5C4JI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4jI02
3GTGI 3I4MI 3GTOI 1N2FA 3S1RI 2KPIA 1SFOI 3S1NI 3H3VJ 2PK7A 3K7AI 1TWHI 3GTLI 1QYPA 3HOXI 1K83I 2JA8I 5CM2M 1Y1VI 3HOYI 2F4MA 3GTPI 1PFTA 2E2JI 4NBAA 4A3MI 4NBBA 2NVTI 3M4OI 3GTMS 3S1QI 1Y1WI 2JNYA 4NBEA 3GTJI 4BY1I 2NVXI 3VB9A 4A3GI 1ZB8A 2JA5I 4Y52I 1L1OC 4MH4A 2AKLA 1TWGI 3HOWI 1TWAI 3GTQI 2JS4A 2E2HI 4NBDA 2BJOA 2JA7I 5IP9I 4A3JI 1Y1VS 1DL6A 3FKII 4X6AI 4BBRI 1RLYA 3ESWA 3VMIA 1TWFI 3RZDI 4A3LI 3S14I 2DE5A 4BY7I 3S2DI 1ML8A 1YUAA 4A3EI 2NVQI 3HOUI 3HOZI 1RO4A 4NBGA 4BXXI 2RBLA 1ZB9A 1WCMI 3PO3I 1I6HI 3S2HI 4QTTA 1X3WA 2F4OA 1WW9A 1USPA 2R7ZI 5C4JI 3S15I 1TFIA 2DE6A 1I50I 1R9TI 3HOVI 3Q87A 2JA6I 3S16I 4BBSI 2E2II 5C44I 4A3DI 4A3KI 4NBHA 3H0GI 3U50C 1X3ZA 3EERA 2JR6A 5C4XI 1TWCI 4QTUA 4NB8A 1LQLA 3VMGA 3S17I 3M3YI 2YU9I 1USPB 3D6WA 2B63I 2VUMI 2HF1A 1VLAA 4XX2A 5IP7I 3VMHA 3S1MI 5FLMI 3GKQA 4A3CI 4NBCA 2P3YA 2DE7A 4NB9A 3GTKI 4A3BI 3I07A 2R93I 4NOZA 4A3FI 2R92I 3GCFA 2NVYI 1NUIA 2K5RA 4Y7NI 4A3II 4A93I 1I3QI 4NBFA 3PO3S 3PO2I 3RZOI 3GTMI 2J6AA 3I4NI 5C3EI 3CQZI 3LUSA
chains in the Genus database with same CATH superfamily
1KQSY 3GTGI 2KI7B 3JAMf 1N2FA 2G2KA 2GTHA 4RS4A 1Q812 3CC7Z 2QRDB 1Y1VI 3CCUZ 1YJ91 2F4MA 1VQ8Z 3I56Z 1Q861 4A3MI 4NBBA 3GTMS 2JNYA 4NBEA 3GTJI 1VQMZ 5A2Qf 3VB9A 1ZB8A 1L1OC 1TWGI 1VQ9Z 2RT9A 2JS4A 2V8IA 1YIT1 1Y1VS 3T4NB 4BBRI 2PMZA 3OW2Z 1RLYA 3KIHA 3S2DI 1ML8A 4EWCA 3CCSZ 4BXXI 1ZB9A 1WCMI 3PO3I 3CCRZ 5T67A 2VPWA 3F3FC 2R7ZI 1QF8A 3S15I 2DE6A 1I50I 3CCL1 1NJI1 3J81f 2GU2A 4E2WA 4E2XA 1ZH1A 1YJNZ 3CCM1 4NBHA 3U50C 3EERA 2JR6A 5AN9F 4CL1A 1TWCI 4NB8A 3M3YI 3CPWZ 3J80f 1N8R2 2JIMA 2NAPA 1Z03A 1VQNZ 1W2BY 2IV2X 3G6EZ 1YITZ 1Q16A 1S721 1NJI2 1K731 2IZ4A 3G4S1 4MD9A 2P3YA 2LEXA 1YIJZ 2R93I 2R92I 3KIFA 2NVYI 2K5RA 4A3II 3CMA1 2ZAEB 1I3QI 3D2LA 3PO2I 3LUSA 3CME1 2QEX1 2VF1A 3QWUA 2OTLZ 2LFUA 1WZNA 1RO0A 3I4MI 3CCLZ 1VQO1 1K9M1 3CC21 3CCV1 4RV9A 1K8A1 2KPIA 1K732 3NH5A 3CCMZ 2PK7A 3K7AI 1VQ51 1YI21 3HOXI 1K83I 2LIYA 5CM2M 2OTJZ 2JIRA 2M6NA 2E2JI 4NBAA 2OZKA 2NVTI 3M4OI 1Y1WI 1VQL1 2YADA 1JJ2Y 3BG1B 4MH4A 1VQ41 3D9XA 4NBDA 2OOYB 2BJOA 2JMOA 1S72Z 2VPYA 1VQ71 4A3JI 