3HOUI

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription,transferase/dna/rna hybrid
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 13
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI02
3RZDI 1TWGI 3GTJI 3S15I 5FLMI 2JNYA 4A3GI 4Y7NI 2P3YA 3HOZI 1VLAA 3GTOI 4A3MI 4NB9A 3U50C 5IP7I 2DE6A 3GTKI 2R7ZI 3VMGA 3I4NI 3M3YI 1I3QI 5C4JI 1I50I 1R9TI 3ESWA 4BY7I 2DE7A 1PFTA 3PO2I 2E2JI 2F4OA 3S14I 4A93I 4NBFA 4A3BI 3S2DI 1ML8A 3H3VJ 2YU9I 2J6AA 1TFIA 3M4OI 1X3ZA 4NBDA 4NOZA 3RZOI 1USPB 1ZB9A 1I6HI 3S16I 2AKLA 3D6WA 1QYPA 4NB8A 1YUAA 3S2HI 1Y1WI 2NVYI 3GTPI 1USPA 4A3CI 2F4MA 5C3EI 2B63I 3FKII 2R92I 3GCFA 3VMIA 2JA6I 1N2FA 1NUIA 3S1RI 2E2HI 1L1OC 3PO3S 1X3WA 1TWAI 3LUSA 4QTTA 2R93I 1Y1VI 2PK7A 4BBSI 4BBRI 3S1QI 5C4XI 3GTLI 2HF1A 3GTQI 1RLYA 4A3DI 2BJOA 5CM2M 3GTMI 2NVQI 3S1MI 3HOYI 2KPIA 3Q87A 4NBEA 2NVXI 2DE5A 4NBGA 3GTMS 3S17I 1TWCI 3EERA 4NBHA 5IP9I 4A3LI 1WW9A 3VMHA 1Y1VS 2JA7I 3VB9A 4NBAA 4Y52I 4A3KI 3HOUI 3GTGI 4A3II 3I4MI 3PO3I 3K7AI 4X6AI 4NBBA 4A3FI 3S1NI 3GKQA 3H0GI 1RO4A 4BY1I 1DL6A 1LQLA 3HOWI 2RBLA 3CQZI 3HOXI 1SFOI 4A3JI 4MH4A 2NVTI 1ZB8A 2JA5I 3I07A 1TWFI 2VUMI 2JR6A 1K83I 1WCMI 2JA8I 2JS4A 4BXXI 2K5RA 4QTUA 1TWHI 3HOVI 4NBCA 4A3EI 5C44I 4XX2A 2E2II
chains in the Genus database with same CATH superfamily
1ZH1A 2QKDA 3GTJI 3RZDI 2GTHA 4AYBA 1VQPZ 1W2BY 3HOZI 3CC4Z 1VLAA 3U50C 3I4NI 5D1PA 5C4JI 3G4S1 3ESWA 1NJI1 4BY7I 3PO2I 2E2JI 3S14I 3CCS1 3T4NB 3M4OI 2J6AA 1TFIA 4S1TA 1VQ41 1YUKA 1X3ZA 4NOZA 2YADA 1VQ91 2H85A 1YIJ1 3S16I 1YHQ1 2LFUA 4NB8A 3CC21 1QVGY 1USPA 4E30A 3CCRZ 4RVDA 1QXFA 2B63I 2JA6I 1NUIA 2Q51A 1K8A1 3CXCZ 4RVFA 3CC2Z 2VPYA 3CCQZ 4MRIA 2O4HA 3NFZA 3NDJA 1QF8A 1YJW1 3BG0B 3GTQI 2G2KA 1RLYA 2IZ3A 4A3DI 5CM2M 3IX0A 1YJN1 4NBEA 3BG1B 3GTMS 2OZKA 4A3LI 1WW9A 1VQ71 2OTJZ 4HGZA 4A3II 1VQM1 4X6AI 1JWHC 3FQMA 2V8IA 3CCLZ 2LEXA 2Y0SA 2R6MA 4MH4A 3CCMZ 2JA5I 3I07A 1TWFI 1K83I 4TNUA 1VQMZ 1M1K2 1N8R2 4HH4A 1K8A2 4BXXI 1QVFY 1VQ8Z 4XX2A 2E2II 5FLMI 2W03A 2JNYA 4Y7NI 2VPWA 3CC7Z 1K9M2 3GTOI 2HU9A 2RPRA 4NB9A 2DE6A 3GTKI 3VMGA 1VQL1 1I3QI 4RVGA 1VQ81 4RVHA 2PM9A 1VQ9Z 2K3RA 3CCR1 4NBFA 1ML8A 2YU9I 4DK1A 4NBDA 2AKLA 3D6WA 3CCQ1 1X0TA 1Q811 