5C4JI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4jI02
4NB9A 3U50C 3GTKI 3PO3I 3EERA 2NVYI 3GTMI 2E2JI 1TFIA 3S16I 2P3YA 1YUAA 3RZDI 1R9TI 4NBHA 2F4MA 4NOZA 1I6HI 3HOYI 4Y52I 4BBSI 4NBGA 2F4OA 4QTTA 3VMHA 2R92I 4A3II 4XX2A 5C3EI 4NBFA 2J6AA 3Q87A 3S1NI 5C44I 3PO3S 3GTMS 2JA5I 1NUIA 3CQZI 2KPIA 3GKQA 1Y1WI 4A3CI 3HOUI 3M4OI 2RBLA 3LUSA 2R93I 1RLYA 5FLMI 4NBBA 3M3YI 2JA8I 3S17I 1ZB9A 3HOZI 2NVTI 1PFTA 2DE6A 1TWGI 4NBAA 1TWAI 1TWHI 1RO4A 3H3VJ 1USPB 1TWCI 4BBRI 5IP9I 4Y7NI 3GTQI 3VMIA 3S1RI 1WW9A 1DL6A 3D6WA 2YU9I 2K5RA 2AKLA 4BY7I 1WCMI 3GTGI 3GTLI 4NB8A 3I4MI 3S15I 4NBCA 4A3BI 2JNYA 3S2HI 4X6AI 3HOWI 3I4NI 3HOXI 4A3EI 2JR6A 4BY1I 4A3GI 1K83I 1ML8A 5IP7I 1VLAA 2DE5A 5CM2M 2DE7A 1X3ZA 4NBEA 4NBDA 2B63I 3HOVI 3GTPI 4A3LI 4A3FI 2JA7I 4A3JI 3GTOI 2JA6I 4MH4A 4A3MI 1ZB8A 3S14I 4A3DI 3GCFA 3I07A 3RZOI 1X3WA 2R7ZI 3GTJI 3H0GI 3K7AI 3S1MI 2HF1A 5C4JI 1SFOI 3S2DI 2JS4A 3FKII 1Y1VI 1TWFI 1LQLA 1I3QI 3VMGA 2E2HI 2E2II 4A3KI 3ESWA 2BJOA 2NVQI 3S1QI 4A93I 1L1OC 1USPA 2VUMI 3VB9A 2NVXI 1I50I 4QTUA 4BXXI 3PO2I 1QYPA 5C4XI 1Y1VS 2PK7A 1N2FA
chains in the Genus database with same CATH superfamily
3CCM1 2JIQA 4RVHA 1VQ4Z 1VQ71 2E2JI 2RPRA 3S16I 1VQ51 2V8IA 2QEX1 1R9TI 4NBHA 4NOZA 1YITZ 2OTL1 3HOYI 2YADA 5D1OB 2M48A 3VMHA 2R92I 1VQ41 4NBFA 5IT9b 1VQ91 5C44I 3PO3S 3GTMS 3CQZI 2JIPA 2QR1B 2KPIA 4RVGA 2V8JA 3GKQA 1YIT1 2VPXA 1VQPZ 1VQNZ 3I56Z 2JIOA 2WB1A 3S17I 5FLXf 2G2KA 4E2WA 4NBAA 3CXCY 5IP9I 4Y7NI 3GTQI 1VQP1 1WW9A 2H85A 1VQN1 1YJW1 1WZNA 2AKLA 1WCMI 1Q16A 1QXFA 4A3BI 2JNYA 3G4SZ 3S2HI 4A3EI 4DK1A 4BY1I 4MXUA 1FDOA 1VQKZ 1FDIA 3CC2Z 1X3ZA 4NBEA 3CCV1 4NBDA 1ZH1A 4E32A 5T6BA 3G4S1 4A3FI 3GTOI 3NFZA 2JA6I 3J80f 2O4HA 3J7A4 1QVGY 4HH4A 3D2LA 3CC21 3JAMb 1N8R1 3H0GI 3K7AI 3OW2Y 1YJNZ 1SFOI 2M6NA 3P5JB 2E2II 3ESWA 4NFRA 3HKZA 2QA41 3CC7Z 4A93I 1L1OC 2OTJZ 1Y8CA 1YJN1 1YI21 4BXXI 2GTIA 4NB9A 3GTKI 3CC71 3GTMI 2NVYI 3PO3I 2OTJ1 1TFIA 1AA6A 2PMZA 1N8R2 1K731 1S72Z 3CCJZ 4E30A 1Q811 4E33A 2F4MA 1M1K1 1JJ2Z 4BBSI 4NBGA 1W2BZ 2F4OA 3J81f 4EWCA 4A3II 2J6AA 3S1NI 1S721 3CCJ1 3CMEZ 2GU2A 2E9HA 3G71Z 1K8A1 1VQ6Z 3HOUI 2R93I 2QRDB 3CCSZ 3MZKB 1SIWA 1ZB9A 2VPWA 3HOZI 