1DL6A 4E2ZA 5T64A 4E31A 3NDJA 1TWFI 3EEDA 3S14I 1QVFZ 1VQP1 1YHQZ 1RO4A 4QTTA 2QEXZ 1USPA 3TE5B 1TFIA 3CC2Z 3CCVZ 3Q87A 1VQ5Z 1YI2Z 3S16I 3CXCY 4A3KI 1QVGZ 3NDIA 3CD61 1X3ZA 3BG0B 1Q862 1VQLZ 1M1K1 2YU9I 5FLXb 1WJ2A 2B63I 2HF1A 3I551 4XX2A 3S1MI 2QR1B 1KRLA 5FLMI 4NBCA 3GTKI 2DE7A 5LL6f 3I07A 4NOZA 1YJ9Z 4A3FI 3GCFA 2VUGA 2QRCB 2V8JA 1JJ2Z 3HKZA 1M1K2 3PO3S 1KQSZ 1X0TA 5C3EI 4E32A 4MRIA 3S1RI 3IR7A 1SFOI 3S1NI 3NH8A 1TWHI 3GTLI 3MZKB 3CD6Z 3HOYI 1KD11 1WIIA 4NH1C 2QA41 3S1QI 1VQK1 4BY1I 2NVXI 3J80b 4A3GI 4Y52I 2AKLA 2JUBA 3CCQ1 2JA7I 3CXCZ 3FKII 3NFZA 3J7A4 2QLVB 3VMIA 3F3PC 3OW2Y 3RZDI 1VQ81 4BY7I 5IT9b 1P9NA 1FDIA 2I3CA 4A3EI 2NVQI 2AYDA 1M901 1VQM1 1Q821 2QKDA 4RVHA 4AYBA 3S2HI 2F4OA 1WW9A 1VQ91 1R9TI 2E9HA 1K9M2 1Q811 2JIQA 2JA6I 2VPZA 3G4SZ 1K8A2 1YUKA 4MONA 5C44I 3CCE1 2M48A 3CCJ1 1LQLA 3CMAZ 4E30A 2QA4Z 3S17I 2RPRA 3CCS1 1Q822 4HGZA 3D6WA 2IZ3A 3IX0A 4RVFA 3CPWY 3CCR1 1W2BZ 3CMEZ 3CC41 1Q7Y1 3CCQZ 4DQYB 1VQOZ 3JAMb 1YJW1 1RQFA 4TNUA 1NP6A 2Y0SA 3GKQA 3FQQA 2HU9A 5D1PA 4NB9A 2P28A 1YJN1 2Q4ZA 3TDHB 5FLXf 3MZLB 1AA6A 2J6AA 3I4NI 2WB1A 3CQZI 4A93I 1VQN1 1VQ4Z 3IFUA 5A2Qb 1Q7Y2 2V45A 2JIPA 3GTOI 1VQ61 1Z01A 1SIWA 4DK1A 3G6E1 4MXUA 1VQ7Z 3G711 3H3VJ 1QYPA 4NFRA 3CCEZ 1YIJ1 2JA8I 1RO2A 3GTPI 3CCJZ 1PFTA 1RNIA 5T6BA 1VQPZ 2V3VA 4S1TA 1N8R1 2Q51A 3FQMA 2JA5I 3CC4Z 2R6MA 2RIQA 2JIOA 3HOWI 1TWAI 3GTQI 2OTL1 2O4HA 2E2HI 3NH4A 1YJWZ 4MD8A 5IP9I 5D1OB 3VTNA 4X6AI 4E2YA 3J81b 2OTJ1 3ESWA 4A3LI 2DE5A 1QVFY 1YUAA 2RHBA 3HOUI 3HOZI 4NBGA 2RBLA 1I6HI 3I55Z 2OOXB 1X3WA 2VPXA 1VQ6Z 5C4JI 2PM9A 3HOVI 3G71Z 4RVGA 4BBSI 2E2II 4A3DI 3H0GI 2W03A 3CC71 5IT9f 1QVGY 1KD12 5C4XI 3CCU1 2GTIA 4HGYA 4QTUA 1FDOA 3I561 2W04A 3VMGA 3MONA 1YHQ1 1USPB 1JWHC 4RVDA 2VUMI 1VLAA 1KC81 3IF8A 5IP7I 1S7MA 3VMHA 2EGTA 2WAQA 2E7ZA 4DGLA 1QXFA 2H85A 4MD7A 4A3CI 4A3BI 3P5JB 2V8KA 5D1OA 4E33A 1NUIA 4Y7NI 2O53A 2QREB 1Z02A 4NBFA 1VQKZ 4HH4A 1M902 3RZOI 3GTMI 1Y8CA 2K3RA 1KC82
chains in the Genus database with same CATH topology