5D1OA 1YI21 2WB1A 2NVYI 2W04A 4E2ZA 1VQP1 1AA6A 3GCFA 2V8JA 1NP6A 3TE5B 2E2HI 1L1OC 1X3WA 4DQYB 2R93I 2VUGA 2PK7A 2KI7B 3J81f 3GTLI 1VQ7Z 1Q822 3CPWY 3CCJZ 4MD8A 3P5JB 4RS4A 2QR1B 3OW2Z 1S721 1KD12 3GTMI 1Z02A 3CCM1 3HOYI 3G4SZ 4NBGA 1TWCI 5IP9I 2WAQA 1FDIA 2JIRA 2QRDB 5LL6f 2P28A 3CCJ1 2E9HA 5A2Qf 2JIPA 1S72Z 4NBAA 1Q821 1Q862 4CL1A 3GTGI 1RO0A 3I4MI 3CCV1 3K7AI 2M6NA 1YIT1 3G6EZ 3MZLB 5D1OB 1DL6A 3CMA1 3QWUA 1WJ2A 1Q812 1N8R1 1VQKZ 2Q4ZA 2VUMI 2GTIA 5T6BA 1WCMI 3CCVZ 1KQSY 4QTUA 1YI2Z 1VQ5Z 2NAPA 4A3EI 1JJ2Y 4E32A 3CCSZ 1TWGI 2O53A 3CMAZ 1S7MA 2V3VA 3MZKB 2P3YA 3CME1 1Q7Y2 4A3MI 3JAMf 1KRLA 3VTNA 3CCL1 1I50I 2F4OA 2QA4Z 5IT9b 3S2DI 3CPWZ 3H3VJ 2JUBA 5FLXf 1M1K1 1I6HI 2M48A 3G71Z 1YUAA 3KIHA 1Y1WI 3CCU1 2V8KA 3I56Z 2F4MA 5A2Qb 1K731 1YJNZ 3VMIA 3F3PC 3F3FC 1NJI2 2RIQA 3PO3S 1TWAI 3LUSA 4MD9A 1P9NA 3CCUZ 2GU2A 1KC81 1Y1VI 4DGLA 2RT9A 4E2XA 4BBSI 1KD11 4BBRI 3S1QI 3J81b 2HF1A 1RO2A 3FQQA 2OOYB 2OTJ1 2BJOA 1QVFZ 2NVQI 3I551 3KIFA 2KPIA 1VQLZ 3J7A4 3CC71 1WZNA 2AYDA 2VPZA 3VMHA 2JA7I 1Q7Y1 3VB9A 1YHQZ 1VQNZ 3NH5A 4Y52I 3CXCY 4A3KI 1SIWA 3NDIA 3HKZA 3PO3I 3IFUA 4NBBA 3S1NI 4NFRA 3H0GI 3NH4A 3CD6Z 1RO4A 4BY1I 1WIIA 2IV2X 1M901 1JJ2Z 2RBLA 1VQK1 3HOXI 4A3JI 1ZB8A 3NH8A 3IR7A 3EEDA 2JS4A 2OTLZ 4RV9A 1TWHI 4NBCA 5C44I 2RHBA 3S15I 4A3GI 1VQ4Z 2JIMA 3D2LA 1KC82 5IP7I 2R7ZI 3TDHB 3M3YI 2PMZA 1VQ61 1R9TI 3CC41 1Z01A 2DE7A 1PFTA 4NH1C 2EGTA 3JAMb 4A93I 4A3BI 3J80f 1VQOZ 2VPXA 1W2BZ 3RZOI 1USPB 1ZB9A 1QYPA 1VQO1 3S2HI 4EWCA 4MXUA 2I3CA 3GTPI 5T67A 4A3CI 4E33A 2QA41 1M902 5IT9f 1YJ9Z 1FDOA 5C3EI 3FKII 5T64A 2R92I 1N2FA 3CMEZ 2QEX1 3D9XA 3I561 1QVGZ 3S1RI 2E7ZA 3IF8A 2QLVB 1VQ51 2QRCB 2LIYA 4QTTA 3J80b 1RNIA 1YJWZ 1YIJZ 1VQN1 2IZ4A 2OTL1 5C4XI 1KQSZ 2V45A 2QREB 3S1MI 1Y8CA 3Q87A 4HGYA 2NVXI 2DE5A 3S17I 3EERA 4NBHA 4MONA 3I55Z 4MD7A 1Q16A 1RQFA 2JMOA 2OOXB 3CD61 2VF1A 1Y1VS 1K9M1 5AN9F 2ZAEB 2JIQA 3G6E1 3OW2Y 1YITZ 4E2WA 3HOUI 4A3FI 1Z03A 3GKQA 1VQ6Z 3CCEZ 1K732 2QEXZ 1LQLA 3HOWI 3CQZI 1SFOI 4E31A 3CCE1 2NVTI 1YJ91 2JR6A 1Q861 2JA8I 5FLXb 3G711 2JIOA 2K5RA 3MONA 4E2YA 3HOVI
chains in the Genus database with same CATH topology
