3HOUI

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 13
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI02
3I07A 5FLMI 4A3MI 3CQZI 1X3ZA 3LUSA 2NVYI 3D6WA 1I6HI 1N2FA 3S16I 4NBAA 5C3EI 3HOYI 3VMHA 4X6AI 3PO3I 4A3FI 4A93I 3U50C 3GTMS 2BJOA 4BBSI 3M3YI 4A3GI 1ZB8A 3PO2I 3GTOI 3RZOI 3FKII 1I3QI 2F4OA 3I4NI 1RO4A 5C4XI 1K83I 2NVTI 2VUMI 3VMIA 2R93I 1X3WA 1Y1WI 2B63I 4NB9A 1LQLA 1SFOI 2PK7A 1Y1VI 4A3II 4BBRI 4QTUA 3VMGA 2JA7I 3GTLI 4QTTA 5IP9I 1PFTA 2E2HI 1ML8A 2NVXI 3HOZI 1I50I 1USPB 3M4OI 2RBLA 3S14I 1QYPA 3HOXI 4A3CI 3S15I 2AKLA 2P3YA 3S1NI 3RZDI 2R92I 3S2DI 1DL6A 2E2II 4NB8A 4NBFA 3Q87A 3HOWI 2JA6I 2JA8I 5IP7I 4A3JI 4BXXI 3H0GI 1TWAI 2YU9I 2K5RA 1USPA 3GTGI 4A3KI 4XX2A 2E2JI 4A3DI 3VB9A 4BY1I 4Y52I 1YUAA 2J6AA 2JS4A 4MH4A 5C4JI 3HOUI 3H3VJ 4NBEA 3GTQI 3HOVI 1TWFI 1TWGI 4Y7NI 2JR6A 3GTKI 2DE5A 3GTJI 3S17I 5CM2M 3GTPI 3GTMI 1Y1VS 1TWCI 4A3EI 1WCMI 1TFIA 4A3BI 2DE6A 4A3LI 3S1MI 1RLYA 2HF1A 1VLAA 3I4MI 3S1QI 1TWHI 1WW9A 2F4MA 3PO3S 4NOZA 4NBDA 1R9TI 3EERA 4NBBA 2NVQI 3ESWA 3S2HI 1ZB9A 3S1RI 2R7ZI 3K7AI 2JNYA 4NBHA 5C44I 1NUIA 4BY7I 3GCFA 2JA5I 4NBGA 4NBCA 2KPIA 1L1OC 3GKQA 2DE7A
chains in the Genus database with same CATH superfamily
3CC21 2NVYI 1I6HI 1VQOZ 1RO0A 4NBAA 2IZ4A 2QKDA 3CCL1 3HOYI 3G711 1JJ2Y 3VMHA 2PM9A 4A93I 3GTMS 3EEDA 1RQFA 1VQ8Z 3GTOI 3RZOI 1RO4A 5C4XI 1Q862 2OOXB 1Q812 2HU9A 3VMIA 1Y1WI 2B63I 1LQLA 1SFOI 2PK7A 2QREB 4AYBA 2OTLZ 3CCSZ 2O53A 3F3PC 2JIQA 4QTUA 1Z02A 3GTLI 5IP9I 2QLVB 3NDIA 2M48A 1VQK1 3IX0A 5D1PA 4MD8A 1W2BY 2H85A 2R92I 3CCV1 1DL6A 3CC41 4NBFA 1YITZ 3CPWY 3MONA 4MD9A 5IP7I 1VQNZ 3GTGI 1Y8CA 1YJNZ 5FLXb 3CMA1 1M901 5C4JI 5LL6f 3FQMA 3HOUI 2RT9A 1YJ9Z 2JR6A 1NJI2 3GTKI 1N8R1 3CC2Z 1JWHC 1Q7Y1 5CM2M 3GTPI 1WCMI 1TFIA 5D1OB 4A3LI 3G4S1 1RLYA 1VLAA 3CCLZ 3G71Z 1WW9A 2F4MA 1R9TI 2NVQI 3VTNA 1YIJ1 3S1RI 5T6BA 4DK1A 3G6EZ 2AYDA 2JA5I 4NBGA 2QRCB 1VQ7Z 1QVGZ 2DE7A 1VQ61 3CCR1 3TDHB 2KI7B 3CQZI 2JIRA 2QR1B 3D6WA 3P5JB 5IT9b 3CCVZ 3CC4Z 2BJOA 1S7MA 3BG1B 4E2ZA 3F3FC 2GTHA 1VQMZ 1KD11 3PO2I 3J81b 5A2Qf 1I3QI 2PMZA 3TE5B 3HKZA 3CME1 4RS4A 1VQ91 3CCE1 1YJW1 2OOYB 3CMAZ 2JIPA 4A3II 2P28A 3CC7Z 1QXFA 4BBRI 3CCQ1 1K8A1 3I55Z 