5C4JI

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4jI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5c4jI02
1TWFI 5C3EI 4A3II 4NBDA 2DE7A 2JA7I 3HOYI 4Y52I 2R92I 3VMIA 2E2HI 5C44I 1TWGI 1PFTA 2DE6A 3LUSA 3GTGI 1VLAA 1Y1VS 3S16I 4A3JI 4A3EI 4A3LI 1QYPA 3FKII 1SFOI 4A93I 2F4MA 4A3DI 2JR6A 4NBAA 1L1OC 1DL6A 3H3VJ 3VB9A 4Y7NI 4BXXI 1ML8A 1USPA 1N2FA 3PO3S 2AKLA 3GTKI 3HOWI 3PO2I 2R7ZI 3U50C 3S1MI 4X6AI 2B63I 1TFIA 2KPIA 5C4XI 3S1NI 3EERA 4XX2A 5CM2M 1X3WA 1TWCI 2BJOA 2JA5I 2E2JI 4A3FI 2JNYA 2NVQI 1Y1WI 2PK7A 2J6AA 4A3MI 4QTUA 4NB9A 3HOXI 1WW9A 3Q87A 4NBHA 1X3ZA 2VUMI 2DE5A 2NVXI 1RO4A 4NBFA 3S1QI 1TWHI 3VMHA 1YUAA 4NBEA 4BBRI 2JA8I 3I4MI 2YU9I 3S15I 5IP7I 2P3YA 2NVYI 3H0GI 4A3GI 2E2II 2NVTI 4NBBA 3GTJI 3PO3I 1ZB8A 4BY7I 4QTTA 1I6HI 1LQLA 2R93I 3GCFA 1RLYA 3GTMI 3S2DI 4BBSI 4NOZA 3D6WA 3M4OI 5IP9I 3I4NI 3S2HI 2HF1A 3GTLI 4A3BI 3GTOI 1TWAI 1Y1VI 3S17I 3CQZI 2RBLA 3VMGA 4NBGA 1NUIA 3GKQA 1I3QI 2F4OA 4NBCA 4BY1I 3GTQI 3HOVI 3HOUI 1ZB9A 1K83I 3S14I 3RZDI 1R9TI 2JS4A 3S1RI 3I07A 3GTPI 3RZOI 1I50I 4MH4A 3ESWA 5C4JI 4A3KI 1USPB 3M3YI 2JA6I 4NB8A 3K7AI 4A3CI 3GTMS 2K5RA 3HOZI 5FLMI 1WCMI
chains in the Genus database with same CATH superfamily
1VQOZ 4NBDA 2DE7A 1KC81 2K3RA 2V8KA 1PFTA 1Y1VS 1RO2A 4MONA 3CCQZ 3J80f 3FKII 2Q51A 3VTNA 4NBAA 1QVGY 1KQSZ 3JAMb 1Q822 1RQFA 2NAPA 1DL6A 3VB9A 3MZLB 1ML8A 3G4S1 3GTKI 3PO2I 1QVFY 1RO0A 5A2Qb 1YJNZ 3G71Z 4X6AI 2QLVB 4RVGA 3CCL1 2JUBA 2M48A 5C4XI 3CPWY 3CD6Z 3P5JB 4DQYB 4E2WA 2RHBA 2BJOA 3NH8A 2J6AA 4HGYA 3CCJZ 4QTUA 3NH4A 1Z02A 1QF8A 1N8R1 3HOXI 2QR1B 1VQ91 3J80b 1X3ZA 1JWHC 2GTHA 3CCU1 3CC21 2V45A 1YUAA 1WIIA 1K9M2 1YJWZ 2JA8I 2E9HA 3I56Z 2P3YA 3OW2Z 2E2II 2NVTI 2QRCB 3GTJI 3CCMZ 1M901 1Q862 1S7MA 1VQNZ 1VQ4Z 2VPWA 3S2DI 2RIQA 2OTL1 4NOZA 2QEXZ 1FDIA 4E30A 3CC4Z 2LIYA 3GTLI 4A3BI 4HGZA 3CCV1 1AA6A 2JIRA 1KD11 3GTOI 1TWAI 2PMZA 3CQZI 5T6BA 2RBLA 4NBGA 3I4MI 2F4OA 4BY1I 3GTQI 1ZB9A 2W03A 3RZDI 3IF8A 2QKDA 2JS4A 2RT9A 3RZOI 3EEDA 1I50I 3CCS1 3ESWA 3CXCZ 4MD9A 1VQK1 3MONA 3K7AI 3CCE1 4A3CI 3GTMS 3G4SZ 5FLMI 2P28A 1YJ91 2H85A 4Y52I 2WAQA 1KC82 1TWGI 2E2HI 1VLAA 3CCLZ 4A3EI 1VQL1 1VQ51 1SFOI 2JR6A 1YI21 4BXXI 2OTJ1 