1ZH1A 2QKDA 3GTJI 3RZDI 2GTHA 4AYBA 1VQPZ 1W2BY 3HOZI 3CC4Z 1VLAA 3U50C 3I4NI 5D1PA 5C4JI 3G4S1 3ESWA 1NJI1 4BY7I 3PO2I 2E2JI 3S14I 3CCS1 3T4NB 3M4OI 2J6AA 1TFIA 4S1TA 1VQ41 1YUKA 1X3ZA 4NOZA 2YADA 1VQ91 2H85A 1YIJ1 3S16I 1YHQ1 2LFUA 4NB8A 3CC21 1QVGY 1USPA 4E30A 3CCRZ 4RVDA 2B63I 2JA6I 1NUIA 2Q51A 1K8A1 3CXCZ 4RVFA 3CC2Z 3CCQZ 4MRIA 2O4HA 3NFZA 3NDJA 1QF8A 1YJW1 3BG0B 3GTQI 2G2KA 1RLYA 2IZ3A 4A3DI 5CM2M 3IX0A 1YJN1 4NBEA 3BG1B 3GTMS 2OZKA 4A3LI 1WW9A 1VQ71 2OTJZ 4HGZA 4A3II 1VQM1 4X6AI 1JWHC 3FQMA 2V8IA 3CCLZ 2Y0SA 2R6MA 4MH4A 3CCMZ 2JA5I 3I07A 1TWFI 1K83I 4TNUA 1VQMZ 1M1K2 1N8R2 4HH4A 1K8A2 4BXXI 1QVFY 1VQ8Z 4XX2A 2E2II 5FLMI 2W03A 2JNYA 4Y7NI 3CC7Z 1K9M2 3GTOI 2HU9A 2RPRA 4NB9A 2DE6A 3GTKI 3VMGA 1VQL1 1I3QI 4RVGA 1VQ81 4RVHA 2PM9A 1VQ9Z 2K3RA 3CCR1 4NBFA 1ML8A 2YU9I 4DK1A 4NBDA 2AKLA 3D6WA 3CCQ1 1X0TA 1Q811 5D1OA 1YI21 2WB1A 2NVYI 2W04A 4E2ZA 1VQP1 3GCFA 2V8JA 1NP6A 3TE5B 2E2HI 1L1OC 1X3WA 4DQYB 2R93I 2VUGA 2PK7A 2KI7B 3J81f 3GTLI 1VQ7Z 1Q822 3CPWY 3CCJZ 4MD8A 3P5JB 4RS4A 2QR1B 3OW2Z 1S721 1KD12 3GTMI 1Z02A 3CCM1 3HOYI 3G4SZ 4NBGA 1TWCI 5IP9I 2WAQA 2QRDB 5LL6f 2P28A 3CCJ1 2E9HA 5A2Qf 1S72Z 4NBAA 1Q821 1Q862 4CL1A 3GTGI 1RO0A 3I4MI 3CCV1 3K7AI 2M6NA 1YIT1 3G6EZ 3MZLB 5D1OB 1DL6A 3CMA1 3QWUA 1Q812 1N8R1 1VQKZ 2Q4ZA 2VUMI 2GTIA 5T6BA 1WCMI 3CCVZ 1KQSY 4QTUA 1YI2Z 1VQ5Z 4A3EI 1JJ2Y 4E32A 3CCSZ 1TWGI 2O53A 3CMAZ 1S7MA 3MZKB 2P3YA 3CME1 1Q7Y2 4A3MI 3JAMf 1KRLA 3VTNA 3CCL1 1I50I 2F4OA 2QA4Z 5IT9b 3S2DI 3CPWZ 3H3VJ 2JUBA 5FLXf 1M1K1 1I6HI 2M48A 3G71Z 1YUAA 3KIHA 1Y1WI 3CCU1 2V8KA 3I56Z 2F4MA 5A2Qb 1K731 1YJNZ 3VMIA 3F3PC 3F3FC 1NJI2 2RIQA 3PO3S 1TWAI 3LUSA 4MD9A 1P9NA 3CCUZ 1KC81 2GU2A 1Y1VI 4DGLA 2RT9A 4E2XA 4BBSI 1KD11 4BBRI 3S1QI 3J81b 2HF1A 1RO2A 3FQQA 2OOYB 2OTJ1 2BJOA 1QVFZ 2NVQI 3I551 3KIFA 2KPIA 1VQLZ 3J7A4 3CC71 3VMHA 2JA7I 1Q7Y1 3VB9A 1YHQZ 1VQNZ 3NH5A 4Y52I 3CXCY 4A3KI 3NDIA 3HKZA 3PO3I 3IFUA 4NBBA 3S1NI 4NFRA 3H0GI 3NH4A 3CD6Z 1RO4A 4BY1I 1WIIA 1M901 1JJ2Z 2RBLA 1VQK1 3HOXI 4A3JI 1ZB8A 3NH8A 3EEDA 2JS4A 2OTLZ 4RV9A 1TWHI 4NBCA 5C44I 2RHBA 3S15I 4A3GI 1VQ4Z 1KC82 5IP7I 2R7ZI 3TDHB 3M3YI 2PMZA 1VQ61 1R9TI 3CC41 1Z01A 2DE7A 1PFTA 4NH1C 2EGTA 3JAMb 4A93I 4A3BI 3J80f 1VQOZ 1W2BZ 3RZOI 1USPB 1ZB9A 1QYPA 1VQO1 