1Q812 2NVTI 1PFTA 2DE6A 5FLXb 1TWGI 1M1K2 1YJ91 3MZLB 3H3VJ 1USPB 1TWCI 3CCEZ 3S1RI 1VQ61 1DL6A 2LFUA 1YUKA 3D6WA 4HGYA 3MONA 3CCS1 4BY7I 1VQLZ 3FQQA 2OOYB 4NBCA 3T4NB 1K8A2 1KQSZ 1JWHC 4A3GI 3CCRZ 1ML8A 2V8KA 2EGTA 3F3PC 2V45A 3CCLZ 3HOVI 4A3LI 4A3JI 2I3CA 3KIHA 4MH4A 3G6EZ 3S14I 4A3DI 3CCR1 3GCFA 3I561 3J80b 1VQMZ 2LEXA 3CCL1 3GTJI 3BG0B 2JS4A 4MRIA 5A2Qb 1LQLA 4MD9A 3G6E1 2NVQI 2O53A 1QVFZ 3TDHB 1VQM1 1WIIA 5LL6f 1P9NA 2RIQA 3CPWZ 4MD7A 2PK7A 4E2YA 4DGLA 1VQK1 3FQMA 4RS4A 3EERA 3CD6Z 1W2BY 1YUAA 3CCQZ 3RZDI 1I6HI 2RT9A 4Y52I 1RQFA 2V3VA 2W03A 3NH8A 2IZ3A 3J81b 5AN9F 4XX2A 3Q87A 2JA5I 3QWUA 3CXCZ 1KD11 1Y1WI 2Y0SA 3BG1B 2RBLA 3LUSA 5FLMI 2JIMA 2RHBA 2QLVB 3CMAZ 2JA8I 3CCUZ 1RO4A 4HGZA 2OZKA 2P28A 2K5RA 2Q4ZA 3CMA1 3GTGI 3GTLI 3CCU1 2WAQA 4RV9A 3I4MI 3S15I 1Z03A 3NDIA 1Q821 1QVGZ 2Q51A 1KD12 2JR6A 1WJ2A 5IP7I 3OW2Z 2DE7A 1K732 4TNUA 2ZAEB 1VQOZ 1VQ7Z 4MD8A 5D1OA 3GTPI 3CME1 2JA7I 3G711 2OTLZ 4A3MI 3I07A 5D1PA 1YHQZ 1VQO1 1X0TA 1VQ9Z 2HF1A 4E31A 3S2DI 2QREB 1Q822 1KRLA 1QVFY 3CCE1 1Z02A 3F3FC 4CL1A 1I3QI 3VMGA 1KC81 2E2HI 3NH4A 2BJOA 2VF1A 1VQL1 3CPWY 2VUMI 1YHQ1 3VB9A 2KI7B 2QKDA 2R6MA 2NVXI 4DQYB 1I50I 1NJI1 2AYDA 2JMOA 3PO2I 1QYPA 5C4XI 2JIRA 1Y1VS 3U50C 1S7MA 3D9XA 5T64A 1YJWZ 4AYBA 4E2XA 2P3YA 2GTHA 3IFUA 3IR7A 1KC82 4QTTA 1Q861 5IT9f 5C3EI 3CCVZ 1NUIA 2HU9A 1NJI2 4S1TA 1NP6A 1RO0A 4A3CI 3M4OI 1JJ2Y 1RLYA 3NH5A 4NBBA 3M3YI 4MONA 3VTNA 4NH1C 1TWAI 1M901 1TWHI 4BBRI 1RNIA 3VMIA 2YU9I 1Q862 2IV2X 3CD61 2QA4Z 4NB8A 3CCQ1 3EEDA 5A2Qf 4X6AI 3HOWI 3I4NI 3HOXI 2IZ4A 2NAPA 1YI2Z 1YIJZ 1K83I 1VLAA 2DE5A 5CM2M 3NDJA 1RO2A 2B63I 1Q7Y1 2OOXB 2QRCB 1M902 1VQ8Z 2K3RA 3CC4Z 1YIJ1 1ZB8A 1K9M1 1Z01A 3I55Z 2E7ZA 3JAMf 1X3WA 3RZOI 1KQSY 2LIYA 2PM9A 2VUGA 2R7ZI 3IX0A 3S1MI 3IF8A 5C4JI 3FKII 1Y1VI 2VPZA 3KIFA 1TWFI 5T67A 1VQ81 3CC41 4A3KI 2VPYA 4RVDA 4E2ZA 3TE5B 3I551 4RVFA 3CCMZ 3S1QI 1USPA 1VQ5Z 1Q7Y2 2QEXZ 2W04A 4QTUA 1YJ9Z 1K9M2 1QF8A 1N2FA 2JUBA
chains in the Genus database with same CATH topology