4QTTA 2R6MA 2OTJ1 3HOZI 2RPRA 2Y0SA 4RVHA 1Z01A 3CD6Z 1YHQZ 3OW2Z 4A3CI 2V45A 3S15I 3MZKB 3G4SZ 2VPYA 3S1NI 3S2DI 1ZH1A 2NAPA 1X0TA 4CL1A 4EWCA 2JA8I 4MD7A 4E2XA 2V8IA 4E2WA 4NH1C 2QEX1 1VQ5Z 4HH4A 2LEXA 2K5RA 4A3KI 2VPWA 1YIJZ 4XX2A 2E2JI 1S72Z 2RHBA 4RVGA 3H3VJ 4Y7NI 3CCM1 2QRDB 1Z03A 3MZLB 3NDJA 3CCJZ 3S17I 3I56Z 4A3EI 3KIFA 3CXCY 4MXUA 1Q822 1Q861 1Q811 2V8JA 5T64A 3S1QI 1M902 1TWHI 3PO3S 4NBDA 1M1K2 5T67A 1VQPZ 3JAMb 3ESWA 1QVFZ 4RVFA 1Q7Y2 3K7AI 2JNYA 5C44I 2EGTA 4BY7I 3CMEZ 3CCEZ 5AN9F 1YJWZ 3T4NB 4TNUA 3CCQZ 3GKQA 1AA6A 4A3MI 3IR7A 4HGYA 1QVGY 3LUSA 1QF8A 2JIMA 1K732 1N2FA 3J80f 3S16I 4E30A 4E32A 4X6AI 2VPXA 2G2KA 1Q16A 4BBSI 4A3GI 1ZB8A 2V3VA 1NJI1 3FKII 1KC82 2F4OA 2VUMI 1K9M2 2W03A 2R93I 1X3WA 4NB9A 2YADA 1Y1VI 1VQKZ 2JA7I 3CCMZ 1PFTA 4HGZA 2E2HI 2NVXI 2OTL1 3CCS1 1USPB 2JIOA 2RBLA 3S14I 3J7A4 4E2YA 1QYPA 3HOXI 1YI21 2AKLA 4NFRA 4S1TA 3HOWI 4E33A 2JA6I 2Q51A 2E9HA 1K8A2 3H0GI 1YIT1 1USPA 2VUGA 2ZAEB 1KQSZ 1KRLA 1VQN1 1WIIA 2IV2X 1YUAA 2J6AA 2JS4A 4MH4A 3FQQA 1SIWA 4NBEA 3GTQI 1TWFI 1TWGI 2DE5A 3GTJI 3NH4A 1VQL1 3GTMI 2WB1A 3S1MI 2HF1A 2Q4ZA 2QA41 1RO2A 2VPZA 4NOZA 4E31A 3EERA 4NBBA 3D9XA 2JMOA 1ZB9A 2RIQA 2VF1A 1QVFY 3CCU1 4NBHA 1RNIA 1VQ6Z 3CCRZ 2LFUA 3GCFA 4RVDA 1VQ41 3G6E1 2E7ZA 3I07A 5FLMI 1VQ71 1X3ZA 1JJ2Z 3QWUA 5C3EI 1WJ2A 1YI2Z 2JUBA 3PO3I 4A3FI 3U50C 1N8R2 2I3CA 3M3YI 2W04A 1WZNA 2IZ3A 3BG0B 1VQ9Z 1VQM1 3I4NI 4MRIA 2NVTI 1K83I 2GTIA 3NFZA 1FDIA 1Q821 2OTJZ 3J80b 3VMGA 2O4HA 3JAMf 3CC71 5FLXf 1ML8A 1W2BZ 2M6NA 3KIHA 1VQLZ 1I50I 3NH5A 1M1K1 1VQO1 3M4OI 3I551 2P3YA 2WAQA 3IFUA 3CPWZ 3CD61 3RZDI 3CXCZ 1YHQ1 1P9NA 2E2II 4NB8A 3Q87A 2QEXZ 2QA4Z 1VQ81 4A3JI 4BXXI 1TWAI 2YU9I 3D2LA 1YUKA 1VQ51 3VB9A 4DQYB 4BY1I 4A3DI 4Y52I 1K731 3CCUZ 1KQSY 1S721 1KD12 3HOVI 5D1OA 1VQ4Z 3OW2Y 5A2Qb 1Y1VS 1TWCI 4A3BI 2DE6A 3IF8A 3CCJ1 1KC81 3I4MI 1K9M1 3I561 2GU2A 1NP6A 5IT9f 2K3RA 3S2HI 4DGLA 4RV9A 2LIYA 1FDOA 1VQP1 2R7ZI 1YJN1 3NH8A 2OZKA 2V8KA 1NUIA 4MONA 3J81f 4NBCA 1YJ91 2KPIA 1L1OC
chains in the Genus database with same CATH topology