3S2HI 4EWCA 4MXUA 2I3CA 3GTPI 5T67A 4A3CI 4E33A 2QA41 1M902 5IT9f 1YJ9Z 5C3EI 3FKII 5T64A 2R92I 1N2FA 3CMEZ 2QEX1 3D9XA 3I561 1QVGZ 3S1RI 3IF8A 2QLVB 1VQ51 2QRCB 2LIYA 1YJWZ 4QTTA 3J80b 1RNIA 1YIJZ 1VQN1 2IZ4A 2OTL1 5C4XI 1KQSZ 2QREB 3S1MI 3Q87A 4HGYA 2NVXI 2DE5A 3S17I 3EERA 4NBHA 4MONA 3I55Z 4MD7A 1RQFA 2JMOA 2OOXB 3CD61 2VF1A 1Y1VS 1K9M1 5AN9F 2ZAEB 3G6E1 3OW2Y 1YITZ 4E2WA 3HOUI 4A3FI 1Z03A 3GKQA 1VQ6Z 3CCEZ 1K732 2QEXZ 1LQLA 3HOWI 3CQZI 1SFOI 4E31A 3CCE1 2NVTI 1YJ91 2JR6A 1Q861 2JA8I 5FLXb 3G711 2K5RA 3MONA 4E2YA 3HOVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD I;  1TWG I;  3GTJ I;  3S15 I;  5FLM I;  2JNY A;  4A3G I;  4Y7N I;  2P3Y A;  3HOZ I;  1VLA A;  3GTO I;  4A3M I;  4NB9 A;  3U50 C;  5IP7 I;  2DE6 A;  3GTK I;  2R7Z I;  3VMG A;  3I4N I;  3M3Y I;  1I3Q I;  5C4J I;  1I50 I;  1R9T I;  3ESW A;  4BY7 I;  2DE7 A;  1PFT A;  3PO2 I;  2E2J I;  2F4O A;  3S14 I;  4A93 I;  4NBF A;  4A3B I;  3S2D I;  1ML8 A;  3H3V J;  2YU9 I;  2J6A A;  1TFI A;  3M4O I;  1X3Z A;  4NBD A;  4NOZ A;  3RZO I;  1USP B;  1ZB9 A;  1I6H I;  3S16 I;  2AKL A;  3D6W A;  1QYP A;  4NB8 A;  1YUA A;  3S2H I;  1Y1W I;  2NVY I;  3GTP I;  1USP A;  4A3C I;  2F4M A;  5C3E I;  2B63 I;  3FKI I;  2R92 I;  3GCF A;  3VMI A;  2JA6 I;  1N2F A;  1NUI A;  3S1R I;  2E2H I;  1L1O C;  3PO3 S;  1X3W A;  1TWA I;  3LUS A;  4QTT A;  2R93 I;  1Y1V I;  2PK7 A;  4BBS I;  4BBR I;  3S1Q I;  5C4X I;  3GTL I;  2HF1 A;  3GTQ I;  1RLY A;  4A3D I;  2BJO A;  5CM2 M;  3GTM I;  2NVQ I;  3S1M I;  3HOY I;  2KPI A;  3Q87 A;  4NBE A;  2NVX I;  2DE5 A;  4NBG A;  3GTM S;  3S17 I;  1TWC I;  3EER A;  4NBH A;  5IP9 I;  4A3L I;  1WW9 A;  3VMH A;  1Y1V S;  2JA7 I;  3VB9 A;  4NBA A;  4Y52 I;  4A3K I;  3HOU I;  3GTG I;  4A3I I;  3I4M I;  3PO3 I;  3K7A I;  4X6A I;  4NBB A;  4A3F I;  3S1N I;  3GKQ A;  3H0G I;  1RO4 A;  4BY1 I;  1DL6 A;  1LQL A;  3HOW I;  2RBL A;  3CQZ I;  3HOX I;  1SFO I;  4A3J I;  4MH4 A;  2NVT I;  1ZB8 A;  2JA5 I;  3I07 A;  1TWF I;  2VUM I;  2JR6 A;  1K83 I;  1WCM I;  2JA8 I;  2JS4 A;  4BXX I;  2K5R A;  4QTU A;  1TWH I;  3HOV I;  4NBC A;  4A3E I;  5C44 I;  4XX2 A;  2E2I I; 
#chains in the Genus database with same CATH topology