3CCM1 4RVHA 1VQ4Z 1VQ71 2E2JI 2RPRA 3S16I 1VQ51 2V8IA 2QEX1 1R9TI 4NBHA 4NOZA 1YITZ 2OTL1 3HOYI 2YADA 5D1OB 2M48A 3VMHA 2R92I 1VQ41 4NBFA 5IT9b 1VQ91 5C44I 3PO3S 3GTMS 3CQZI 2QR1B 2KPIA 4RVGA 2V8JA 3GKQA 1YIT1 1VQPZ 1VQNZ 3I56Z 2WB1A 3S17I 5FLXf 4E2WA 4NBAA 3CXCY 5IP9I 4Y7NI 3GTQI 1VQP1 1WW9A 2H85A 1VQN1 1YJW1 2AKLA 1WCMI 4A3BI 2JNYA 3G4SZ 3S2HI 4A3EI 4DK1A 4BY1I 4MXUA 1VQKZ 3CC2Z 1X3ZA 4NBEA 3CCV1 4NBDA 1ZH1A 4E32A 5T6BA 3G4S1 4A3FI 3GTOI 3NFZA 2JA6I 3J80f 2O4HA 3J7A4 1QVGY 4HH4A 3CC21 3JAMb 1N8R1 3H0GI 3K7AI 3OW2Y 1YJNZ 1SFOI 2M6NA 3P5JB 2E2II 3ESWA 4NFRA 3HKZA 2QA41 3CC7Z 4A93I 1L1OC 2OTJZ 1YJN1 1YI21 4BXXI 2GTIA 4NB9A 3GTKI 3CC71 3GTMI 2NVYI 3PO3I 2OTJ1 1TFIA 2PMZA 1N8R2 1K731 1S72Z 3CCJZ 4E30A 1Q811 4E33A 2F4MA 1M1K1 1JJ2Z 4BBSI 4NBGA 1W2BZ 2F4OA 3J81f 4EWCA 4A3II 2J6AA 3S1NI 1S721 3CCJ1 3CMEZ 2GU2A 2E9HA 3G71Z 1K8A1 1VQ6Z 3HOUI 2R93I 2QRDB 3CCSZ 3MZKB 1ZB9A 3HOZI 1Q812 2NVTI 1PFTA 2DE6A 5FLXb 1TWGI 1M1K2 1YJ91 3MZLB 3H3VJ 1USPB 1TWCI 3CCEZ 3S1RI 1VQ61 1DL6A 2LFUA 1YUKA 3D6WA 4HGYA 3MONA 3CCS1 4BY7I 1VQLZ 3FQQA 2OOYB 4NBCA 3T4NB 1K8A2 1KQSZ 1JWHC 4A3GI 3CCRZ 1ML8A 2V8KA 2EGTA 3F3PC 3CCLZ 3HOVI 4A3LI 4A3JI 2I3CA 3KIHA 4MH4A 3G6EZ 3S14I 4A3DI 3CCR1 3GCFA 3I561 3J80b 1VQMZ 3CCL1 3GTJI 3BG0B 2JS4A 4MRIA 5A2Qb 1LQLA 4MD9A 3G6E1 2NVQI 2O53A 1QVFZ 3TDHB 1VQM1 1WIIA 5LL6f 1P9NA 2RIQA 3CPWZ 4MD7A 2PK7A 4E2YA 4DGLA 1VQK1 3FQMA 4RS4A 3EERA 3CD6Z 1W2BY 1YUAA 3CCQZ 3RZDI 1I6HI 2RT9A 4Y52I 1RQFA 2W03A 3NH8A 2IZ3A 3J81b 5AN9F 4XX2A 3Q87A 2JA5I 3QWUA 3CXCZ 1KD11 1Y1WI 2Y0SA 3BG1B 2RBLA 3LUSA 5FLMI 2RHBA 2QLVB 3CMAZ 2JA8I 3CCUZ 1QF8A 1RO4A 4HGZA 2OZKA 2P28A 2K5RA 2Q4ZA 3CMA1 3GTGI 3GTLI 3CCU1 2WAQA 4RV9A 3I4MI 3S15I 1Z03A 3NDIA 1Q821 1QVGZ 2Q51A 1KD12 2JR6A 5IP7I 3OW2Z 2DE7A 1K732 4TNUA 2ZAEB 1VQOZ 1VQ7Z 4MD8A 5D1OA 3GTPI 3CME1 2JA7I 3G711 2OTLZ 4A3MI 3I07A 5D1PA 1YHQZ 1VQO1 1X0TA 1VQ9Z 2HF1A 4E31A 3S2DI 2QREB 1Q822 1KRLA 1QVFY 3CCE1 1Z02A 3F3FC 4CL1A 1I3QI 3VMGA 1KC81 2E2HI 3NH4A 2BJOA 2VF1A 1VQL1 3CPWY 2VUMI 1YHQ1 3VB9A 2KI7B 2QKDA 2R6MA 2NVXI 4DQYB 1I50I 1NJI1 2JMOA 3PO2I 1QYPA 5C4XI 1Y1VS 3U50C 1S7MA 3D9XA 5T64A 1YJWZ 4AYBA 4E2XA 2P3YA 2GTHA 3IFUA 1KC82 4QTTA 1Q861 5IT9f 5C3EI 3CCVZ 1NUIA 2HU9A 1NJI2 4S1TA 1NP6A 1RO0A 4A3CI 3M4OI 1JJ2Y 1RLYA 3NH5A 4NBBA 3M3YI 4MONA 3VTNA 4NH1C 1TWAI 1M901 1TWHI 4BBRI 1RNIA 