1QVFZ

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvfZ00
1NJI2 3CC21 1K731 1VQMZ 2OTJ1 3CXCZ 1K9M1 1VQ51 3CMA1 3CCE1 3CCRZ 2QA4Z 1Q822 1VQL1 1QVGZ 3I561 3CC2Z 3I55Z 1K8A1 1VQO1 1QVFY 1VQ5Z 3CMAZ 1YHQZ 1YJWZ 1YITZ 3CCM1 1W2BZ 1YJN1 3CXCY 1VQOZ 1VQM1 1M901 3G4S1 1VQKZ 1QVFZ 3CCR1 3CMEZ 1N8R2 1KD11 3I551 1K732 1JJ2Z 3G4SZ 1YJW1 1YHQ1 1YJ9Z 1W2BY 1K9M2 1VQNZ 3CCJZ 3CCQ1 1M1K1 1YIT1 1VQP1 3CC4Z 1K8A2 1S72Z 1Q7Y1 3CCQZ 1VQK1 1KC81 3CME1 3CD61 3CCSZ 1VQPZ 1JJ2Y 2OTL1 1VQ61 1M902 1YJ91 1VQN1 3CD6Z 3CCJ1 1KD12 2QEXZ 1VQ8Z 1YI2Z 2OTLZ 3CC41 1VQ6Z 1S721 1VQ41 1M1K2 3CCS1 1Q811 3CCLZ 1VQ7Z 1VQ9Z 1Q861 1Q7Y2 3G6E1 3CC7Z 2QEX1 1VQ81 1YI21 1YIJZ 3CCVZ 1KQSZ 3CPWY 1NJI1 3G6EZ 3G711 3CCU1 1Q821 1VQ4Z 3CCL1 3OW2Z 1VQ71 1VQ91 3G71Z 2OTJZ 3CCUZ 3CPWZ 3CCEZ 3CC71 1KQSY 1VQLZ 1Q812 1YIJ1 3I56Z 3CCV1 1Q862 1KC82 3OW2Y 1QVGY 2QA41 1N8R1 3CCMZ 1YJNZ
chains in the Genus database with same CATH superfamily
1WZNA 1Y1VI 1NJI2 1VQMZ 3CMA1 3CCE1 2QA4Z 1USPA 2K5RA 5T64A 4NB8A 2IZ4A 1RNIA 1VQO1 3NFZA 2JA6I 1SIWA 4NFRA 2VUGA 1YJN1 1RO0A 2V45A 1VQM1 1M901 3HOVI 2M48A 1N8R2 1KD11 2RHBA 5FLMI 2JA5I 1K732 3EEDA 3G4SZ 4S1TA 1K9M2 1W2BY 1M1K1 2E2II 2AKLA 3CC4Z 1S72Z 1Q7Y1 3TE5B 3CCQZ 2R6MA 2GTIA 5C44I 2OTL1 3PO3S 5C4JI 2WAQA 3NH5A 1TWGI 2H85A 3CD6Z 4NBGA 2QEXZ 4DGLA 1RO2A 3CC41 1VQ6Z 2F4MA 4AYBA 3F3PC 2PMZA 1S721 4A3II 4QTUA 3FQQA 4MRIA 1VQ7Z 1AA6A 3HOWI 2VPWA 2DE7A 3HOUI 2Q51A 4NOZA 2QEX1 1YIJZ 1KQSZ 3S1NI 3CPWY 3GTLI 3G711 2LEXA 3CCU1 4NBEA 5A2Qb 1Y1WI 4X6AI 1VQ71 2RPRA 3NH4A 1FDOA 5A2Qf 2E2HI 3P5JB 1X3WA 4A3KI 1K83I 1VQLZ 4MD7A 1QF8A 2Y0SA 1QYPA 1YIJ1 3I56Z 1Q862 3VMHA 1KC82 3MONA 3S2DI 3F3FC 5D1OA 1LQLA 3S1RI 2LIYA 1FDIA 3D9XA 3CC21 2QRDB 1NUIA 2JR6A 1RO4A 1VQ51 