1N2FA 1VQ71 4RS4A 4E2ZA 4MXUA 2R7ZI 3D9XA 4HH4A 1VQ9Z 3U50C 3CCUZ 2Y0SA 2KPIA 2JIOA 3CC2Z 1Q7Y1 1VQP1 4XX2A 3F3FC 1TWCI 3KIHA 3T4NB 2E2JI 2JA5I 2VUGA 2PK7A 3MZKB 2GU2A 3NFZA 4E2YA 2VUMI 2OTLZ 1RO4A 2V3VA 3VMHA 2V8IA 4BBRI 2YU9I 3S15I 3CCVZ 2OOXB 1S721 1Q812 3CMA1 4MD8A 2R6MA 2ZAEB 1ZB8A 1Z01A 4QTTA 1LQLA 2R93I 3CCSZ 3GCFA 4BBSI 1K8A1 1VQKZ 5T67A 2GTIA 3M4OI 2JIPA 2OZKA 1W2BZ 1YIT1 2IZ3A 3CCEZ 1Q16A 3TE5B 1ZH1A 4E31A 1Y1VI 3CCR1 1X0TA 1KD12 5T64A 3J81f 1YJ9Z 3GKQA 1NUIA 3HOVI 3S14I 1JJ2Y 1WZNA 3I07A 4MH4A 1Q821 4RVFA 5C4JI 1VQLZ 1P9NA 3G6E1 4A3KI 1VQ5Z 3M3YI 1M1K1 2JA6I 2HU9A 1YI2Z 2OTJZ 1K732 1VQ7Z 2QREB 1TWFI 4A3II 2VF1A 4TNUA 3HOYI 3NDJA 1KQSY 2IV2X 3S16I 3GTGI 3IR7A 4NH1C 1YHQ1 1VQPZ 4A3LI 1QYPA 3CME1 4A93I 2F4MA 2AYDA 4A3DI 4E33A 1Z03A 1NJI1 3HKZA 1YIJ1 1FDOA 3H3VJ 3PO3S 2VPYA 2PM9A 3HOWI 2Q4ZA 3S1MI 5D1PA 1QVGZ 1TFIA 5IT9f 3S1NI 3EERA 3BG1B 5CM2M 1Q7Y2 4E32A 1QVFZ 1X3WA 4AYBA 2LEXA 2JNYA 1S72Z 1SIWA 3NH5A 3CMAZ 2W04A 3CPWZ 2IZ4A 1WW9A 3Q87A 1KRLA 5AN9F 3OW2Y 2NVXI 2G2KA 3S1QI 1RNIA 2RPRA 1TWHI 3F3PC 1YITZ 1VQ61 3JAMf 3TDHB 2NVYI 3H0GI 4A3GI 3CCRZ 5A2Qf 2YADA 4NBBA 4E2XA 1VQM1 3PO3I 5IT9b 3CC71 1I6HI 5LL6f 5D1OA 1RLYA 1N8R2 2KI7B 3GTMI 3G6EZ 3NDIA 5IP9I 4DK1A 2HF1A 3S17I 2WB1A 2M6NA 3CXCY 1I3QI 4NBCA 1Y8CA 1K83I 2VPZA 2VPXA 1R9TI 3D2LA 1YHQZ 4RVHA 3I551 1M902 1NP6A 3CMEZ 4NB8A 1YIJZ 1M1K2 1QXFA 3IX0A 2K5RA 2QA41 4CL1A 5C3EI 4NFRA 2JA7I 4S1TA 2R92I 3VMIA 5C44I 2DE6A 3LUSA 4RVDA 4A3JI 2O53A 2O4HA 3QWUA 4RV9A 1L1OC 1NJI2 2JIQA 4Y7NI 1USPA 2AKLA 1VQ81 1VQO1 2OOYB 2B63I 4DGLA 1Q811 3CCQ1 2V8JA 1VQ6Z 4A3FI 2NVQI 1Y1WI 4A3MI 4NB9A 3IFUA 5D1OB 4MD7A 1VQMZ 3J81b 3CC7Z 1YJN1 4NBHA 3G711 2DE5A 2JMOA 4NBFA 3CD61 3J7A4 1K9M1 5FLXf 4NBEA 2E7ZA 5IP7I 2JIMA 4EWCA 3FQQA 3CCJ1 1WJ2A 1Q861 1W2BY 2EGTA 4BY7I 3I55Z 3D6WA 1K731 3S2HI 3I4NI 2LFUA 1YJW1 4MRIA 3I561 2QA4Z 3FQMA 3VMGA 3HOUI 3CCM1 1VQN1 2QRDB 3S1RI 3GTPI 1VQ41 5FLXb 2QEX1 3BG0B 1USPB 3KIFA 3CC41 1JJ2Z 2I3CA 1K8A2 1YUKA 3HOZI 1VQ8Z 1WCMI
chains in the Genus database with same CATH topology