3CC21 2NVYI 1I6HI 1VQOZ 1RO0A 4NBAA 2IZ4A 2QKDA 3CCL1 3HOYI 3G711 1JJ2Y 3VMHA 2PM9A 4A93I 3GTMS 3EEDA 1RQFA 1VQ8Z 3GTOI 3RZOI 1RO4A 5C4XI 1Q862 2OOXB 1Q812 2HU9A 3VMIA 1Y1WI 2B63I 1LQLA 1SFOI 2PK7A 2QREB 4AYBA 2OTLZ 3CCSZ 2O53A 3F3PC 4QTUA 1Z02A 3GTLI 5IP9I 2QLVB 3NDIA 2M48A 1VQK1 3IX0A 5D1PA 4MD8A 1W2BY 2H85A 2R92I 3CCV1 1DL6A 3CC41 4NBFA 1YITZ 3CPWY 3MONA 4MD9A 5IP7I 1VQNZ 3GTGI 1YJNZ 5FLXb 3CMA1 1M901 5C4JI 5LL6f 3FQMA 3HOUI 2RT9A 1YJ9Z 2JR6A 1NJI2 3GTKI 1N8R1 3CC2Z 1JWHC 1Q7Y1 5CM2M 3GTPI 1WCMI 1TFIA 5D1OB 4A3LI 3G4S1 1RLYA 1VLAA 3CCLZ 3G71Z 1WW9A 2F4MA 1R9TI 2NVQI 3VTNA 1YIJ1 3S1RI 5T6BA 4DK1A 3G6EZ 2JA5I 4NBGA 2QRCB 1VQ7Z 1QVGZ 2DE7A 1VQ61 3CCR1 3TDHB 2KI7B 3CQZI 2QR1B 3D6WA 3P5JB 5IT9b 3CCVZ 3CC4Z 2BJOA 1S7MA 3BG1B 4E2ZA 3F3FC 2GTHA 1VQMZ 1KD11 3PO2I 3J81b 5A2Qf 1I3QI 2PMZA 3TE5B 3HKZA 3CME1 4RS4A 1VQ91 3CCE1 1YJW1 2OOYB 3CMAZ 4A3II 2P28A 3CC7Z 4BBRI 1K8A1 3CCQ1 3I55Z 4QTTA 2R6MA 2OTJ1 3HOZI 2RPRA 2Y0SA 4RVHA 1Z01A 3CD6Z 1YHQZ 3OW2Z 4A3CI 3S15I 3MZKB 3G4SZ 3S1NI 3S2DI 1ZH1A 1X0TA 4CL1A 4EWCA 2JA8I 4MD7A 4E2XA 2V8IA 4E2WA 4NH1C 2QEX1 1VQ5Z 4HH4A 2K5RA 4A3KI 1YIJZ 4XX2A 2E2JI 1S72Z 2RHBA 4RVGA 3H3VJ 4Y7NI 3CCM1 2QRDB 1Z03A 3MZLB 3NDJA 3CCJZ 3S17I 3I56Z 4A3EI 3KIFA 3CXCY 4MXUA 1Q822 1Q861 1Q811 2V8JA 5T64A 3S1QI 1M902 1TWHI 3PO3S 4NBDA 1M1K2 5T67A 1VQPZ 3JAMb 3ESWA 1QVFZ 4RVFA 1Q7Y2 3K7AI 2JNYA 5C44I 2EGTA 4BY7I 3CMEZ 3CCEZ 5AN9F 1YJWZ 3T4NB 4TNUA 3CCQZ 3GKQA 4A3MI 4HGYA 1QVGY 3LUSA 1QF8A 1K732 1N2FA 3J80f 3S16I 4E30A 4E32A 4X6AI 2G2KA 4BBSI 4A3GI 1ZB8A 1NJI1 3FKII 1KC82 2F4OA 2VUMI 1K9M2 2W03A 2R93I 1X3WA 4NB9A 2YADA 1Y1VI 1VQKZ 2JA7I 3CCMZ 1PFTA 4HGZA 2E2HI 2NVXI 2OTL1 3CCS1 1USPB 2RBLA 3S14I 3J7A4 4E2YA 1QYPA 3HOXI 1YI21 2AKLA 4NFRA 4S1TA 3HOWI 4E33A 2JA6I 2Q51A 2E9HA 1K8A2 3H0GI 1YIT1 1USPA 2VUGA 2ZAEB 1KQSZ 1KRLA 1VQN1 1WIIA 1YUAA 2J6AA 2JS4A 4MH4A 3FQQA 4NBEA 3GTQI 1TWFI 1TWGI 2DE5A 3GTJI 3NH4A 1VQL1 3GTMI 2WB1A 3S1MI 2HF1A 2Q4ZA 2QA41 1RO2A 4NOZA 4E31A 3EERA 4NBBA 3D9XA 2JMOA 1ZB9A 2RIQA 2VF1A 1QVFY 3CCU1 4NBHA 1RNIA 1VQ6Z 3CCRZ 2LFUA 3GCFA 4RVDA 1VQ41 3G6E1 3I07A 5FLMI 1VQ71 1X3ZA 1JJ2Z 3QWUA 5C3EI 1YI2Z 2JUBA 3PO3I 4A3FI 3U50C 1N8R2 2I3CA 3M3YI 2W04A 2IZ3A 3BG0B 1VQ9Z 1VQM1 3I4NI 4MRIA 2NVTI 1K83I 2GTIA 3NFZA 1Q821 2OTJZ 3J80b 3VMGA 2O4HA 3JAMf 3CC71 5FLXf 