3VMIA 2YU9I 1Q862 3CD61 2QA4Z 4NB8A 3CCQ1 3EEDA 5A2Qf 4X6AI 3HOWI 3I4NI 3HOXI 2IZ4A 1YI2Z 1YIJZ 1K83I 1VLAA 2DE5A 5CM2M 3NDJA 1RO2A 2B63I 1Q7Y1 2OOXB 2QRCB 1M902 1VQ8Z 2K3RA 3CC4Z 1YIJ1 1ZB8A 1K9M1 1Z01A 3I55Z 3JAMf 1X3WA 3RZOI 1KQSY 2LIYA 2PM9A 2VUGA 2R7ZI 3IX0A 3S1MI 3IF8A 5C4JI 3FKII 1Y1VI 3KIFA 1TWFI 5T67A 1VQ81 3CC41 4A3KI 4RVDA 4E2ZA 3TE5B 3I551 4RVFA 3CCMZ 3S1QI 1USPA 1VQ5Z 1Q7Y2 2QEXZ 2W04A 4QTUA 1YJ9Z 1K9M2 2G2KA 1N2FA 2JUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB9 A;  3U50 C;  3GTK I;  3PO3 I;  3EER A;  2NVY I;  3GTM I;  2E2J I;  1TFI A;  3S16 I;  2P3Y A;  1YUA A;  3RZD I;  1R9T I;  4NBH A;  2F4M A;  4NOZ A;  1I6H I;  3HOY I;  4Y52 I;  4BBS I;  4NBG A;  2F4O A;  4QTT A;  3VMH A;  2R92 I;  4A3I I;  4XX2 A;  5C3E I;  4NBF A;  2J6A A;  3Q87 A;  3S1N I;  5C44 I;  3PO3 S;  3GTM S;  2JA5 I;  1NUI A;  3CQZ I;  2KPI A;  3GKQ A;  1Y1W I;  4A3C I;  3HOU I;  3M4O I;  2RBL A;  3LUS A;  2R93 I;  1RLY A;  5FLM I;  4NBB A;  3M3Y I;  2JA8 I;  3S17 I;  1ZB9 A;  3HOZ I;  2NVT I;  1PFT A;  2DE6 A;  1TWG I;  4NBA A;  1TWA I;  1TWH I;  1RO4 A;  3H3V J;  1USP B;  1TWC I;  4BBR I;  5IP9 I;  4Y7N I;  3GTQ I;  3VMI A;  3S1R I;  1WW9 A;  1DL6 A;  3D6W A;  2YU9 I;  2K5R A;  2AKL A;  4BY7 I;  1WCM I;  3GTG I;  3GTL I;  4NB8 A;  3I4M I;  3S15 I;  4NBC A;  4A3B I;  2JNY A;  3S2H I;  4X6A I;  3HOW I;  3I4N I;  3HOX I;  4A3E I;  2JR6 A;  4BY1 I;  4A3G I;  1K83 I;  1ML8 A;  5IP7 I;  1VLA A;  2DE5 A;  5CM2 M;  2DE7 A;  1X3Z A;  4NBE A;  4NBD A;  2B63 I;  3HOV I;  3GTP I;  4A3L I;  4A3F I;  2JA7 I;  4A3J I;  3GTO I;  2JA6 I;  4MH4 A;  4A3M I;  1ZB8 A;  3S14 I;  4A3D I;  3GCF A;  3I07 A;  3RZO I;  1X3W A;  2R7Z I;  3GTJ I;  3H0G I;  3K7A I;  3S1M I;  2HF1 A;  5C4J I;  1SFO I;  3S2D I;  2JS4 A;  3FKI I;  1Y1V I;  1TWF I;  1LQL A;  1I3Q I;  3VMG A;  2E2H I;  2E2I I;  4A3K I;  3ESW A;  2BJO A;  2NVQ I;  3S1Q I;  4A93 I;  1L1O C;  1USP A;  2VUM I;  3VB9 A;  2NVX I;  1I50 I;  4QTU A;  4BXX I;  3PO2 I;  1QYP A;  5C4X I;  1Y1V S;  2PK7 A;  1N2F A; 
#chains in the Genus database with same CATH topology