1VQOZ 4NBDA 2DE7A 1KC81 2K3RA 2V8KA 1PFTA 1Y1VS 1RO2A 4MONA 3CCQZ 3J80f 3FKII 2Q51A 3VTNA 4NBAA 1QVGY 1KQSZ 3JAMb 1Q822 1RQFA 1DL6A 3VB9A 3MZLB 1ML8A 3G4S1 3GTKI 3PO2I 1QVFY 1RO0A 5A2Qb 1YJNZ 3G71Z 4X6AI 2QLVB 4RVGA 3CCL1 2JUBA 2M48A 5C4XI 3CPWY 3CD6Z 3P5JB 4DQYB 4E2WA 2RHBA 2BJOA 3NH8A 2J6AA 4HGYA 3CCJZ 4QTUA 3NH4A 1Z02A 1QF8A 1N8R1 3HOXI 2QR1B 1VQ91 3J80b 1X3ZA 1JWHC 2GTHA 3CCU1 3CC21 1YUAA 1WIIA 1K9M2 1YJWZ 2JA8I 2E9HA 3I56Z 2P3YA 3OW2Z 2E2II 2NVTI 2QRCB 3GTJI 3CCMZ 1M901 1Q862 1S7MA 1VQNZ 1VQ4Z 3S2DI 2RIQA 2OTL1 4NOZA 2QEXZ 4E30A 3CC4Z 2LIYA 3GTLI 4A3BI 4HGZA 3CCV1 1KD11 3GTOI 1TWAI 2PMZA 3CQZI 5T6BA 2RBLA 4NBGA 3I4MI 2F4OA 4BY1I 3GTQI 1ZB9A 2W03A 3RZDI 3IF8A 2QKDA 2JS4A 2RT9A 3RZOI 3EEDA 1I50I 3CCS1 3ESWA 3CXCZ 4MD9A 1VQK1 3MONA 3K7AI 3CCE1 4A3CI 3GTMS 3G4SZ 5FLMI 2P28A 1YJ91 2H85A 4Y52I 2WAQA 1KC82 1TWGI 2E2HI 1VLAA 3CCLZ 4A3EI 1VQL1 1VQ51 1SFOI 2JR6A 1YI21 4BXXI 2OTJ1 1N2FA 1VQ71 4RS4A 4E2ZA 4MXUA 2R7ZI 3D9XA 4HH4A 1VQ9Z 3U50C 3CCUZ 2Y0SA 2KPIA 3CC2Z 1Q7Y1 1VQP1 4XX2A 3F3FC 1TWCI 3KIHA 3T4NB 2E2JI 2JA5I 2VUGA 2PK7A 3MZKB 2GU2A 3NFZA 4E2YA 2VUMI 2OTLZ 1RO4A 3VMHA 2V8IA 4BBRI 2YU9I 3S15I 3CCVZ 2OOXB 1S721 1Q812 3CMA1 4MD8A 2R6MA 2ZAEB 1ZB8A 1Z01A 4QTTA 1LQLA 2R93I 3CCSZ 3GCFA 4BBSI 1K8A1 1VQKZ 5T67A 2GTIA 3M4OI 2OZKA 1W2BZ 1YIT1 2IZ3A 3CCEZ 3TE5B 1ZH1A 4E31A 1Y1VI 3CCR1 1X0TA 1KD12 5T64A 3J81f 1YJ9Z 3GKQA 1NUIA 3HOVI 3S14I 1JJ2Y 3I07A 4MH4A 1Q821 4RVFA 5C4JI 1VQLZ 1P9NA 3G6E1 4A3KI 1VQ5Z 3M3YI 1M1K1 2JA6I 2HU9A 1YI2Z 2OTJZ 1K732 1VQ7Z 2QREB 1TWFI 4A3II 2VF1A 4TNUA 3HOYI 3NDJA 1KQSY 3S16I 3GTGI 4NH1C 1YHQ1 1VQPZ 4A3LI 1QYPA 3CME1 4A93I 2F4MA 4A3DI 4E33A 1Z03A 1NJI1 3HKZA 1YIJ1 3H3VJ 3PO3S 2PM9A 3HOWI 2Q4ZA 3S1MI 5D1PA 1QVGZ 1TFIA 5IT9f 3S1NI 3EERA 3BG1B 5CM2M 1Q7Y2 4E32A 1QVFZ 1X3WA 4AYBA 2JNYA 1S72Z 3NH5A 3CMAZ 2W04A 3CPWZ 2IZ4A 1WW9A 3Q87A 1KRLA 5AN9F 3OW2Y 2NVXI 2G2KA 3S1QI 1RNIA 2RPRA 1TWHI 3F3PC 1YITZ 1VQ61 3JAMf 3TDHB 2NVYI 3H0GI 4A3GI 3CCRZ 5A2Qf 2YADA 4NBBA 4E2XA 1VQM1 3PO3I 5IT9b 3CC71 1I6HI 5LL6f 5D1OA 1RLYA 1N8R2 2KI7B 3GTMI 3G6EZ 3NDIA 5IP9I 4DK1A 2HF1A 3S17I 2WB1A 2M6NA 3CXCY 1I3QI 4NBCA 1K83I 1R9TI 1YHQZ 4RVHA 3I551 1M902 1NP6A 3CMEZ 4NB8A 1YIJZ 1M1K2 3IX0A 2K5RA 2QA41 4CL1A 5C3EI 4NFRA 2JA7I 4S1TA 2R92I 3VMIA 5C44I 2DE6A 3LUSA 4RVDA 4A3JI 2O53A 