1ML8A 1W2BZ 2M6NA 3KIHA 1VQLZ 1I50I 3NH5A 1M1K1 1VQO1 3M4OI 3I551 2P3YA 2WAQA 3IFUA 3CPWZ 3CD61 3RZDI 3CXCZ 1YHQ1 1P9NA 2E2II 4NB8A 3Q87A 2QEXZ 2QA4Z 1VQ81 4A3JI 4BXXI 1TWAI 2YU9I 1YUKA 1VQ51 3VB9A 4DQYB 4BY1I 4A3DI 4Y52I 1K731 3CCUZ 1KQSY 1S721 1KD12 3HOVI 5D1OA 1VQ4Z 3OW2Y 5A2Qb 1Y1VS 1TWCI 4A3BI 2DE6A 3IF8A 3CCJ1 1KC81 3I4MI 1K9M1 3I561 2GU2A 1NP6A 5IT9f 2K3RA 3S2HI 4DGLA 4RV9A 2LIYA 1VQP1 2R7ZI 1YJN1 3NH8A 2OZKA 2V8KA 1NUIA 4MONA 3J81f 4NBCA 1YJ91 2KPIA 1L1OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I07 A;  5FLM I;  4A3M I;  3CQZ I;  1X3Z A;  3LUS A;  2NVY I;  3D6W A;  1I6H I;  1N2F A;  3S16 I;  4NBA A;  5C3E I;  3HOY I;  3VMH A;  4X6A I;  3PO3 I;  4A3F I;  4A93 I;  3U50 C;  3GTM S;  2BJO A;  4BBS I;  3M3Y I;  4A3G I;  1ZB8 A;  3PO2 I;  3GTO I;  3RZO I;  3FKI I;  1I3Q I;  2F4O A;  3I4N I;  1RO4 A;  5C4X I;  1K83 I;  2NVT I;  2VUM I;  3VMI A;  2R93 I;  1X3W A;  1Y1W I;  2B63 I;  4NB9 A;  1LQL A;  1SFO I;  2PK7 A;  1Y1V I;  4A3I I;  4BBR I;  4QTU A;  3VMG A;  2JA7 I;  3GTL I;  4QTT A;  5IP9 I;  1PFT A;  2E2H I;  1ML8 A;  2NVX I;  3HOZ I;  1I50 I;  1USP B;  3M4O I;  2RBL A;  3S14 I;  1QYP A;  3HOX I;  4A3C I;  3S15 I;  2AKL A;  2P3Y A;  3S1N I;  3RZD I;  2R92 I;  3S2D I;  1DL6 A;  2E2I I;  4NB8 A;  4NBF A;  3Q87 A;  3HOW I;  2JA6 I;  2JA8 I;  5IP7 I;  4A3J I;  4BXX I;  3H0G I;  1TWA I;  2YU9 I;  2K5R A;  1USP A;  3GTG I;  4A3K I;  4XX2 A;  2E2J I;  4A3D I;  3VB9 A;  4BY1 I;  4Y52 I;  1YUA A;  2J6A A;  2JS4 A;  4MH4 A;  5C4J I;  3HOU I;  3H3V J;  4NBE A;  3GTQ I;  3HOV I;  1TWF I;  1TWG I;  4Y7N I;  2JR6 A;  3GTK I;  2DE5 A;  3GTJ I;  3S17 I;  5CM2 M;  3GTP I;  3GTM I;  1Y1V S;  1TWC I;  4A3E I;  1WCM I;  1TFI A;  4A3B I;  2DE6 A;  4A3L I;  3S1M I;  1RLY A;  2HF1 A;  1VLA A;  3I4M I;  3S1Q I;  1TWH I;  1WW9 A;  2F4M A;  3PO3 S;  4NOZ A;  4NBD A;  1R9T I;  3EER A;  4NBB A;  2NVQ I;  3ESW A;  3S2H I;  1ZB9 A;  3S1R I;  2R7Z I;  3K7A I;  2JNY A;  4NBH A;  5C44 I;  1NUI A;  4BY7 I;  3GCF A;  2JA5 I;  4NBG A;  4NBC A;  2KPI A;  1L1O C;  3GKQ A;  2DE7 A; 
#chains in the Genus database with same CATH topology