1KQSY 3GTGI 2KI7B 3JAMf 1N2FA 2G2KA 2GTHA 4RS4A 1Q812 3CC7Z 2QRDB 1Y1VI 3CCUZ 1YJ91 2F4MA 1VQ8Z 3I56Z 1Q861 4A3MI 4NBBA 3GTMS 2JNYA 4NBEA 3GTJI 1VQMZ 5A2Qf 3VB9A 1ZB8A 1L1OC 1TWGI 1VQ9Z 2RT9A 2JS4A 2V8IA 1YIT1 1Y1VS 3T4NB 4BBRI 2PMZA 3OW2Z 1RLYA 3KIHA 3S2DI 1ML8A 4EWCA 3CCSZ 4BXXI 1ZB9A 1WCMI 3PO3I 3CCRZ 5T67A 3F3FC 2R7ZI 1QF8A 3S15I 2DE6A 1I50I 3CCL1 1NJI1 3J81f 2GU2A 4E2WA 4E2XA 1ZH1A 1YJNZ 3CCM1 4NBHA 3U50C 3EERA 2JR6A 5AN9F 4CL1A 1TWCI 4NB8A 3M3YI 3CPWZ 3J80f 1N8R2 1Z03A 1VQNZ 1W2BY 3G6EZ 1YITZ 1S721 1NJI2 1K731 2IZ4A 3G4S1 4MD9A 2P3YA 1YIJZ 2R93I 2R92I 3KIFA 2NVYI 2K5RA 4A3II 3CMA1 2ZAEB 1I3QI 3PO2I 3LUSA 3CME1 2QEX1 2VF1A 3QWUA 2OTLZ 2LFUA 3I4MI 1RO0A 3CCLZ 1VQO1 1K9M1 3CC21 3CCV1 4RV9A 1K8A1 2KPIA 1K732 3NH5A 3CCMZ 2PK7A 3K7AI 1VQ51 1YI21 3HOXI 1K83I 2LIYA 5CM2M 2OTJZ 2M6NA 2E2JI 4NBAA 2OZKA 2NVTI 3M4OI 1Y1WI 1VQL1 2YADA 1JJ2Y 3BG1B 4MH4A 1VQ41 3D9XA 4NBDA 2OOYB 2BJOA 2JMOA 1S72Z 1VQ71 4A3JI 1DL6A 4E2ZA 5T64A 4E31A 3NDJA 1TWFI 3EEDA 3S14I 1QVFZ 1VQP1 1YHQZ 1RO4A 4QTTA 2QEXZ 1USPA 3TE5B 1TFIA 3CC2Z 3CCVZ 3Q87A 1VQ5Z 1YI2Z 3S16I 3CXCY 4A3KI 1QVGZ 3NDIA 3CD61 1X3ZA 3BG0B 1Q862 1VQLZ 1M1K1 2YU9I 5FLXb 2B63I 2HF1A 3I551 4XX2A 3S1MI 2QR1B 1KRLA 5FLMI 4NBCA 3GTKI 2DE7A 5LL6f 3I07A 4NOZA 1YJ9Z 4A3FI 3GCFA 2VUGA 2QRCB 2V8JA 1JJ2Z 3HKZA 1M1K2 3PO3S 1KQSZ 1X0TA 5C3EI 4E32A 4MRIA 3S1RI 1SFOI 3S1NI 3NH8A 1TWHI 3GTLI 3MZKB 3CD6Z 3HOYI 1KD11 1WIIA 4NH1C 2QA41 3S1QI 1VQK1 4BY1I 2NVXI 3J80b 4A3GI 4Y52I 2AKLA 2JUBA 3CCQ1 2JA7I 3CXCZ 3FKII 3NFZA 3J7A4 2QLVB 3VMIA 3F3PC 3OW2Y 3RZDI 1VQ81 4BY7I 5IT9b 1P9NA 2I3CA 4A3EI 2NVQI 1M901 1VQM1 1Q821 2QKDA 4RVHA 4AYBA 3S2HI 2F4OA 1WW9A 1VQ91 1R9TI 2E9HA 1K9M2 1Q811 2JA6I 3G4SZ 1K8A2 1YUKA 4MONA 5C44I 3CCE1 2M48A 3CCJ1 1LQLA 3CMAZ 4E30A 2QA4Z 3S17I 2RPRA 3CCS1 1Q822 4HGZA 3D6WA 2IZ3A 3IX0A 4RVFA 3CPWY 3CCR1 1W2BZ 3CMEZ 3CC41 1Q7Y1 3CCQZ 4DQYB 1VQOZ 3JAMb 1YJW1 1RQFA 4TNUA 1NP6A 2Y0SA 3GKQA 3FQQA 2HU9A 5D1PA 4NB9A 2P28A 1YJN1 2Q4ZA 3TDHB 5FLXf 3MZLB 2J6AA 3I4NI 2WB1A 3CQZI 4A93I 1VQN1 1VQ4Z 3IFUA 5A2Qb 1Q7Y2 3GTOI 1VQ61 1Z01A 3G6E1 4DK1A 4MXUA 1VQ7Z 3G711 3H3VJ 1QYPA 4NFRA 3CCEZ 1YIJ1 2JA8I 1RO2A 3GTPI 3CCJZ 1PFTA 1RNIA 5T6BA 1VQPZ 4S1TA 1N8R1 2Q51A 3FQMA 2JA5I 3CC4Z 2R6MA 2RIQA 3HOWI 1TWAI 3GTQI 2OTL1 2O4HA 2E2HI 3NH4A 1YJWZ 4MD8A 5IP9I 5D1OB 3VTNA 4X6AI 4E2YA 3J81b 2OTJ1 3ESWA 