2O4HA 3QWUA 4RV9A 1L1OC 1NJI2 4Y7NI 1USPA 2AKLA 1VQ81 1VQO1 2OOYB 2B63I 4DGLA 1Q811 3CCQ1 2V8JA 1VQ6Z 4A3FI 2NVQI 1Y1WI 4A3MI 4NB9A 3IFUA 5D1OB 4MD7A 1VQMZ 3J81b 3CC7Z 1YJN1 4NBHA 3G711 2DE5A 2JMOA 4NBFA 3CD61 3J7A4 1K9M1 5FLXf 4NBEA 5IP7I 4EWCA 3FQQA 3CCJ1 1Q861 1W2BY 2EGTA 4BY7I 3I55Z 3D6WA 1K731 3S2HI 3I4NI 2LFUA 1YJW1 4MRIA 3I561 2QA4Z 3FQMA 3VMGA 3HOUI 3CCM1 1VQN1 2QRDB 3S1RI 3GTPI 1VQ41 5FLXb 2QEX1 3BG0B 1USPB 3KIFA 3CC41 1JJ2Z 2I3CA 1K8A2 1YUKA 3HOZI 1VQ8Z 1WCMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF I;  5C3E I;  4A3I I;  4NBD A;  2DE7 A;  2JA7 I;  3HOY I;  4Y52 I;  2R92 I;  3VMI A;  2E2H I;  5C44 I;  1TWG I;  1PFT A;  2DE6 A;  3LUS A;  3GTG I;  1VLA A;  1Y1V S;  3S16 I;  4A3J I;  4A3E I;  4A3L I;  1QYP A;  3FKI I;  1SFO I;  4A93 I;  2F4M A;  4A3D I;  2JR6 A;  4NBA A;  1L1O C;  1DL6 A;  3H3V J;  3VB9 A;  4Y7N I;  4BXX I;  1ML8 A;  1USP A;  1N2F A;  3PO3 S;  2AKL A;  3GTK I;  3HOW I;  3PO2 I;  2R7Z I;  3U50 C;  3S1M I;  4X6A I;  2B63 I;  1TFI A;  2KPI A;  5C4X I;  3S1N I;  3EER A;  4XX2 A;  5CM2 M;  1X3W A;  1TWC I;  2BJO A;  2JA5 I;  2E2J I;  4A3F I;  2JNY A;  2NVQ I;  1Y1W I;  2PK7 A;  2J6A A;  4A3M I;  4QTU A;  4NB9 A;  3HOX I;  1WW9 A;  3Q87 A;  4NBH A;  1X3Z A;  2VUM I;  2DE5 A;  2NVX I;  1RO4 A;  4NBF A;  3S1Q I;  1TWH I;  3VMH A;  1YUA A;  4NBE A;  4BBR I;  2JA8 I;  3I4M I;  2YU9 I;  3S15 I;  5IP7 I;  2P3Y A;  2NVY I;  3H0G I;  4A3G I;  2E2I I;  2NVT I;  4NBB A;  3GTJ I;  3PO3 I;  1ZB8 A;  4BY7 I;  4QTT A;  1I6H I;  1LQL A;  2R93 I;  3GCF A;  1RLY A;  3GTM I;  3S2D I;  4BBS I;  4NOZ A;  3D6W A;  3M4O I;  5IP9 I;  3I4N I;  3S2H I;  2HF1 A;  3GTL I;  4A3B I;  3GTO I;  1TWA I;  1Y1V I;  3S17 I;  3CQZ I;  2RBL A;  3VMG A;  4NBG A;  1NUI A;  3GKQ A;  1I3Q I;  2F4O A;  4NBC A;  4BY1 I;  3GTQ I;  3HOV I;  3HOU I;  1ZB9 A;  1K83 I;  3S14 I;  3RZD I;  1R9T I;  2JS4 A;  3S1R I;  3I07 A;  3GTP I;  3RZO I;  1I50 I;  4MH4 A;  3ESW A;  5C4J I;  4A3K I;  1USP B;  3M3Y I;  2JA6 I;  4NB8 A;  3K7A I;  4A3C I;  3GTM S;  2K5R A;  3HOZ I;  5FLM I;  1WCM I; 
#chains in the Genus database with same CATH topology