 3CCM 1;  2JIQ A;  4RVH A;  1VQ4 Z;  1VQ7 1;  2E2J I;  2RPR A;  3S16 I;  1VQ5 1;  2V8I A;  2QEX 1;  1R9T I;  4NBH A;  4NOZ A;  1YIT Z;  2OTL 1;  3HOY I;  2YAD A;  5D1O B;  2M48 A;  3VMH A;  2R92 I;  1VQ4 1;  4NBF A;  5IT9 b;  1VQ9 1;  5C44 I;  3PO3 S;  3GTM S;  3CQZ I;  2JIP A;  2QR1 B;  2KPI A;  4RVG A;  2V8J A;  3GKQ A;  1YIT 1;  2VPX A;  1VQP Z;  1VQN Z;  3I56 Z;  2JIO A;  2WB1 A;  3S17 I;  5FLX f;  2G2K A;  4E2W A;  4NBA A;  3CXC Y;  5IP9 I;  4Y7N I;  3GTQ I;  1VQP 1;  1WW9 A;  2H85 A;  1VQN 1;  1YJW 1;  1WZN A;  2AKL A;  1WCM I;  1Q16 A;  1QXF A;  4A3B I;  2JNY A;  3G4S Z;  3S2H I;  4A3E I;  4DK1 A;  4BY1 I;  4MXU A;  1FDO A;  1VQK Z;  1FDI A;  3CC2 Z;  1X3Z A;  4NBE A;  3CCV 1;  4NBD A;  1ZH1 A;  4E32 A;  5T6B A;  3G4S 1;  4A3F I;  3GTO I;  3NFZ A;  2JA6 I;  3J80 f;  2O4H A;  3J7A 4;  1QVG Y;  4HH4 A;  3D2L A;  3CC2 1;  3JAM b;  1N8R 1;  3H0G I;  3K7A I;  3OW2 Y;  1YJN Z;  1SFO I;  2M6N A;  3P5J B;  2E2I I;  3ESW A;  4NFR A;  3HKZ A;  2QA4 1;  3CC7 Z;  4A93 I;  1L1O C;  2OTJ Z;  1Y8C A;  1YJN 1;  1YI2 1;  4BXX I;  2GTI A;  4NB9 A;  3GTK I;  3CC7 1;  3GTM I;  2NVY I;  3PO3 I;  2OTJ 1;  1TFI A;  1AA6 A;  2PMZ A;  1N8R 2;  1K73 1;  1S72 Z;  3CCJ Z;  4E30 A;  1Q81 1;  4E33 A;  2F4M A;  1M1K 1;  1JJ2 Z;  4BBS I;  4NBG A;  1W2B Z;  2F4O A;  3J81 f;  4EWC A;  4A3I I;  2J6A A;  3S1N I;  1S72 1;  3CCJ 1;  3CME Z;  2GU2 A;  2E9H A;  3G71 Z;  1K8A 1;  1VQ6 Z;  3HOU I;  2R93 I;  2QRD B;  3CCS Z;  3MZK B;  1SIW A;  1ZB9 A;  2VPW A;  3HOZ I;  1Q81 2;  2NVT I;  1PFT A;  2DE6 A;  5FLX b;  1TWG I;  1M1K 2;  1YJ9 1;  3MZL B;  3H3V J;  1USP B;  1TWC I;  3CCE Z;  3S1R I;  1VQ6 1;  1DL6 A;  2LFU A;  1YUK A;  3D6W A;  4HGY A;  3MON A;  3CCS 1;  4BY7 I;  1VQL Z;  3FQQ A;  2OOY B;  4NBC A;  3T4N B;  1K8A 2;  1KQS Z;  1JWH C;  4A3G I;  3CCR Z;  1ML8 A;  2V8K A;  2EGT A;  3F3P C;  2V45 A;  3CCL Z;  3HOV I;  4A3L I;  4A3J I;  2I3C A;  3KIH A;  4MH4 A;  3G6E Z;  3S14 I;  4A3D I;  3CCR 1;  3GCF A;  3I56 1;  3J80 b;  1VQM Z;  2LEX A;  3CCL 1;  3GTJ I;  3BG0 B;  2JS4 A;  4MRI A;  5A2Q b;  1LQL A;  4MD9 A;  3G6E 1;  2NVQ I;  2O53 A;  1QVF Z;  3TDH B;  1VQM 1;  1WII A;  5LL6 f;  1P9N A;  2RIQ A;  3CPW Z;  4MD7 A;  2PK7 A;  4E2Y A;  