 3CC2 1;  2NVY I;  1I6H I;  1VQO Z;  1RO0 A;  4NBA A;  2IZ4 A;  2QKD A;  3CCL 1;  3HOY I;  3G71 1;  1JJ2 Y;  3VMH A;  2PM9 A;  4A93 I;  3GTM S;  3EED A;  1RQF A;  1VQ8 Z;  3GTO I;  3RZO I;  1RO4 A;  5C4X I;  1Q86 2;  2OOX B;  1Q81 2;  2HU9 A;  3VMI A;  1Y1W I;  2B63 I;  1LQL A;  1SFO I;  2PK7 A;  2QRE B;  4AYB A;  2OTL Z;  3CCS Z;  2O53 A;  3F3P C;  2JIQ A;  4QTU A;  1Z02 A;  3GTL I;  5IP9 I;  2QLV B;  3NDI A;  2M48 A;  1VQK 1;  3IX0 A;  5D1P A;  4MD8 A;  1W2B Y;  2H85 A;  2R92 I;  3CCV 1;  1DL6 A;  3CC4 1;  4NBF A;  1YIT Z;  3CPW Y;  3MON A;  4MD9 A;  5IP7 I;  1VQN Z;  3GTG I;  1Y8C A;  1YJN Z;  5FLX b;  3CMA 1;  1M90 1;  5C4J I;  5LL6 f;  3FQM A;  3HOU I;  2RT9 A;  1YJ9 Z;  2JR6 A;  1NJI 2;  3GTK I;  1N8R 1;  3CC2 Z;  1JWH C;  1Q7Y 1;  5CM2 M;  3GTP I;  1WCM I;  1TFI A;  5D1O B;  4A3L I;  3G4S 1;  1RLY A;  1VLA A;  3CCL Z;  3G71 Z;  1WW9 A;  2F4M A;  1R9T I;  2NVQ I;  3VTN A;  1YIJ 1;  3S1R I;  5T6B A;  4DK1 A;  3G6E Z;  2AYD A;  2JA5 I;  4NBG A;  2QRC B;  1VQ7 Z;  1QVG Z;  2DE7 A;  1VQ6 1;  3CCR 1;  3TDH B;  2KI7 B;  3CQZ I;  2JIR A;  2QR1 B;  3D6W A;  3P5J B;  5IT9 b;  3CCV Z;  3CC4 Z;  2BJO A;  1S7M A;  3BG1 B;  4E2Z A;  3F3F C;  2GTH A;  1VQM Z;  1KD1 1;  3PO2 I;  3J81 b;  5A2Q f;  1I3Q I;  2PMZ A;  3TE5 B;  3HKZ A;  3CME 1;  4RS4 A;  1VQ9 1;  3CCE 1;  1YJW 1;  2OOY B;  3CMA Z;  2JIP A;  4A3I I;  2P28 A;  3CC7 Z;  1QXF A;  4BBR I;  3CCQ 1;  1K8A 1;  3I55 Z;  4QTT A;  2R6M A;  2OTJ 1;  3HOZ I;  2RPR A;  2Y0S A;  4RVH A;  1Z01 A;  3CD6 Z;  1YHQ Z;  3OW2 Z;  4A3C I;  2V45 A;  3S15 I;  3MZK B;  3G4S Z;  2VPY A;  3S1N I;  3S2D I;  1ZH1 A;  2NAP A;  1X0T A;  4CL1 A;  4EWC A;  2JA8 I;  4MD7 A;  4E2X A;  2V8I A;  4E2W A;  4NH1 C;  2QEX 1;  1VQ5 Z;  4HH4 A;  2LEX A;  2K5R A;  4A3K I;  2VPW A;  1YIJ Z;  4XX2 A;  2E2J I;  1S72 Z;  2RHB A;  4RVG A;  3H3V J;  4Y7N I;  3CCM 1;  2QRD B;  1Z03 A;  3MZL B;  3NDJ A;  3CCJ Z;  3S17 I;  3I56 Z;  4A3E I;  3KIF A;  3CXC Y;  4MXU A;  1Q82 2;  1Q86 1;  1Q81 1;  2V8J A;  5T64 A;  3S1Q I;  1M90 2;  1TWH I;  3PO3 S;  4NBD A;  1M1K 2;  5T67 A;  1VQP Z;  3JAM b;  3ESW A;  1QVF Z;  4RVF A;  1Q7Y 2;  3K7A I;  2JNY A;  5C44 I;  2EGT A;  4BY7 I;  3CME Z;  3CCE