 1VQO Z;  4NBD A;  2DE7 A;  1KC8 1;  2K3R A;  2V8K A;  1PFT A;  1Y1V S;  1RO2 A;  4MON A;  3CCQ Z;  3J80 f;  3FKI I;  2Q51 A;  3VTN A;  4NBA A;  1QVG Y;  1KQS Z;  3JAM b;  1Q82 2;  1RQF A;  2NAP A;  1DL6 A;  3VB9 A;  3MZL B;  1ML8 A;  3G4S 1;  3GTK I;  3PO2 I;  1QVF Y;  1RO0 A;  5A2Q b;  1YJN Z;  3G71 Z;  4X6A I;  2QLV B;  4RVG A;  3CCL 1;  2JUB A;  2M48 A;  5C4X I;  3CPW Y;  3CD6 Z;  3P5J B;  4DQY B;  4E2W A;  2RHB A;  2BJO A;  3NH8 A;  2J6A A;  4HGY A;  3CCJ Z;  4QTU A;  3NH4 A;  1Z02 A;  1QF8 A;  1N8R 1;  3HOX I;  2QR1 B;  1VQ9 1;  3J80 b;  1X3Z A;  1JWH C;  2GTH A;  3CCU 1;  3CC2 1;  2V45 A;  1YUA A;  1WII A;  1K9M 2;  1YJW Z;  2JA8 I;  2E9H A;  3I56 Z;  2P3Y A;  3OW2 Z;  2E2I I;  2NVT I;  2QRC B;  3GTJ I;  3CCM Z;  1M90 1;  1Q86 2;  1S7M A;  1VQN Z;  1VQ4 Z;  2VPW A;  3S2D I;  2RIQ A;  2OTL 1;  4NOZ A;  2QEX Z;  1FDI A;  4E30 A;  3CC4 Z;  2LIY A;  3GTL I;  4A3B I;  4HGZ A;  3CCV 1;  1AA6 A;  2JIR A;  1KD1 1;  3GTO I;  1TWA I;  2PMZ A;  3CQZ I;  5T6B A;  2RBL A;  4NBG A;  3I4M I;  2F4O A;  4BY1 I;  3GTQ I;  1ZB9 A;  2W03 A;  3RZD I;  3IF8 A;  2QKD A;  2JS4 A;  2RT9 A;  3RZO I;  3EED A;  1I50 I;  3CCS 1;  3ESW A;  3CXC Z;  4MD9 A;  1VQK 1;  3MON A;  3K7A I;  3CCE 1;  4A3C I;  3GTM S;  3G4S Z;  5FLM I;  2P28 A;  1YJ9 1;  2H85 A;  4Y52 I;  2WAQ A;  1KC8 2;  1TWG I;  2E2H I;  1VLA A;  3CCL Z;  4A3E I;  1VQL 1;  1VQ5 1;  1SFO I;  2JR6 A;  1YI2 1;  4BXX I;  2OTJ 1;  1N2F A;  1VQ7 1;  4RS4 A;  4E2Z A;  4MXU A;  2R7Z I;  3D9X A;  4HH4 A;  1VQ9 Z;  3U50 C;  3CCU Z;  2Y0S A;  2KPI A;  2JIO A;  3CC2 Z;  1Q7Y 1;  1VQP 1;  4XX2 A;  3F3F C;  1TWC I;  3KIH A;  3T4N B;  2E2J I;  2JA5 I;  2VUG A;  2PK7 A;  3MZK B;  2GU2 A;  3NFZ A;  4E2Y A;  2VUM I;  2OTL Z;  1RO4 A;  2V3V A;  3VMH A;  2V8I A;  4BBR I;  2YU9 I;  3S15 I;  3CCV Z;  2OOX B;  1S72 1;  1Q81 2;  3CMA 1;  4MD8 A;  2R6M A;  2ZAE B;  1ZB8 A;  1Z01 A;  4QTT A;  1LQL A;  2R93 I;  3CCS Z;  3GCF A;  4BBS I;  1K8A 1;  1VQK Z;  5T67 A;  2GTI A;  3M4O I;  2JIP A;  2OZK A;  1W2B Z;  1YIT 1;  2IZ3 A;  3CCE Z;  1Q16 A;  3TE5 B;  1ZH1 A;  4E31 A;  1Y1V I;  3CCR 1;  1X0T A;  1KD1 2;  5T64 A;  3J81 f;  1YJ9 Z;  3GKQ A;  1NUI A;  3HOV I;  3S14 I;  1JJ2 