4DGL A;  1VQK 1;  3FQM A;  4RS4 A;  3EER A;  3CD6 Z;  1W2B Y;  1YUA A;  3CCQ Z;  3RZD I;  1I6H I;  2RT9 A;  4Y52 I;  1RQF A;  2V3V A;  2W03 A;  3NH8 A;  2IZ3 A;  3J81 b;  5AN9 F;  4XX2 A;  3Q87 A;  2JA5 I;  3QWU A;  3CXC Z;  1KD1 1;  1Y1W I;  2Y0S A;  3BG1 B;  2RBL A;  3LUS A;  5FLM I;  2JIM A;  2RHB A;  2QLV B;  3CMA Z;  2JA8 I;  3CCU Z;  1RO4 A;  4HGZ A;  2OZK A;  2P28 A;  2K5R A;  2Q4Z A;  3CMA 1;  3GTG I;  3GTL I;  3CCU 1;  2WAQ A;  4RV9 A;  3I4M I;  3S15 I;  1Z03 A;  3NDI A;  1Q82 1;  1QVG Z;  2Q51 A;  1KD1 2;  2JR6 A;  1WJ2 A;  5IP7 I;  3OW2 Z;  2DE7 A;  1K73 2;  4TNU A;  2ZAE B;  1VQO Z;  1VQ7 Z;  4MD8 A;  5D1O A;  3GTP I;  3CME 1;  2JA7 I;  3G71 1;  2OTL Z;  4A3M I;  3I07 A;  5D1P A;  1YHQ Z;  1VQO 1;  1X0T A;  1VQ9 Z;  2HF1 A;  4E31 A;  3S2D I;  2QRE B;  1Q82 2;  1KRL A;  1QVF Y;  3CCE 1;  1Z02 A;  3F3F C;  4CL1 A;  1I3Q I;  3VMG A;  1KC8 1;  2E2H I;  3NH4 A;  2BJO A;  2VF1 A;  1VQL 1;  3CPW Y;  2VUM I;  1YHQ 1;  3VB9 A;  2KI7 B;  2QKD A;  2R6M A;  2NVX I;  4DQY B;  1I50 I;  1NJI 1;  2AYD A;  2JMO A;  3PO2 I;  1QYP A;  5C4X I;  2JIR A;  1Y1V S;  3U50 C;  1S7M A;  3D9X A;  5T64 A;  1YJW Z;  4AYB A;  4E2X A;  2P3Y A;  2GTH A;  3IFU A;  3IR7 A;  1KC8 2;  4QTT A;  1Q86 1;  5IT9 f;  5C3E I;  3CCV Z;  1NUI A;  2HU9 A;  1NJI 2;  4S1T A;  1NP6 A;  1RO0 A;  4A3C I;  3M4O I;  1JJ2 Y;  1RLY A;  3NH5 A;  4NBB A;  3M3Y I;  4MON A;  3VTN A;  4NH1 C;  1TWA I;  1M90 1;  1TWH I;  4BBR I;  1RNI A;  3VMI A;  2YU9 I;  1Q86 2;  2IV2 X;  3CD6 1;  2QA4 Z;  4NB8 A;  3CCQ 1;  3EED A;  5A2Q f;  4X6A I;  3HOW I;  3I4N I;  3HOX I;  2IZ4 A;  2NAP A;  1YI2 Z;  1YIJ Z;  1K83 I;  1VLA A;  2DE5 A;  5CM2 M;  3NDJ A;  1RO2 A;  2B63 I;  1Q7Y 1;  2OOX B;  2QRC B;  1M90 2;  1VQ8 Z;  2K3R A;  3CC4 Z;  1YIJ 1;  1ZB8 A;  1K9M 1;  1Z01 A;  3I55 Z;  2E7Z A;  3JAM f;  1X3W A;  3RZO I;  1KQS Y;  2LIY A;  2PM9 A;  2VUG A;  2R7Z I;  3IX0 A;  3S1M I;  3IF8 A;  5C4J I;  3FKI I;  1Y1V I;  2VPZ A;  3KIF A;  1TWF I;  5T67 A;  1VQ8 1;  3CC4 1;  4A3K I;  2VPY A;  4RVD A;  4E2Z A;  3TE5 B;  3I55 1;  4RVF A;  3CCM Z;  3S1Q I;  1USP A;  1VQ5 Z;  1Q7Y 2;  2QEX Z;  2W04 A;  4QTU A;  1YJ9 Z;  1K9M 2;  1QF8 A;  1N2F A;  2JUB A; 