Z;  5AN9 F;  1YJW Z;  3T4N B;  4TNU A;  3CCQ Z;  3GKQ A;  1AA6 A;  4A3M I;  3IR7 A;  4HGY A;  1QVG Y;  3LUS A;  1QF8 A;  2JIM A;  1K73 2;  1N2F A;  3J80 f;  3S16 I;  4E30 A;  4E32 A;  4X6A I;  2VPX A;  2G2K A;  1Q16 A;  4BBS I;  4A3G I;  1ZB8 A;  2V3V A;  1NJI 1;  3FKI I;  1KC8 2;  2F4O A;  2VUM I;  1K9M 2;  2W03 A;  2R93 I;  1X3W A;  4NB9 A;  2YAD A;  1Y1V I;  1VQK Z;  2JA7 I;  3CCM Z;  1PFT A;  4HGZ A;  2E2H I;  2NVX I;  2OTL 1;  3CCS 1;  1USP B;  2JIO A;  2RBL A;  3S14 I;  3J7A 4;  4E2Y A;  1QYP A;  3HOX I;  1YI2 1;  2AKL A;  4NFR A;  4S1T A;  3HOW I;  4E33 A;  2JA6 I;  2Q51 A;  2E9H A;  1K8A 2;  3H0G I;  1YIT 1;  1USP A;  2VUG A;  2ZAE B;  1KQS Z;  1KRL A;  1VQN 1;  1WII A;  2IV2 X;  1YUA A;  2J6A A;  2JS4 A;  4MH4 A;  3FQQ A;  1SIW A;  4NBE A;  3GTQ I;  1TWF I;  1TWG I;  2DE5 A;  3GTJ I;  3NH4 A;  1VQL 1;  3GTM I;  2WB1 A;  3S1M I;  2HF1 A;  2Q4Z A;  2QA4 1;  1RO2 A;  2VPZ A;  4NOZ A;  4E31 A;  3EER A;  4NBB A;  3D9X A;  2JMO A;  1ZB9 A;  2RIQ A;  2VF1 A;  1QVF Y;  3CCU 1;  4NBH A;  1RNI A;  1VQ6 Z;  3CCR Z;  2LFU A;  3GCF A;  4RVD A;  1VQ4 1;  3G6E 1;  2E7Z A;  3I07 A;  5FLM I;  1VQ7 1;  1X3Z A;  1JJ2 Z;  3QWU A;  5C3E I;  1WJ2 A;  1YI2 Z;  2JUB A;  3PO3 I;  4A3F I;  3U50 C;  1N8R 2;  2I3C A;  3M3Y I;  2W04 A;  1WZN A;  2IZ3 A;  3BG0 B;  1VQ9 Z;  1VQM 1;  3I4N I;  4MRI A;  2NVT I;  1K83 I;  2GTI A;  3NFZ A;  1FDI A;  1Q82 1;  2OTJ Z;  3J80 b;  3VMG A;  2O4H A;  3JAM f;  3CC7 1;  5FLX f;  1ML8 A;  1W2B Z;  2M6N A;  3KIH A;  1VQL Z;  1I50 I;  3NH5 A;  1M1K 1;  1VQO 1;  3M4O I;  3I55 1;  2P3Y A;  2WAQ A;  3IFU A;  3CPW Z;  3CD6 1;  3RZD I;  3CXC Z;  1YHQ 1;  1P9N A;  2E2I I;  4NB8 A;  3Q87 A;  2QEX Z;  2QA4 Z;  1VQ8 1;  4A3J I;  4BXX I;  1TWA I;  2YU9 I;  3D2L A;  1YUK A;  1VQ5 1;  3VB9 A;  4DQY B;  4BY1 I;  4A3D I;  4Y52 I;  1K73 1;  3CCU Z;  1KQS Y;  1S72 1;  1KD1 2;  3HOV I;  5D1O A;  1VQ4 Z;  3OW2 Y;  5A2Q b;  1Y1V S;  1TWC I;  4A3B I;  2DE6 A;  3IF8 A;  3CCJ 1;  1KC8 1;  3I4M I;  1K9M 1;  3I56 1;  2GU2 A;  1NP6 A;  5IT9 f;  2K3R A;  3S2H I;  4DGL A;  4RV9 A;  2LIY A;  1FDO A;  1VQP 1;  2R7Z I;  1YJN 1;  3NH8 A;  2OZK A;  2V8K A;  1NUI A;  4MON A;  3J81 f;  4NBC A;  1YJ9 1;  2KPI A;  1L1O C; 
