 2;  1YJ9 1;  2E9H A;  3GCF A;  3I56 1;  3CME Z;  3MZK B;  3EER A;  2QR1 B;  3HOY I;  4XX2 A;  2YU9 I;  1RQF A;  3CQZ I;  3D9X A;  1VQ7 Z;  4E2W A;  3CC7 Z;  1Y1V I;  1Q86 2;  2OTL 1;  4MH4 A;  1QVG Z;  3GTL I;  3S2D I;  2VF1 A;  3CCL Z;  1Q81 1;  2JA8 I;  3CCR 1;  3H0G I;  4NFR A;  3J81 b;  2R6M A;  2JUB A;  3J80 f;  2OOX B;  3G71 Z;  3TDH B;  3LUS A;  3GTJ I;  3ESW A;  1KQS Y;  4RS4 A;  1VQO 1;  3G6E Z;  2QA4 Z;  2F4M A;  4RV9 A;  4E2X A;  1QF8 A;  1TWH I;  1P9N A;  4AYB A;  3CCJ 1;  1USP B;  3FQQ A;  3S1N I;  3S2H I;  2EGT A;  4RVG A;  5T67 A;  1Q7Y 2;  1QVF Z;  1K73 1;  3G4S Z;  1M90 1;  2V8I A;  3CXC Y;  4DGL A;  1YJW Z;  1S7M A;  3JAM b;  5IT9 b;  5C3E I;  1USP A;  3CME 1;  2QLV B;  2V8K A;  1TWA I;  1RLY A;  1Z02 A;  3HOV I;  1VQ6 1;  2NVT I;  2Y0S A;  1RNI A;  1VQ9 Z;  3CCE Z;  4A3K I;  5A2Q b;  2R92 I;  1VQ7 1;  3CC7 1;  1YHQ Z;  5LL6 f;  2BJO A;  5FLX b;  4Y7N I;  1W2B Y;  3CCL 1;  2YAD A;  4X6A I;  1TFI A;  5T64 A;  2RT9 A;  3CD6 Z;  3GTM I;  3GTO I;  5CM2 M;  2DE6 A;  2P28 A;  5T6B A;  2OOY B;  3G71 1;  1I3Q I;  4A3D I;  1K73 2;  3G6E 1;  2JNY A;  2QA4 1;  4RVD A;  2P3Y A;  1ZB8 A;  3GKQ A;  2O53 A;  1WCM I;  2HF1 A;  3KIF A;  2QRE B;  5C4X I;  2OTJ Z;  1VQ5 1;  3NH4 A;  3CC2 1;  3NDI A;  3S1M I;  4A3M I;  2JS4 A;  1N8R 1;  2PMZ A;  2M48 A;  3JAM f;  2LIY A;  3G4S 1;  2B63 I;  4BBR I;  4A3F I;  3GTQ I;  3CXC Z;  1YJW 1;  4A3J I;  1VQ4 Z;  1Q7Y 1;  2W03 A;  2GTI A;  1VQ6 Z;  3HOU I;  3VMG A;  4DQY B;  2PK7 A;  4QTU A;  5A2Q f;  3U50 C;  1JWH C;  1NUI A;  1N2F A;  3CCM Z;  5FLX f;  4A3G I;  1VQ9 1;  3CCE 1;  2RPR A;  3EED A;  1Y1V S;  1YHQ 1;  1W2B Z;  4Y52 I;  5C4J I;  4MXU A;  1X0T A;  1VLA A;  2E2J I;  1ZH1 A;  3CD6 1;  3VTN A;  4NBF A;  3VB9 A;  3TE5 B;  2G2K A;  4RVF A;  5FLM I;  1LQL A;  3IFU A;  2E2I I;  1N8R 2;  1VQM Z;  1VQ5 Z;  1KRL A;  3CC2 Z;  2R7Z I;  4MD8 A;  4NBD A;  1VQN Z;  1PFT A;  2F4O A;  2I3C A;  3KIH A;  2JMO A;  2OTJ 1;  3RZO I;  3PO3 S;  4NH1 C;  2QKD A;  3T4N B;  1JJ2 Z;  3OW2 Z;  1TWG I;  2NVQ I;  3S17 I;  1YUK A;  4NBG A;  2GU2 A;  2RHB A;  1VQ4 1;  2HU9 A;  3IX0 A;  1KD1 1;  3F3F C;  4TNU A;  3CC4 Z;  1WII A;  4BBS I;  2E2H I;  1YUA A;  4DK1 A;  1I50 I;  3J81 f;  4A3B I;  4NBB A;  2VUG A;  2V8J A;  3CCM 1;  1X3W A;  1Y1W I;  1S72 Z;  2K3R A;  4BY1 I;  3VMI A;  3RZD I;  1VQL Z;  4A93 I;  3QWU A;  2PM9 A;  3CCQ Z;  2DE5 A;  1X3Z A;  1YIJ 1;  5IP7 I;  4CL1 A;  4NBE A;  2JA6 I;  3I07 A;  1K9M 1;  1M1K 2;  3K7A I;  1RO0 A;  1VQM 1;  3I4N I;  3M4O I;  3S1Q I;  3J80 b;  1K8A 1;  1VQN 1;  3CCS Z;  1JJ2 Y;  3IF8 A;  3OW2 Y;  3BG1 B;  3CPW Z;  1KD1 2;  5IT9 f;  3S1R I;  3Q87 A;  5AN9 F;  4BY7 I;  1YIT Z;  1SFO I;  3HOX I;  2W04 A;  2RBL A;  2WAQ A;  4NBA A;  1Z01 A;  3CC4 1;  4E2Z A;  4HGY A;  1WW9 A;  4NOZ A;  3NH8 A;  3HOZ I;  3GTG I;  2Q51 A;  3NFZ A;  1TWF I;  1L1O C;  2WB1 A;  1Z03 A;  3F3P C;  3BG0 B;  4MON A;  1S72 1;  4MRI A;  2GTH A;  2VUM I;  2IZ3 A;  4MD7 A;  1YIJ Z;  1K9M 2;  4QTT A;  1VQL 1;  1YJN Z;  3S15 I;  3D6W A;  2QEX Z;  3CCQ 1;  3NDJ A;  1K8A 2;  1VQP 1;  3H3V J;  3CCV Z;  4RVH A;  1NP6 A;  1K83 I;  3CMA Z;  1QYP A;  3VMH A;  2K5R A;  1YI2 Z;  2KI7 B;  2NVY I;  1DL6 A;  1VQK Z;  3CPW Y;  2J6A A;  2JA5 I;  5D1O B;  2DE7 A;  2AKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...