4A3LI 2DE5A 1QVFY 1YUAA 2RHBA 3HOUI 3HOZI 4NBGA 2RBLA 1I6HI 3I55Z 2OOXB 1X3WA 1VQ6Z 5C4JI 2PM9A 3HOVI 3G71Z 4RVGA 4BBSI 2E2II 4A3DI 3H0GI 2W03A 3CC71 5IT9f 1QVGY 1KD12 5C4XI 3CCU1 2GTIA 4HGYA 4QTUA 3I561 2W04A 3VMGA 3MONA 1YHQ1 1USPB 1JWHC 4RVDA 2VUMI 1VLAA 1KC81 3IF8A 5IP7I 1S7MA 3VMHA 2EGTA 2WAQA 4DGLA 2H85A 4MD7A 4A3CI 4A3BI 3P5JB 2V8KA 5D1OA 4E33A 1NUIA 4Y7NI 2O53A 2QREB 1Z02A 4NBFA 1VQKZ 4HH4A 1M902 3RZOI 3GTMI 2K3RA 1KC82
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG I;  3I4M I;  3GTO I;  1N2F A;  3S1R I;  2KPI A;  1SFO I;  3S1N I;  3H3V J;  2PK7 A;  3K7A I;  1TWH I;  3GTL I;  1QYP A;  3HOX I;  1K83 I;  2JA8 I;  5CM2 M;  1Y1V I;  3HOY I;  2F4M A;  3GTP I;  1PFT A;  2E2J I;  4NBA A;  4A3M I;  4NBB A;  2NVT I;  3M4O I;  3GTM S;  3S1Q I;  1Y1W I;  2JNY A;  4NBE A;  3GTJ I;  4BY1 I;  2NVX I;  3VB9 A;  4A3G I;  1ZB8 A;  2JA5 I;  4Y52 I;  1L1O C;  4MH4 A;  2AKL A;  1TWG I;  3HOW I;  1TWA I;  3GTQ I;  2JS4 A;  2E2H I;  4NBD A;  2BJO A;  2JA7 I;  5IP9 I;  4A3J I;  1Y1V S;  1DL6 A;  3FKI I;  4X6A I;  4BBR I;  1RLY A;  3ESW A;  3VMI A;  1TWF I;  3RZD I;  4A3L I;  3S14 I;  2DE5 A;  4BY7 I;  3S2D I;  1ML8 A;  1YUA A;  4A3E I;  2NVQ I;  3HOU I;  3HOZ I;  1RO4 A;  4NBG A;  4BXX I;  2RBL A;  1ZB9 A;  1WCM I;  3PO3 I;  1I6H I;  3S2H I;  4QTT A;  1X3W A;  2F4O A;  1WW9 A;  1USP A;  2R7Z I;  5C4J I;  3S15 I;  1TFI A;  2DE6 A;  1I50 I;  1R9T I;  3HOV I;  3Q87 A;  2JA6 I;  3S16 I;  4BBS I;  2E2I I;  5C44 I;  4A3D I;  4A3K I;  4NBH A;  3H0G I;  3U50 C;  1X3Z A;  3EER A;  2JR6 A;  5C4X I;  1TWC I;  4QTU A;  4NB8 A;  1LQL A;  3VMG A;  3S17 I;  3M3Y I;  2YU9 I;  1USP B;  3D6W A;  2B63 I;  2VUM I;  2HF1 A;  1VLA A;  4XX2 A;  5IP7 I;  3VMH A;  3S1M I;  5FLM I;  3GKQ A;  4A3C I;  4NBC A;  2P3Y A;  2DE7 A;  4NB9 A;  3GTK I;  4A3B I;  3I07 A;  2R93 I;  4NOZ A;  4A3F I;  2R92 I;  3GCF A;  2NVY I;  1NUI A;  2K5R A;  4Y7N I;  4A3I I;  4A93 I;  1I3Q I;  4NBF A;  3PO3 S;  3PO2 I;  3RZO I;  3GTM I;  2J6A A;  3I4N I;  5C3E I;  3CQZ I;  3LUS A; 
#chains in the Genus database with same CATH topology