 1ZH1 A;  2QKD A;  3GTJ I;  3RZD I;  2GTH A;  4AYB A;  1VQP Z;  1W2B Y;  3HOZ I;  3CC4 Z;  1VLA A;  3U50 C;  3I4N I;  5D1P A;  5C4J I;  3G4S 1;  3ESW A;  1NJI 1;  4BY7 I;  3PO2 I;  2E2J I;  3S14 I;  3CCS 1;  3T4N B;  3M4O I;  2J6A A;  1TFI A;  4S1T A;  1VQ4 1;  1YUK A;  1X3Z A;  4NOZ A;  2YAD A;  1VQ9 1;  2H85 A;  1YIJ 1;  3S16 I;  1YHQ 1;  2LFU A;  4NB8 A;  3CC2 1;  1QVG Y;  1USP A;  4E30 A;  3CCR Z;  4RVD A;  1QXF A;  2B63 I;  2JA6 I;  1NUI A;  2Q51 A;  1K8A 1;  3CXC Z;  4RVF A;  3CC2 Z;  2VPY A;  3CCQ Z;  4MRI A;  2O4H A;  3NFZ A;  3NDJ A;  1QF8 A;  1YJW 1;  3BG0 B;  3GTQ I;  2G2K A;  1RLY A;  2IZ3 A;  4A3D I;  5CM2 M;  3IX0 A;  1YJN 1;  4NBE A;  3BG1 B;  3GTM S;  2OZK A;  4A3L I;  1WW9 A;  1VQ7 1;  2OTJ Z;  4HGZ A;  4A3I I;  1VQM 1;  4X6A I;  1JWH C;  3FQM A;  2V8I A;  3CCL Z;  2LEX A;  2Y0S A;  2R6M A;  4MH4 A;  3CCM Z;  2JA5 I;  3I07 A;  1TWF I;  1K83 I;  4TNU A;  1VQM Z;  1M1K 2;  1N8R 2;  4HH4 A;  1K8A 2;  4BXX I;  1QVF Y;  1VQ8 Z;  4XX2 A;  2E2I I;  5FLM I;  2W03 A;  2JNY A;  4Y7N I;  2VPW A;  3CC7 Z;  1K9M 2;  3GTO I;  2HU9 A;  2RPR A;  4NB9 A;  2DE6 A;  3GTK I;  3VMG A;  1VQL 1;  1I3Q I;  4RVG A;  1VQ8 1;  4RVH A;  2PM9 A;  1VQ9 Z;  2K3R A;  3CCR 1;  4NBF A;  1ML8 A;  2YU9 I;  4DK1 A;  4NBD A;  2AKL A;  3D6W A;  3CCQ 1;  1X0T A;  1Q81 1;  5D1O A;  1YI2 1;  2WB1 A;  2NVY I;  2W04 A;  4E2Z A;  1VQP 1;  1AA6 A;  3GCF A;  2V8J A;  1NP6 A;  3TE5 B;  2E2H I;  1L1O C;  1X3W A;  4DQY B;  2R93 I;  2VUG A;  2PK7 A;  2KI7 B;  3J81 f;  3GTL I;  1VQ7 Z;  1Q82 2;  3CPW Y;  3CCJ Z;  4MD8 A;  3P5J B;  4RS4 A;  2QR1 B;  3OW2 Z;  1S72 1;  1KD1 2;  3GTM I;  1Z02 A;  3CCM 1;  3HOY I;  3G4S Z;  4NBG A;  1TWC I;  5IP9 I;  2WAQ A;  1FDI A;  2JIR A;  2QRD B;  5LL6 f;  2P28 A;  3CCJ 1;  2E9H A;  5A2Q f;  2JIP A;  1S72 Z;  4NBA A;  1Q82 1;  1Q86 2;  4CL1 A;  3GTG I;  1RO0 A;  3I4M I;  3CCV 1;  3K7A I;  2M6N A;  1YIT 1;  3G6E Z;  3MZL B;  5D1O B;  1DL6 A;  3CMA 1;  3QWU A;  1WJ2 A;  1Q81 2;  1N8R 1;  1VQK Z;  2Q4Z A;  2VUM I;  2GTI A;  5T6B A;  1WCM I;  3CCV Z;  1KQS Y;  4QTU A;  1YI2 Z;  1VQ5 Z;  2NAP A;  4A3E I;  1JJ2 Y;  4E32 A;  3CCS Z;  1TWG I;  2O53 A;  3CMA Z;  