#chains in the Genus database with same CATH homology
 3CC2 1;  2NVY I;  1I6H I;  1VQO Z;  1RO0 A;  4NBA A;  2IZ4 A;  2QKD A;  3CCL 1;  3HOY I;  3G71 1;  1JJ2 Y;  3VMH A;  2PM9 A;  4A93 I;  3GTM S;  3EED A;  1RQF A;  1VQ8 Z;  3GTO I;  3RZO I;  1RO4 A;  5C4X I;  1Q86 2;  2OOX B;  1Q81 2;  2HU9 A;  3VMI A;  1Y1W I;  2B63 I;  1LQL A;  1SFO I;  2PK7 A;  2QRE B;  4AYB A;  2OTL Z;  3CCS Z;  2O53 A;  3F3P C;  4QTU A;  1Z02 A;  3GTL I;  5IP9 I;  2QLV B;  3NDI A;  2M48 A;  1VQK 1;  3IX0 A;  5D1P A;  4MD8 A;  1W2B Y;  2H85 A;  2R92 I;  3CCV 1;  1DL6 A;  3CC4 1;  4NBF A;  1YIT Z;  3CPW Y;  3MON A;  4MD9 A;  5IP7 I;  1VQN Z;  3GTG I;  1YJN Z;  5FLX b;  3CMA 1;  1M90 1;  5C4J I;  5LL6 f;  3FQM A;  3HOU I;  2RT9 A;  1YJ9 Z;  2JR6 A;  1NJI 2;  3GTK I;  1N8R 1;  3CC2 Z;  1JWH C;  1Q7Y 1;  5CM2 M;  3GTP I;  1WCM I;  1TFI A;  5D1O B;  4A3L I;  3G4S 1;  1RLY A;  1VLA A;  3CCL Z;  3G71 Z;  1WW9 A;  2F4M A;  1R9T I;  2NVQ I;  3VTN A;  1YIJ 1;  3S1R I;  5T6B A;  4DK1 A;  3G6E Z;  2JA5 I;  4NBG A;  2QRC B;  1VQ7 Z;  1QVG Z;  2DE7 A;  1VQ6 1;  3CCR 1;  3TDH B;  2KI7 B;  3CQZ I;  2QR1 B;  3D6W A;  3P5J B;  5IT9 b;  3CCV Z;  3CC4 Z;  2BJO A;  1S7M A;  3BG1 B;  4E2Z A;  3F3F C;  2GTH A;  1VQM Z;  1KD1 1;  3PO2 I;  3J81 b;  5A2Q f;  1I3Q I;  2PMZ A;  3TE5 B;  3HKZ A;  3CME 1;  4RS4 A;  1VQ9 1;  3CCE 1;  1YJW 1;  2OOY B;  3CMA Z;  4A3I I;  2P28 A;  3CC7 Z;  4BBR I;  1K8A 1;  3CCQ 1;  3I55 Z;  4QTT A;  2R6M A;  2OTJ 1;  3HOZ I;  2RPR A;  2Y0S A;  4RVH A;  1Z01 A;  3CD6 Z;  1YHQ Z;  3OW2 Z;  4A3C I;  3S15 I;  3MZK B;  3G4S Z;  3S1N I;  3S2D I;  1ZH1 A;  1X0T A;  4CL1 A;  4EWC A;  2JA8 I;  4MD7 A;  4E2X A;  2V8I A;  4E2W A;  4NH1 C;  2QEX 1;  1VQ5 Z;  4HH4 A;  2K5R A;  4A3K I;  1YIJ Z;  4XX2 A;  2E2J I;  1S72 Z;  2RHB A;  4RVG A;  3H3V J;  4Y7N I;  3CCM 1;  2QRD B;  1Z03 A;  3MZL B;  3NDJ A;  3CCJ Z;  3S17 I;  3I56 Z;  4A3E I;  3KIF A;  3CXC Y;  4MXU A;  1Q82 2;  1Q86 1;  1Q81 1;  2V8J A;  5T64 A;  3S1Q I;  1M90 2;  1TWH I;  3PO3 S;  4NBD A;  1M1K 2;  5T67 A;  1VQP Z;  3JAM b;  3ESW A;  1QVF Z;  4RVF A;  1Q7Y 2;  3K7A I;  2JNY A;  