 1KQS Y;  3GTG I;  2KI7 B;  3JAM f;  1N2F A;  2G2K A;  2GTH A;  4RS4 A;  1Q81 2;  3CC7 Z;  2QRD B;  1Y1V I;  3CCU Z;  1YJ9 1;  2F4M A;  1VQ8 Z;  3I56 Z;  1Q86 1;  4A3M I;  4NBB A;  3GTM S;  2JNY A;  4NBE A;  3GTJ I;  1VQM Z;  5A2Q f;  3VB9 A;  1ZB8 A;  1L1O C;  1TWG I;  1VQ9 Z;  2RT9 A;  2JS4 A;  2V8I A;  1YIT 1;  1Y1V S;  3T4N B;  4BBR I;  2PMZ A;  3OW2 Z;  1RLY A;  3KIH A;  3S2D I;  1ML8 A;  4EWC A;  3CCS Z;  4BXX I;  1ZB9 A;  1WCM I;  3PO3 I;  3CCR Z;  5T67 A;  2VPW A;  3F3F C;  2R7Z I;  1QF8 A;  3S15 I;  2DE6 A;  1I50 I;  3CCL 1;  1NJI 1;  3J81 f;  2GU2 A;  4E2W A;  4E2X A;  1ZH1 A;  1YJN Z;  3CCM 1;  4NBH A;  3U50 C;  3EER A;  2JR6 A;  5AN9 F;  4CL1 A;  1TWC I;  4NB8 A;  3M3Y I;  3CPW Z;  3J80 f;  1N8R 2;  2JIM A;  2NAP A;  1Z03 A;  1VQN Z;  1W2B Y;  2IV2 X;  3G6E Z;  1YIT Z;  1Q16 A;  1S72 1;  1NJI 2;  1K73 1;  2IZ4 A;  3G4S 1;  4MD9 A;  2P3Y A;  2LEX A;  1YIJ Z;  2R93 I;  2R92 I;  3KIF A;  2NVY I;  2K5R A;  4A3I I;  3CMA 1;  2ZAE B;  1I3Q I;  3D2L A;  3PO2 I;  3LUS A;  3CME 1;  2QEX 1;  2VF1 A;  3QWU A;  2OTL Z;  2LFU A;  1WZN A;  1RO0 A;  3I4M I;  3CCL Z;  1VQO 1;  1K9M 1;  3CC2 1;  3CCV 1;  4RV9 A;  1K8A 1;  2KPI A;  1K73 2;  3NH5 A;  3CCM Z;  2PK7 A;  3K7A I;  1VQ5 1;  1YI2 1;  3HOX I;  1K83 I;  2LIY A;  5CM2 M;  2OTJ Z;  2JIR A;  2M6N A;  2E2J I;  4NBA A;  2OZK A;  2NVT I;  3M4O I;  1Y1W I;  1VQL 1;  2YAD A;  1JJ2 Y;  3BG1 B;  4MH4 A;  1VQ4 1;  3D9X A;  4NBD A;  2OOY B;  2BJO A;  2JMO A;  1S72 Z;  2VPY A;  1VQ7 1;  4A3J I;  1DL6 A;  4E2Z A;  5T64 A;  4E31 A;  3NDJ A;  1TWF I;  3EED A;  3S14 I;  1QVF Z;  1VQP 1;  1YHQ Z;  1RO4 A;  4QTT A;  2QEX Z;  1USP A;  3TE5 B;  1TFI A;  3CC2 Z;  3CCV Z;  3Q87 A;  1VQ5 Z;  1YI2 Z;  3S16 I;  3CXC Y;  4A3K I;  1QVG Z;  3NDI A;  3CD6 1;  1X3Z A;  3BG0 B;  1Q86 2;  1VQL Z;  1M1K 1;  2YU9 I;  5FLX b;  1WJ2 A;  2B63 I;  2HF1 A;  3I55 1;  4XX2 A;  3S1M I;  2QR1 B;  1KRL A;  5FLM I;  4NBC A;  3GTK I;  2DE7 A;  5LL6 f;  3I07 A;  4NOZ A;  1YJ9 Z;  4A3F I;  3GCF A;  2VUG A;  2QRC B;  2V8J A;  1JJ2 Z;  3HKZ A;  1M1K 2;  3PO3 S;  1KQS Z;  1X0T A;  5C3E I;  4E32 A;  4MRI A;  3S1R I;  3IR7 A;  1SFO I;  3S1N I;  3NH8 A;  1TWH I;  3GTL I;  3MZK B;  3CD6 Z;  3HOY I;  1KD1 1;  