#chains in the Genus database with same CATH homology
 3CCM 1;  4RVH A;  1VQ4 Z;  1VQ7 1;  2E2J I;  2RPR A;  3S16 I;  1VQ5 1;  2V8I A;  2QEX 1;  1R9T I;  4NBH A;  4NOZ A;  1YIT Z;  2OTL 1;  3HOY I;  2YAD A;  5D1O B;  2M48 A;  3VMH A;  2R92 I;  1VQ4 1;  4NBF A;  5IT9 b;  1VQ9 1;  5C44 I;  3PO3 S;  3GTM S;  3CQZ I;  2QR1 B;  2KPI A;  4RVG A;  2V8J A;  3GKQ A;  1YIT 1;  1VQP Z;  1VQN Z;  3I56 Z;  2WB1 A;  3S17 I;  5FLX f;  4E2W A;  4NBA A;  3CXC Y;  5IP9 I;  4Y7N I;  3GTQ I;  1VQP 1;  1WW9 A;  2H85 A;  1VQN 1;  1YJW 1;  2AKL A;  1WCM I;  4A3B I;  2JNY A;  3G4S Z;  3S2H I;  4A3E I;  4DK1 A;  4BY1 I;  4MXU A;  1VQK Z;  3CC2 Z;  1X3Z A;  4NBE A;  3CCV 1;  4NBD A;  1ZH1 A;  4E32 A;  5T6B A;  3G4S 1;  4A3F I;  3GTO I;  3NFZ A;  2JA6 I;  3J80 f;  2O4H A;  3J7A 4;  1QVG Y;  4HH4 A;  3CC2 1;  3JAM b;  1N8R 1;  3H0G I;  3K7A I;  3OW2 Y;  1YJN Z;  1SFO I;  2M6N A;  3P5J B;  2E2I I;  3ESW A;  4NFR A;  3HKZ A;  2QA4 1;  3CC7 Z;  4A93 I;  1L1O C;  2OTJ Z;  1YJN 1;  1YI2 1;  4BXX I;  2GTI A;  4NB9 A;  3GTK I;  3CC7 1;  3GTM I;  2NVY I;  3PO3 I;  2OTJ 1;  1TFI A;  2PMZ A;  1N8R 2;  1K73 1;  1S72 Z;  3CCJ Z;  4E30 A;  1Q81 1;  4E33 A;  2F4M A;  1M1K 1;  1JJ2 Z;  4BBS I;  4NBG A;  1W2B Z;  2F4O A;  3J81 f;  4EWC A;  4A3I I;  2J6A A;  3S1N I;  1S72 1;  3CCJ 1;  3CME Z;  2GU2 A;  2E9H A;  3G71 Z;  1K8A 1;  1VQ6 Z;  3HOU I;  2R93 I;  2QRD B;  3CCS Z;  3MZK B;  1ZB9 A;  3HOZ I;  1Q81 2;  2NVT I;  1PFT A;  2DE6 A;  5FLX b;  1TWG I;  1M1K 2;  1YJ9 1;  3MZL B;  3H3V J;  1USP B;  1TWC I;  3CCE Z;  3S1R I;  1VQ6 1;  1DL6 A;  2LFU A;  1YUK A;  3D6W A;  4HGY A;  3MON A;  3CCS 1;  4BY7 I;  1VQL Z;  3FQQ A;  2OOY B;  4NBC A;  3T4N B;  1K8A 2;  1KQS Z;  1JWH C;  4A3G I;  3CCR Z;  1ML8 A;  2V8K A;  2EGT A;  3F3P C;  3CCL Z;  3HOV I;  4A3L I;  4A3J I;  2I3C A;  3KIH A;  4MH4 A;  3G6E Z;  3S14 I;  4A3D I;  3CCR 1;  3GCF A;  3I56 1;  3J80 b;  1VQM Z;  3CCL 1;  3GTJ I;  3BG0 B;  2JS4 A;  4MRI A;  5A2Q b;  1LQL A;  4MD9 A;  3G6E 1;  2NVQ I;  2O53 A;  1QVF Z;  3TDH B;  1VQM 1;  1WII A;  5LL6 f;  1P9N A;  2RIQ A;  3CPW Z;  4MD7 A;  2PK7 A;  4E2Y