Y;  1WZN A;  3I07 A;  4MH4 A;  1Q82 1;  4RVF A;  5C4J I;  1VQL Z;  1P9N A;  3G6E 1;  4A3K I;  1VQ5 Z;  3M3Y I;  1M1K 1;  2JA6 I;  2HU9 A;  1YI2 Z;  2OTJ Z;  1K73 2;  1VQ7 Z;  2QRE B;  1TWF I;  4A3I I;  2VF1 A;  4TNU A;  3HOY I;  3NDJ A;  1KQS Y;  2IV2 X;  3S16 I;  3GTG I;  3IR7 A;  4NH1 C;  1YHQ 1;  1VQP Z;  4A3L I;  1QYP A;  3CME 1;  4A93 I;  2F4M A;  2AYD A;  4A3D I;  4E33 A;  1Z03 A;  1NJI 1;  3HKZ A;  1YIJ 1;  1FDO A;  3H3V J;  3PO3 S;  2VPY A;  2PM9 A;  3HOW I;  2Q4Z A;  3S1M I;  5D1P A;  1QVG Z;  1TFI A;  5IT9 f;  3S1N I;  3EER A;  3BG1 B;  5CM2 M;  1Q7Y 2;  4E32 A;  1QVF Z;  1X3W A;  4AYB A;  2LEX A;  2JNY A;  1S72 Z;  1SIW A;  3NH5 A;  3CMA Z;  2W04 A;  3CPW Z;  2IZ4 A;  1WW9 A;  3Q87 A;  1KRL A;  5AN9 F;  3OW2 Y;  2NVX I;  2G2K A;  3S1Q I;  1RNI A;  2RPR A;  1TWH I;  3F3P C;  1YIT Z;  1VQ6 1;  3JAM f;  3TDH B;  2NVY I;  3H0G I;  4A3G I;  3CCR Z;  5A2Q f;  2YAD A;  4NBB A;  4E2X A;  1VQM 1;  3PO3 I;  5IT9 b;  3CC7 1;  1I6H I;  5LL6 f;  5D1O A;  1RLY A;  1N8R 2;  2KI7 B;  3GTM I;  3G6E Z;  3NDI A;  5IP9 I;  4DK1 A;  2HF1 A;  3S17 I;  2WB1 A;  2M6N A;  3CXC Y;  1I3Q I;  4NBC A;  1Y8C A;  1K83 I;  2VPZ A;  2VPX A;  1R9T I;  3D2L A;  1YHQ Z;  4RVH A;  3I55 1;  1M90 2;  1NP6 A;  3CME Z;  4NB8 A;  1YIJ Z;  1M1K 2;  1QXF A;  3IX0 A;  2K5R A;  2QA4 1;  4CL1 A;  5C3E I;  4NFR A;  2JA7 I;  4S1T A;  2R92 I;  3VMI A;  5C44 I;  2DE6 A;  3LUS A;  4RVD A;  4A3J I;  2O53 A;  2O4H A;  3QWU A;  4RV9 A;  1L1O C;  1NJI 2;  2JIQ A;  4Y7N I;  1USP A;  2AKL A;  1VQ8 1;  1VQO 1;  2OOY B;  2B63 I;  4DGL A;  1Q81 1;  3CCQ 1;  2V8J A;  1VQ6 Z;  4A3F I;  2NVQ I;  1Y1W I;  4A3M I;  4NB9 A;  3IFU A;  5D1O B;  4MD7 A;  1VQM Z;  3J81 b;  3CC7 Z;  1YJN 1;  4NBH A;  3G71 1;  2DE5 A;  2JMO A;  4NBF A;  3CD6 1;  3J7A 4;  1K9M 1;  5FLX f;  4NBE A;  2E7Z A;  5IP7 I;  2JIM A;  4EWC A;  3FQQ A;  3CCJ 1;  1WJ2 A;  1Q86 1;  1W2B Y;  2EGT A;  4BY7 I;  3I55 Z;  3D6W A;  1K73 1;  3S2H I;  3I4N I;  2LFU A;  1YJW 1;  4MRI A;  3I56 1;  2QA4 Z;  3FQM A;  3VMG A;  3HOU I;  3CCM 1;  1VQN 1;  2QRD B;  3S1R I;  3GTP I;  1VQ4 1;  5FLX b;  2QEX 1;  3BG0 B;  1USP B;  3KIF A;  3CC4 1;  1JJ2 Z;  2I3C A;  1K8A 2;  1YUK A;  3HOZ I;  1VQ8 Z;  1WCM I; 