1WII A;  4NH1 C;  2QA4 1;  3S1Q I;  1VQK 1;  4BY1 I;  2NVX I;  3J80 b;  4A3G I;  4Y52 I;  2AKL A;  2JUB A;  3CCQ 1;  2JA7 I;  3CXC Z;  3FKI I;  3NFZ A;  3J7A 4;  2QLV B;  3VMI A;  3F3P C;  3OW2 Y;  3RZD I;  1VQ8 1;  4BY7 I;  5IT9 b;  1P9N A;  1FDI A;  2I3C A;  4A3E I;  2NVQ I;  2AYD A;  1M90 1;  1VQM 1;  1Q82 1;  2QKD A;  4RVH A;  4AYB A;  3S2H I;  2F4O A;  1WW9 A;  1VQ9 1;  1R9T I;  2E9H A;  1K9M 2;  1Q81 1;  2JIQ A;  2JA6 I;  2VPZ A;  3G4S Z;  1K8A 2;  1YUK A;  4MON A;  5C44 I;  3CCE 1;  2M48 A;  3CCJ 1;  1LQL A;  3CMA Z;  4E30 A;  2QA4 Z;  3S17 I;  2RPR A;  3CCS 1;  1Q82 2;  4HGZ A;  3D6W A;  2IZ3 A;  3IX0 A;  4RVF A;  3CPW Y;  3CCR 1;  1W2B Z;  3CME Z;  3CC4 1;  1Q7Y 1;  3CCQ Z;  4DQY B;  1VQO Z;  3JAM b;  1YJW 1;  1RQF A;  4TNU A;  1NP6 A;  2Y0S A;  3GKQ A;  3FQQ A;  2HU9 A;  5D1P A;  4NB9 A;  2P28 A;  1YJN 1;  2Q4Z A;  3TDH B;  5FLX f;  3MZL B;  1AA6 A;  2J6A A;  3I4N I;  2WB1 A;  3CQZ I;  4A93 I;  1VQN 1;  1VQ4 Z;  3IFU A;  5A2Q b;  1Q7Y 2;  2V45 A;  2JIP A;  3GTO I;  1VQ6 1;  1Z01 A;  1SIW A;  4DK1 A;  3G6E 1;  4MXU A;  1VQ7 Z;  3G71 1;  3H3V J;  1QYP A;  4NFR A;  3CCE Z;  1YIJ 1;  2JA8 I;  1RO2 A;  3GTP I;  3CCJ Z;  1PFT A;  1RNI A;  5T6B A;  1VQP Z;  2V3V A;  4S1T A;  1N8R 1;  2Q51 A;  3FQM A;  2JA5 I;  3CC4 Z;  2R6M A;  2RIQ A;  2JIO A;  3HOW I;  1TWA I;  3GTQ I;  2OTL 1;  2O4H A;  2E2H I;  3NH4 A;  1YJW Z;  4MD8 A;  5IP9 I;  5D1O B;  3VTN A;  4X6A I;  4E2Y A;  3J81 b;  2OTJ 1;  3ESW A;  4A3L I;  2DE5 A;  1QVF Y;  1YUA A;  2RHB A;  3HOU I;  3HOZ I;  4NBG A;  2RBL A;  1I6H I;  3I55 Z;  2OOX B;  1X3W A;  2VPX A;  1VQ6 Z;  5C4J I;  2PM9 A;  3HOV I;  3G71 Z;  4RVG A;  4BBS I;  2E2I I;  4A3D I;  3H0G I;  2W03 A;  3CC7 1;  5IT9 f;  1QVG Y;  1KD1 2;  5C4X I;  3CCU 1;  2GTI A;  4HGY A;  4QTU A;  1FDO A;  3I56 1;  2W04 A;  3VMG A;  3MON A;  1YHQ 1;  1USP B;  1JWH C;  4RVD A;  2VUM I;  1VLA A;  1KC8 1;  3IF8 A;  5IP7 I;  1S7M A;  3VMH A;  2EGT A;  2WAQ A;  2E7Z A;  4DGL A;  1QXF A;  2H85 A;  4MD7 A;  4A3C I;  4A3B I;  3P5J B;  2V8K A;  5D1O A;  4E33 A;  1NUI A;  4Y7N I;  2O53 A;  2QRE B;  1Z02 A;  4NBF A;  1VQK Z;  4HH4 A;  1M90 2;  3RZO I;  3GTM I;  1Y8C A;  2K3R A;  1KC8 2; 