1S7M A;  2V3V A;  3MZK B;  2P3Y A;  3CME 1;  1Q7Y 2;  4A3M I;  3JAM f;  1KRL A;  3VTN A;  3CCL 1;  1I50 I;  2F4O A;  2QA4 Z;  5IT9 b;  3S2D I;  3CPW Z;  3H3V J;  2JUB A;  5FLX f;  1M1K 1;  1I6H I;  2M48 A;  3G71 Z;  1YUA A;  3KIH A;  1Y1W I;  3CCU 1;  2V8K A;  3I56 Z;  2F4M A;  5A2Q b;  1K73 1;  1YJN Z;  3VMI A;  3F3P C;  3F3F C;  1NJI 2;  2RIQ A;  3PO3 S;  1TWA I;  3LUS A;  4MD9 A;  1P9N A;  3CCU Z;  2GU2 A;  1KC8 1;  1Y1V I;  4DGL A;  2RT9 A;  4E2X A;  4BBS I;  1KD1 1;  4BBR I;  3S1Q I;  3J81 b;  2HF1 A;  1RO2 A;  3FQQ A;  2OOY B;  2OTJ 1;  2BJO A;  1QVF Z;  2NVQ I;  3I55 1;  3KIF A;  2KPI A;  1VQL Z;  3J7A 4;  3CC7 1;  1WZN A;  2AYD A;  2VPZ A;  3VMH A;  2JA7 I;  1Q7Y 1;  3VB9 A;  1YHQ Z;  1VQN Z;  3NH5 A;  4Y52 I;  3CXC Y;  4A3K I;  1SIW A;  3NDI A;  3HKZ A;  3PO3 I;  3IFU A;  4NBB A;  3S1N I;  4NFR A;  3H0G I;  3NH4 A;  3CD6 Z;  1RO4 A;  4BY1 I;  1WII A;  2IV2 X;  1M90 1;  1JJ2 Z;  2RBL A;  1VQK 1;  3HOX I;  4A3J I;  1ZB8 A;  3NH8 A;  3IR7 A;  3EED A;  2JS4 A;  2OTL Z;  4RV9 A;  1TWH I;  4NBC A;  5C44 I;  2RHB A;  3S15 I;  4A3G I;  1VQ4 Z;  2JIM A;  3D2L A;  1KC8 2;  5IP7 I;  2R7Z I;  3TDH B;  3M3Y I;  2PMZ A;  1VQ6 1;  1R9T I;  3CC4 1;  1Z01 A;  2DE7 A;  1PFT A;  4NH1 C;  2EGT A;  3JAM b;  4A93 I;  4A3B I;  3J80 f;  1VQO Z;  2VPX A;  1W2B Z;  3RZO I;  1USP B;  1ZB9 A;  1QYP A;  1VQO 1;  3S2H I;  4EWC A;  4MXU A;  2I3C A;  3GTP I;  5T67 A;  4A3C I;  4E33 A;  2QA4 1;  1M90 2;  5IT9 f;  1YJ9 Z;  1FDO A;  5C3E I;  3FKI I;  5T64 A;  2R92 I;  1N2F A;  3CME Z;  2QEX 1;  3D9X A;  3I56 1;  1QVG Z;  3S1R I;  2E7Z A;  3IF8 A;  2QLV B;  1VQ5 1;  2QRC B;  2LIY A;  4QTT A;  3J80 b;  1RNI A;  1YJW Z;  1YIJ Z;  1VQN 1;  2IZ4 A;  2OTL 1;  5C4X I;  1KQS Z;  2V45 A;  2QRE B;  3S1M I;  1Y8C A;  3Q87 A;  4HGY A;  2NVX I;  2DE5 A;  3S17 I;  3EER A;  4NBH A;  4MON A;  3I55 Z;  4MD7 A;  1Q16 A;  1RQF A;  2JMO A;  2OOX B;  3CD6 1;  2VF1 A;  1Y1V S;  1K9M 1;  5AN9 F;  2ZAE B;  2JIQ A;  3G6E 1;  3OW2 Y;  1YIT Z;  4E2W A;  3HOU I;  4A3F I;  1Z03 A;  3GKQ A;  1VQ6 Z;  3CCE Z;  1K73 2;  2QEX Z;  1LQL A;  3HOW I;  3CQZ I;  1SFO I;  4E31 A;  3CCE 1;  2NVT I;  1YJ9 1;  2JR6 A;  1Q86 1;  2JA8 I;  5FLX b;  3G71 1;  2JIO A;  2K5R A;  3MON A;  4E2Y A;  3HOV I; 