#chains in the Genus database with same CATH homology
 1VQO Z;  4NBD A;  2DE7 A;  1KC8 1;  2K3R A;  2V8K A;  1PFT A;  1Y1V S;  1RO2 A;  4MON A;  3CCQ Z;  3J80 f;  3FKI I;  2Q51 A;  3VTN A;  4NBA A;  1QVG Y;  1KQS Z;  3JAM b;  1Q82 2;  1RQF A;  1DL6 A;  3VB9 A;  3MZL B;  1ML8 A;  3G4S 1;  3GTK I;  3PO2 I;  1QVF Y;  1RO0 A;  5A2Q b;  1YJN Z;  3G71 Z;  4X6A I;  2QLV B;  4RVG A;  3CCL 1;  2JUB A;  2M48 A;  5C4X I;  3CPW Y;  3CD6 Z;  3P5J B;  4DQY B;  4E2W A;  2RHB A;  2BJO A;  3NH8 A;  2J6A A;  4HGY A;  3CCJ Z;  4QTU A;  3NH4 A;  1Z02 A;  1QF8 A;  1N8R 1;  3HOX I;  2QR1 B;  1VQ9 1;  3J80 b;  1X3Z A;  1JWH C;  2GTH A;  3CCU 1;  3CC2 1;  1YUA A;  1WII A;  1K9M 2;  1YJW Z;  2JA8 I;  2E9H A;  3I56 Z;  2P3Y A;  3OW2 Z;  2E2I I;  2NVT I;  2QRC B;  3GTJ I;  3CCM Z;  1M90 1;  1Q86 2;  1S7M A;  1VQN Z;  1VQ4 Z;  3S2D I;  2RIQ A;  2OTL 1;  4NOZ A;  2QEX Z;  4E30 A;  3CC4 Z;  2LIY A;  3GTL I;  4A3B I;  4HGZ A;  3CCV 1;  1KD1 1;  3GTO I;  1TWA I;  2PMZ A;  3CQZ I;  5T6B A;  2RBL A;  4NBG A;  3I4M I;  2F4O A;  4BY1 I;  3GTQ I;  1ZB9 A;  2W03 A;  3RZD I;  3IF8 A;  2QKD A;  2JS4 A;  2RT9 A;  3RZO I;  3EED A;  1I50 I;  3CCS 1;  3ESW A;  3CXC Z;  4MD9 A;  1VQK 1;  3MON A;  3K7A I;  3CCE 1;  4A3C I;  3GTM S;  3G4S Z;  5FLM I;  2P28 A;  1YJ9 1;  2H85 A;  4Y52 I;  2WAQ A;  1KC8 2;  1TWG I;  2E2H I;  1VLA A;  3CCL Z;  4A3E I;  1VQL 1;  1VQ5 1;  1SFO I;  2JR6 A;  1YI2 1;  4BXX I;  2OTJ 1;  1N2F A;  1VQ7 1;  4RS4 A;  4E2Z A;  4MXU A;  2R7Z I;  3D9X A;  4HH4 A;  1VQ9 Z;  3U50 C;  3CCU Z;  2Y0S A;  2KPI A;  3CC2 Z;  1Q7Y 1;  1VQP 1;  4XX2 A;  3F3F C;  1TWC I;  3KIH A;  3T4N B;  2E2J I;  2JA5 I;  2VUG A;  2PK7 A;  3MZK B;  2GU2 A;  3NFZ A;  4E2Y A;  2VUM I;  2OTL Z;  1RO4 A;  3VMH A;  2V8I A;  4BBR I;  2YU9 I;  3S15 I;  3CCV Z;  2OOX B;  1S72 1;  1Q81 2;  3CMA 1;  4MD8 A;  2R6M A;  2ZAE B;  1ZB8 A;  1Z01 A;  4QTT A;  1LQL A;  2R93 I;  3CCS Z;  3GCF A;  4BBS I;  1K8A 1;  1VQK Z;  5T67 A;  2GTI A;  3M4O I;  2OZK A;  1W2B Z;  1YIT 1;  2IZ3 A;  3CCE Z;  3TE5 B;  1ZH1 A;  4E31 A;  1Y1V I;  3CCR 1;  1X0T A;  1KD1 2;  5T64 A;  3J81 f;  