5C44 I;  2EGT A;  4BY7 I;  3CME Z;  3CCE Z;  5AN9 F;  1YJW Z;  3T4N B;  4TNU A;  3CCQ Z;  3GKQ A;  4A3M I;  4HGY A;  1QVG Y;  3LUS A;  1QF8 A;  1K73 2;  1N2F A;  3J80 f;  3S16 I;  4E30 A;  4E32 A;  4X6A I;  2G2K A;  4BBS I;  4A3G I;  1ZB8 A;  1NJI 1;  3FKI I;  1KC8 2;  2F4O A;  2VUM I;  1K9M 2;  2W03 A;  2R93 I;  1X3W A;  4NB9 A;  2YAD A;  1Y1V I;  1VQK Z;  2JA7 I;  3CCM Z;  1PFT A;  4HGZ A;  2E2H I;  2NVX I;  2OTL 1;  3CCS 1;  1USP B;  2RBL A;  3S14 I;  3J7A 4;  4E2Y A;  1QYP A;  3HOX I;  1YI2 1;  2AKL A;  4NFR A;  4S1T A;  3HOW I;  4E33 A;  2JA6 I;  2Q51 A;  2E9H A;  1K8A 2;  3H0G I;  1YIT 1;  1USP A;  2VUG A;  2ZAE B;  1KQS Z;  1KRL A;  1VQN 1;  1WII A;  1YUA A;  2J6A A;  2JS4 A;  4MH4 A;  3FQQ A;  4NBE A;  3GTQ I;  1TWF I;  1TWG I;  2DE5 A;  3GTJ I;  3NH4 A;  1VQL 1;  3GTM I;  2WB1 A;  3S1M I;  2HF1 A;  2Q4Z A;  2QA4 1;  1RO2 A;  4NOZ A;  4E31 A;  3EER A;  4NBB A;  3D9X A;  2JMO A;  1ZB9 A;  2RIQ A;  2VF1 A;  1QVF Y;  3CCU 1;  4NBH A;  1RNI A;  1VQ6 Z;  3CCR Z;  2LFU A;  3GCF A;  4RVD A;  1VQ4 1;  3G6E 1;  3I07 A;  5FLM I;  1VQ7 1;  1X3Z A;  1JJ2 Z;  3QWU A;  5C3E I;  1YI2 Z;  2JUB A;  3PO3 I;  4A3F I;  3U50 C;  1N8R 2;  2I3C A;  3M3Y I;  2W04 A;  2IZ3 A;  3BG0 B;  1VQ9 Z;  1VQM 1;  3I4N I;  4MRI A;  2NVT I;  1K83 I;  2GTI A;  3NFZ A;  1Q82 1;  2OTJ Z;  3J80 b;  3VMG A;  2O4H A;  3JAM f;  3CC7 1;  5FLX f;  1ML8 A;  1W2B Z;  2M6N A;  3KIH A;  1VQL Z;  1I50 I;  3NH5 A;  1M1K 1;  1VQO 1;  3M4O I;  3I55 1;  2P3Y A;  2WAQ A;  3IFU A;  3CPW Z;  3CD6 1;  3RZD I;  3CXC Z;  1YHQ 1;  1P9N A;  2E2I I;  4NB8 A;  3Q87 A;  2QEX Z;  2QA4 Z;  1VQ8 1;  4A3J I;  4BXX I;  1TWA I;  2YU9 I;  1YUK A;  1VQ5 1;  3VB9 A;  4DQY B;  4BY1 I;  4A3D I;  4Y52 I;  1K73 1;  3CCU Z;  1KQS Y;  1S72 1;  1KD1 2;  3HOV I;  5D1O A;  1VQ4 Z;  3OW2 Y;  5A2Q b;  1Y1V S;  1TWC I;  4A3B I;  2DE6 A;  3IF8 A;  3CCJ 1;  1KC8 1;  3I4M I;  1K9M 1;  3I56 1;  2GU2 A;  1NP6 A;  5IT9 f;  2K3R A;  3S2H I;  4DGL A;  4RV9 A;  2LIY A;  1VQP 1;  2R7Z I;  1YJN 1;  3NH8 A;  2OZK A;  2V8K A;  1NUI A;  4MON A;  3J81 f;  4NBC A;  1YJ9 1;  2KPI A;  1L1O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...