#chains in the Genus database with same CATH homology
 1ZH1 A;  2QKD A;  3GTJ I;  3RZD I;  2GTH A;  4AYB A;  1VQP Z;  1W2B Y;  3HOZ I;  3CC4 Z;  1VLA A;  3U50 C;  3I4N I;  5D1P A;  5C4J I;  3G4S 1;  3ESW A;  1NJI 1;  4BY7 I;  3PO2 I;  2E2J I;  3S14 I;  3CCS 1;  3T4N B;  3M4O I;  2J6A A;  1TFI A;  4S1T A;  1VQ4 1;  1YUK A;  1X3Z A;  4NOZ A;  2YAD A;  1VQ9 1;  2H85 A;  1YIJ 1;  3S16 I;  1YHQ 1;  2LFU A;  4NB8 A;  3CC2 1;  1QVG Y;  1USP A;  4E30 A;  3CCR Z;  4RVD A;  2B63 I;  2JA6 I;  1NUI A;  2Q51 A;  1K8A 1;  3CXC Z;  4RVF A;  3CC2 Z;  3CCQ Z;  4MRI A;  2O4H A;  3NFZ A;  3NDJ A;  1QF8 A;  1YJW 1;  3BG0 B;  3GTQ I;  2G2K A;  1RLY A;  2IZ3 A;  4A3D I;  5CM2 M;  3IX0 A;  1YJN 1;  4NBE A;  3BG1 B;  3GTM S;  2OZK A;  4A3L I;  1WW9 A;  1VQ7 1;  2OTJ Z;  4HGZ A;  4A3I I;  1VQM 1;  4X6A I;  1JWH C;  3FQM A;  2V8I A;  3CCL Z;  2Y0S A;  2R6M A;  4MH4 A;  3CCM Z;  2JA5 I;  3I07 A;  1TWF I;  1K83 I;  4TNU A;  1VQM Z;  1M1K 2;  1N8R 2;  4HH4 A;  1K8A 2;  4BXX I;  1QVF Y;  1VQ8 Z;  4XX2 A;  2E2I I;  5FLM I;  2W03 A;  2JNY A;  4Y7N I;  3CC7 Z;  1K9M 2;  3GTO I;  2HU9 A;  2RPR A;  4NB9 A;  2DE6 A;  3GTK I;  3VMG A;  1VQL 1;  1I3Q I;  4RVG A;  1VQ8 1;  4RVH A;  2PM9 A;  1VQ9 Z;  2K3R A;  3CCR 1;  4NBF A;  1ML8 A;  2YU9 I;  4DK1 A;  4NBD A;  2AKL A;  3D6W A;  3CCQ 1;  1X0T A;  1Q81 1;  5D1O A;  1YI2 1;  2WB1 A;  2NVY I;  2W04 A;  4E2Z A;  1VQP 1;  3GCF A;  2V8J A;  1NP6 A;  3TE5 B;  2E2H I;  1L1O C;  1X3W A;  4DQY B;  2R93 I;  2VUG A;  2PK7 A;  2KI7 B;  3J81 f;  3GTL I;  1VQ7 Z;  1Q82 2;  3CPW Y;  3CCJ Z;  4MD8 A;  3P5J B;  4RS4 A;  2QR1 B;  3OW2 Z;  1S72 1;  1KD1 2;  3GTM I;  1Z02 A;  3CCM 1;  3HOY I;  3G4S Z;  4NBG A;  1TWC I;  5IP9 I;  2WAQ A;  2QRD B;  5LL6 f;  2P28 A;  3CCJ 1;  2E9H A;  5A2Q f;  1S72 Z;  4NBA A;  1Q82 1;  1Q86 2;  4CL1 A;  3GTG I;  1RO0 A;  3I4M I;  3CCV 1;  3K7A I;  2M6N A;  1YIT 1;  3G6E Z;  3MZL B;  5D1O B;  1DL6 A;  3CMA 1;  3QWU A;  1Q81 2;  1N8R 1;  1VQK Z;  2Q4Z A;  2VUM I;  2GTI A;  5T6B A;  1WCM I;  3CCV Z;  1KQS Y;  4QTU A;  1YI2 Z;  1VQ5 Z;  4A3E I;  1JJ2 Y;  4E32 A;  3CCS