1YJ9 Z;  3GKQ A;  1NUI A;  3HOV I;  3S14 I;  1JJ2 Y;  3I07 A;  4MH4 A;  1Q82 1;  4RVF A;  5C4J I;  1VQL Z;  1P9N A;  3G6E 1;  4A3K I;  1VQ5 Z;  3M3Y I;  1M1K 1;  2JA6 I;  2HU9 A;  1YI2 Z;  2OTJ Z;  1K73 2;  1VQ7 Z;  2QRE B;  1TWF I;  4A3I I;  2VF1 A;  4TNU A;  3HOY I;  3NDJ A;  1KQS Y;  3S16 I;  3GTG I;  4NH1 C;  1YHQ 1;  1VQP Z;  4A3L I;  1QYP A;  3CME 1;  4A93 I;  2F4M A;  4A3D I;  4E33 A;  1Z03 A;  1NJI 1;  3HKZ A;  1YIJ 1;  3H3V J;  3PO3 S;  2PM9 A;  3HOW I;  2Q4Z A;  3S1M I;  5D1P A;  1QVG Z;  1TFI A;  5IT9 f;  3S1N I;  3EER A;  3BG1 B;  5CM2 M;  1Q7Y 2;  4E32 A;  1QVF Z;  1X3W A;  4AYB A;  2JNY A;  1S72 Z;  3NH5 A;  3CMA Z;  2W04 A;  3CPW Z;  2IZ4 A;  1WW9 A;  3Q87 A;  1KRL A;  5AN9 F;  3OW2 Y;  2NVX I;  2G2K A;  3S1Q I;  1RNI A;  2RPR A;  1TWH I;  3F3P C;  1YIT Z;  1VQ6 1;  3JAM f;  3TDH B;  2NVY I;  3H0G I;  4A3G I;  3CCR Z;  5A2Q f;  2YAD A;  4NBB A;  4E2X A;  1VQM 1;  3PO3 I;  5IT9 b;  3CC7 1;  1I6H I;  5LL6 f;  5D1O A;  1RLY A;  1N8R 2;  2KI7 B;  3GTM I;  3G6E Z;  3NDI A;  5IP9 I;  4DK1 A;  2HF1 A;  3S17 I;  2WB1 A;  2M6N A;  3CXC Y;  1I3Q I;  4NBC A;  1K83 I;  1R9T I;  1YHQ Z;  4RVH A;  3I55 1;  1M90 2;  1NP6 A;  3CME Z;  4NB8 A;  1YIJ Z;  1M1K 2;  3IX0 A;  2K5R A;  2QA4 1;  4CL1 A;  5C3E I;  4NFR A;  2JA7 I;  4S1T A;  2R92 I;  3VMI A;  5C44 I;  2DE6 A;  3LUS A;  4RVD A;  4A3J I;  2O53 A;  2O4H A;  3QWU A;  4RV9 A;  1L1O C;  1NJI 2;  4Y7N I;  1USP A;  2AKL A;  1VQ8 1;  1VQO 1;  2OOY B;  2B63 I;  4DGL A;  1Q81 1;  3CCQ 1;  2V8J A;  1VQ6 Z;  4A3F I;  2NVQ I;  1Y1W I;  4A3M I;  4NB9 A;  3IFU A;  5D1O B;  4MD7 A;  1VQM Z;  3J81 b;  3CC7 Z;  1YJN 1;  4NBH A;  3G71 1;  2DE5 A;  2JMO A;  4NBF A;  3CD6 1;  3J7A 4;  1K9M 1;  5FLX f;  4NBE A;  5IP7 I;  4EWC A;  3FQQ A;  3CCJ 1;  1Q86 1;  1W2B Y;  2EGT A;  4BY7 I;  3I55 Z;  3D6W A;  1K73 1;  3S2H I;  3I4N I;  2LFU A;  1YJW 1;  4MRI A;  3I56 1;  2QA4 Z;  3FQM A;  3VMG A;  3HOU I;  3CCM 1;  1VQN 1;  2QRD B;  3S1R I;  3GTP I;  1VQ4 1;  5FLX b;  2QEX 1;  3BG0 B;  1USP B;  3KIF A;  3CC4 1;  1JJ2 Z;  2I3C A;  1K8A 2;  1YUK A;  3HOZ I;  1VQ8 Z;  1WCM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...