#chains in the Genus database with same CATH homology
 1KQS Y;  3GTG I;  2KI7 B;  3JAM f;  1N2F A;  2G2K A;  2GTH A;  4RS4 A;  1Q81 2;  3CC7 Z;  2QRD B;  1Y1V I;  3CCU Z;  1YJ9 1;  2F4M A;  1VQ8 Z;  3I56 Z;  1Q86 1;  4A3M I;  4NBB A;  3GTM S;  2JNY A;  4NBE A;  3GTJ I;  1VQM Z;  5A2Q f;  3VB9 A;  1ZB8 A;  1L1O C;  1TWG I;  1VQ9 Z;  2RT9 A;  2JS4 A;  2V8I A;  1YIT 1;  1Y1V S;  3T4N B;  4BBR I;  2PMZ A;  3OW2 Z;  1RLY A;  3KIH A;  3S2D I;  1ML8 A;  4EWC A;  3CCS Z;  4BXX I;  1ZB9 A;  1WCM I;  3PO3 I;  3CCR Z;  5T67 A;  3F3F C;  2R7Z I;  1QF8 A;  3S15 I;  2DE6 A;  1I50 I;  3CCL 1;  1NJI 1;  3J81 f;  2GU2 A;  4E2W A;  4E2X A;  1ZH1 A;  1YJN Z;  3CCM 1;  4NBH A;  3U50 C;  3EER A;  2JR6 A;  5AN9 F;  4CL1 A;  1TWC I;  4NB8 A;  3M3Y I;  3CPW Z;  3J80 f;  1N8R 2;  1Z03 A;  1VQN Z;  1W2B Y;  3G6E Z;  1YIT Z;  1S72 1;  1NJI 2;  1K73 1;  2IZ4 A;  3G4S 1;  4MD9 A;  2P3Y A;  1YIJ Z;  2R93 I;  2R92 I;  3KIF A;  2NVY I;  2K5R A;  4A3I I;  3CMA 1;  2ZAE B;  1I3Q I;  3PO2 I;  3LUS A;  3CME 1;  2QEX 1;  2VF1 A;  3QWU A;  2OTL Z;  2LFU A;  3I4M I;  1RO0 A;  3CCL Z;  1VQO 1;  1K9M 1;  3CC2 1;  3CCV 1;  4RV9 A;  1K8A 1;  2KPI A;  1K73 2;  3NH5 A;  3CCM Z;  2PK7 A;  3K7A I;  1VQ5 1;  1YI2 1;  3HOX I;  1K83 I;  2LIY A;  5CM2 M;  2OTJ Z;  2M6N A;  2E2J I;  4NBA A;  2OZK A;  2NVT I;  3M4O I;  1Y1W I;  1VQL 1;  2YAD A;  1JJ2 Y;  3BG1 B;  4MH4 A;  1VQ4 1;  3D9X A;  4NBD A;  2OOY B;  2BJO A;  2JMO A;  1S72 Z;  1VQ7 1;  4A3J I;  1DL6 A;  4E2Z A;  5T64 A;  4E31 A;  3NDJ A;  1TWF I;  3EED A;  3S14 I;  1QVF Z;  1VQP 1;  1YHQ Z;  1RO4 A;  4QTT A;  2QEX Z;  1USP A;  3TE5 B;  1TFI A;  3CC2 Z;  3CCV Z;  3Q87 A;  1VQ5 Z;  1YI2 Z;  3S16 I;  3CXC Y;  4A3K I;  1QVG Z;  3NDI A;  3CD6 1;  1X3Z A;  3BG0 B;  1Q86 2;  1VQL Z;  1M1K 1;  2YU9 I;  5FLX b;  2B63 I;  2HF1 A;  3I55 1;  4XX2 A;  3S1M I;  2QR1 B;  1KRL A;  5FLM I;  4NBC A;  3GTK I;  2DE7 A;  5LL6 f;  3I07 A;  4NOZ A;  1YJ9 Z;  4A3F I;  3GCF A;  2VUG A;  2QRC B;  2V8J A;  1JJ2 Z;  3HKZ A;  1M1K 2;  3PO3 S;  1KQS Z;  1X0T A;  5C3E I;  4E32 A;  4MRI A;  3S1R I;  1SFO I;  3S1N I;  3NH8 A;  1TWH I;  