Z;  1TWG I;  2O53 A;  3CMA Z;  1S7M A;  3MZK B;  2P3Y A;  3CME 1;  1Q7Y 2;  4A3M I;  3JAM f;  1KRL A;  3VTN A;  3CCL 1;  1I50 I;  2F4O A;  2QA4 Z;  5IT9 b;  3S2D I;  3CPW Z;  3H3V J;  2JUB A;  5FLX f;  1M1K 1;  1I6H I;  2M48 A;  3G71 Z;  1YUA A;  3KIH A;  1Y1W I;  3CCU 1;  2V8K A;  3I56 Z;  2F4M A;  5A2Q b;  1K73 1;  1YJN Z;  3VMI A;  3F3P C;  3F3F C;  1NJI 2;  2RIQ A;  3PO3 S;  1TWA I;  3LUS A;  4MD9 A;  1P9N A;  3CCU Z;  1KC8 1;  2GU2 A;  1Y1V I;  4DGL A;  2RT9 A;  4E2X A;  4BBS I;  1KD1 1;  4BBR I;  3S1Q I;  3J81 b;  2HF1 A;  1RO2 A;  3FQQ A;  2OOY B;  2OTJ 1;  2BJO A;  1QVF Z;  2NVQ I;  3I55 1;  3KIF A;  2KPI A;  1VQL Z;  3J7A 4;  3CC7 1;  3VMH A;  2JA7 I;  1Q7Y 1;  3VB9 A;  1YHQ Z;  1VQN Z;  3NH5 A;  4Y52 I;  3CXC Y;  4A3K I;  3NDI A;  3HKZ A;  3PO3 I;  3IFU A;  4NBB A;  3S1N I;  4NFR A;  3H0G I;  3NH4 A;  3CD6 Z;  1RO4 A;  4BY1 I;  1WII A;  1M90 1;  1JJ2 Z;  2RBL A;  1VQK 1;  3HOX I;  4A3J I;  1ZB8 A;  3NH8 A;  3EED A;  2JS4 A;  2OTL Z;  4RV9 A;  1TWH I;  4NBC A;  5C44 I;  2RHB A;  3S15 I;  4A3G I;  1VQ4 Z;  1KC8 2;  5IP7 I;  2R7Z I;  3TDH B;  3M3Y I;  2PMZ A;  1VQ6 1;  1R9T I;  3CC4 1;  1Z01 A;  2DE7 A;  1PFT A;  4NH1 C;  2EGT A;  3JAM b;  4A93 I;  4A3B I;  3J80 f;  1VQO Z;  1W2B Z;  3RZO I;  1USP B;  1ZB9 A;  1QYP A;  1VQO 1;  3S2H I;  4EWC A;  4MXU A;  2I3C A;  3GTP I;  5T67 A;  4A3C I;  4E33 A;  2QA4 1;  1M90 2;  5IT9 f;  1YJ9 Z;  5C3E I;  3FKI I;  5T64 A;  2R92 I;  1N2F A;  3CME Z;  2QEX 1;  3D9X A;  3I56 1;  1QVG Z;  3S1R I;  3IF8 A;  2QLV B;  1VQ5 1;  2QRC B;  2LIY A;  1YJW Z;  4QTT A;  3J80 b;  1RNI A;  1YIJ Z;  1VQN 1;  2IZ4 A;  2OTL 1;  5C4X I;  1KQS Z;  2QRE B;  3S1M I;  3Q87 A;  4HGY A;  2NVX I;  2DE5 A;  3S17 I;  3EER A;  4NBH A;  4MON A;  3I55 Z;  4MD7 A;  1RQF A;  2JMO A;  2OOX B;  3CD6 1;  2VF1 A;  1Y1V S;  1K9M 1;  5AN9 F;  2ZAE B;  3G6E 1;  3OW2 Y;  1YIT Z;  4E2W A;  3HOU I;  4A3F I;  1Z03 A;  3GKQ A;  1VQ6 Z;  3CCE Z;  1K73 2;  2QEX Z;  1LQL A;  3HOW I;  3CQZ I;  1SFO I;  4E31 A;  3CCE 1;  2NVT I;  1YJ9 1;  2JR6 A;  1Q86 1;  2JA8 I;  5FLX b;  3G71 1;  2K5R A;  3MON A;  4E2Y A;  3HOV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...