A;  4DGL A;  1VQK 1;  3FQM A;  4RS4 A;  3EER A;  3CD6 Z;  1W2B Y;  1YUA A;  3CCQ Z;  3RZD I;  1I6H I;  2RT9 A;  4Y52 I;  1RQF A;  2W03 A;  3NH8 A;  2IZ3 A;  3J81 b;  5AN9 F;  4XX2 A;  3Q87 A;  2JA5 I;  3QWU A;  3CXC Z;  1KD1 1;  1Y1W I;  2Y0S A;  3BG1 B;  2RBL A;  3LUS A;  5FLM I;  2RHB A;  2QLV B;  3CMA Z;  2JA8 I;  3CCU Z;  1QF8 A;  1RO4 A;  4HGZ A;  2OZK A;  2P28 A;  2K5R A;  2Q4Z A;  3CMA 1;  3GTG I;  3GTL I;  3CCU 1;  2WAQ A;  4RV9 A;  3I4M I;  3S15 I;  1Z03 A;  3NDI A;  1Q82 1;  1QVG Z;  2Q51 A;  1KD1 2;  2JR6 A;  5IP7 I;  3OW2 Z;  2DE7 A;  1K73 2;  4TNU A;  2ZAE B;  1VQO Z;  1VQ7 Z;  4MD8 A;  5D1O A;  3GTP I;  3CME 1;  2JA7 I;  3G71 1;  2OTL Z;  4A3M I;  3I07 A;  5D1P A;  1YHQ Z;  1VQO 1;  1X0T A;  1VQ9 Z;  2HF1 A;  4E31 A;  3S2D I;  2QRE B;  1Q82 2;  1KRL A;  1QVF Y;  3CCE 1;  1Z02 A;  3F3F C;  4CL1 A;  1I3Q I;  3VMG A;  1KC8 1;  2E2H I;  3NH4 A;  2BJO A;  2VF1 A;  1VQL 1;  3CPW Y;  2VUM I;  1YHQ 1;  3VB9 A;  2KI7 B;  2QKD A;  2R6M A;  2NVX I;  4DQY B;  1I50 I;  1NJI 1;  2JMO A;  3PO2 I;  1QYP A;  5C4X I;  1Y1V S;  3U50 C;  1S7M A;  3D9X A;  5T64 A;  1YJW Z;  4AYB A;  4E2X A;  2P3Y A;  2GTH A;  3IFU A;  1KC8 2;  4QTT A;  1Q86 1;  5IT9 f;  5C3E I;  3CCV Z;  1NUI A;  2HU9 A;  1NJI 2;  4S1T A;  1NP6 A;  1RO0 A;  4A3C I;  3M4O I;  1JJ2 Y;  1RLY A;  3NH5 A;  4NBB A;  3M3Y I;  4MON A;  3VTN A;  4NH1 C;  1TWA I;  1M90 1;  1TWH I;  4BBR I;  1RNI A;  3VMI A;  2YU9 I;  1Q86 2;  3CD6 1;  2QA4 Z;  4NB8 A;  3CCQ 1;  3EED A;  5A2Q f;  4X6A I;  3HOW I;  3I4N I;  3HOX I;  2IZ4 A;  1YI2 Z;  1YIJ Z;  1K83 I;  1VLA A;  2DE5 A;  5CM2 M;  3NDJ A;  1RO2 A;  2B63 I;  1Q7Y 1;  2OOX B;  2QRC B;  1M90 2;  1VQ8 Z;  2K3R A;  3CC4 Z;  1YIJ 1;  1ZB8 A;  1K9M 1;  1Z01 A;  3I55 Z;  3JAM f;  1X3W A;  3RZO I;  1KQS Y;  2LIY A;  2PM9 A;  2VUG A;  2R7Z I;  3IX0 A;  3S1M I;  3IF8 A;  5C4J I;  3FKI I;  1Y1V I;  3KIF A;  1TWF I;  5T67 A;  1VQ8 1;  3CC4 1;  4A3K I;  4RVD A;  4E2Z A;  3TE5 B;  3I55 1;  4RVF A;  3CCM Z;  3S1Q I;  1USP A;  1VQ5 Z;  1Q7Y 2;  2QEX Z;  2W04 A;  4QTU A;  1YJ9 Z;  1K9M 2;  2G2K A;  1N2F A;  2JUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...