3GTL I;  3MZK B;  3CD6 Z;  3HOY I;  1KD1 1;  1WII A;  4NH1 C;  2QA4 1;  3S1Q I;  1VQK 1;  4BY1 I;  2NVX I;  3J80 b;  4A3G I;  4Y52 I;  2AKL A;  2JUB A;  3CCQ 1;  2JA7 I;  3CXC Z;  3FKI I;  3NFZ A;  3J7A 4;  2QLV B;  3VMI A;  3F3P C;  3OW2 Y;  3RZD I;  1VQ8 1;  4BY7 I;  5IT9 b;  1P9N A;  2I3C A;  4A3E I;  2NVQ I;  1M90 1;  1VQM 1;  1Q82 1;  2QKD A;  4RVH A;  4AYB A;  3S2H I;  2F4O A;  1WW9 A;  1VQ9 1;  1R9T I;  2E9H A;  1K9M 2;  1Q81 1;  2JA6 I;  3G4S Z;  1K8A 2;  1YUK A;  4MON A;  5C44 I;  3CCE 1;  2M48 A;  3CCJ 1;  1LQL A;  3CMA Z;  4E30 A;  2QA4 Z;  3S17 I;  2RPR A;  3CCS 1;  1Q82 2;  4HGZ A;  3D6W A;  2IZ3 A;  3IX0 A;  4RVF A;  3CPW Y;  3CCR 1;  1W2B Z;  3CME Z;  3CC4 1;  1Q7Y 1;  3CCQ Z;  4DQY B;  1VQO Z;  3JAM b;  1YJW 1;  1RQF A;  4TNU A;  1NP6 A;  2Y0S A;  3GKQ A;  3FQQ A;  2HU9 A;  5D1P A;  4NB9 A;  2P28 A;  1YJN 1;  2Q4Z A;  3TDH B;  5FLX f;  3MZL B;  2J6A A;  3I4N I;  2WB1 A;  3CQZ I;  4A93 I;  1VQN 1;  1VQ4 Z;  3IFU A;  5A2Q b;  1Q7Y 2;  3GTO I;  1VQ6 1;  1Z01 A;  3G6E 1;  4DK1 A;  4MXU A;  1VQ7 Z;  3G71 1;  3H3V J;  1QYP A;  4NFR A;  3CCE Z;  1YIJ 1;  2JA8 I;  1RO2 A;  3GTP I;  3CCJ Z;  1PFT A;  1RNI A;  5T6B A;  1VQP Z;  4S1T A;  1N8R 1;  2Q51 A;  3FQM A;  2JA5 I;  3CC4 Z;  2R6M A;  2RIQ A;  3HOW I;  1TWA I;  3GTQ I;  2OTL 1;  2O4H A;  2E2H I;  3NH4 A;  1YJW Z;  4MD8 A;  5IP9 I;  5D1O B;  3VTN A;  4X6A I;  4E2Y A;  3J81 b;  2OTJ 1;  3ESW A;  4A3L I;  2DE5 A;  1QVF Y;  1YUA A;  2RHB A;  3HOU I;  3HOZ I;  4NBG A;  2RBL A;  1I6H I;  3I55 Z;  2OOX B;  1X3W A;  1VQ6 Z;  5C4J I;  2PM9 A;  3HOV I;  3G71 Z;  4RVG A;  4BBS I;  2E2I I;  4A3D I;  3H0G I;  2W03 A;  3CC7 1;  5IT9 f;  1QVG Y;  1KD1 2;  5C4X I;  3CCU 1;  2GTI A;  4HGY A;  4QTU A;  3I56 1;  2W04 A;  3VMG A;  3MON A;  1YHQ 1;  1USP B;  1JWH C;  4RVD A;  2VUM I;  1VLA A;  1KC8 1;  3IF8 A;  5IP7 I;  1S7M A;  3VMH A;  2EGT A;  2WAQ A;  4DGL A;  2H85 A;  4MD7 A;  4A3C I;  4A3B I;  3P5J B;  2V8K A;  5D1O A;  4E33 A;  1NUI A;  4Y7N I;  2O53 A;  2QRE B;  1Z02 A;  4NBF A;  1VQK Z;  4HH4 A;  1M90 2;  3RZO I;  3GTM I;  2K3R A;  1KC8 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...