2RBLA 3PO3I 1Q822 1VQL1 5T67A 2OZKA 2NVYI 3I561 3NH8A 5AN9F 2NVTI 3MZLB 3CMAZ 1YHQZ 4BY7I 1USPB 3CXCY 3GTJI 1VQOZ 2V8JA 1VQKZ 1QVFZ 3BG1B 3K7AI 2OOYB 2E7ZA 4A3EI 2JUBA 1JWHC 1YHQ1 2JIMA 3HOXI 2HU9A 2DE6A 1TWAI 4NBFA 3U50C 1K8A2 2O53A 1I50I 2QRCB 1VQK1 2AYDA 1KC81 2EGTA 1Z01A 1ML8A 1S7MA 2JIOA 1JJ2Y 3JAMb 3D2LA 4E2YA 3JAMf 1YI2Z 2OTLZ 4NB9A 3T4NB 3GKQA 1R9TI 1DL6A 3VB9A 3HOZI 3NDJA 2E2JI 1Q811 4DQYB 4NBDA 3S17I 2QREB 3GTPI 1YI21 2E9HA 4RVHA 1KRLA 4MH4A 1NJI1 1Z03A 2V3VA 3M4OI 3OW2Z 1QXFA 2QKDA 3G71Z 2OTJZ 3CCUZ 3QWUA 2DE5A 3GTKI 2VPYA 3Q87A 4E2WA 1N2FA 4E30A 3MZKB 2JA8I 1TFIA 2GTHA 1N8R1 3CCMZ 1X0TA 3IFUA 2PM9A 1K731 2OTJ1 2WB1A 1Z02A 1K9M1 2HF1A 3CCRZ 4A3CI 5D1OB 4MD8A 1QVGZ 4BBSI 4DK1A 4TNUA 1RLYA 4HGZA 3CC2Z 3I55Z 5LL6f 3GTMS 1QVFY 1VQ5Z 1YJWZ 1NP6A 4E31A 1YITZ 4MXUA 3CCM1 1W2BZ 4A93I 2NVXI 4A3DI 3VMGA 3IR7A 4A3BI 2LFUA 1SFOI 2R92I 2IV2X 3CQZI 3CCR1 1ZB9A 5FLXb 2IZ3A 2O4HA 3I4NI 4E32A 3I551 1YJW1 3GCFA 3VTNA 5FLXf 3S16I 1YIT1 1VQP1 2NVQI 3D6WA 5C4XI 3KIFA 2JA7I 3S2HI 5D1PA 2YU9I 3CCSZ 2R93I 4Y52I 2OOXB 1WCMI 2VUMI 1M902 2R7ZI 1KD12 2VPZA 4Y7NI 2Q4ZA 3FQMA 1VQ41 2NAPA 2QR1B 1M1K2 3CCS1 2B63I 3CCLZ 1VQ9Z 1Q861 2JMOA 5IT9b 1Q7Y2 3J7A4 2GU2A 3G6E1 5IP9I 3GTMI 3J81b 1YJNZ 3CCVZ 2K3RA 4MONA 3J80b 4CL1A 1TWHI 3IX0A 3J81f 1Q821 4EWCA 3CCL1 2ZAEB 4E2XA 3J80f 3LUSA 1VQ91 2F4OA 1PFTA 4BBRI 3M3YI 1YUAA 4RV9A 1KQSY 1ZB8A 1Q16A 3CCV1 1TWFI 4XX2A 2M6NA 2I3CA 1QVGY 2JNYA 2QA41 1Y8CA 4A3FI 3NDIA 3CXCZ 2QLVB 3FKII 4NBBA 5CM2M 5IP7I 3HOYI 3RZOI 1K8A1 1I3QI 1WIIA 3HKZA 2V8KA 1RQFA 2P3YA 2RT9A 4HH4A 4E33A 5T6BA 2KPIA 4HGYA 1ZH1A 3G4S1 3S1MI 3CMEZ 2G2KA 3ESWA 1JJ2Z 1YJ9Z 1VQNZ 2JIQA 2W04A 3CCJZ 3CCQ1 3GTOI 2JIPA 4NH1C 3S15I 2RIQA 3CD61 3CME1 1Y1VS 4RVDA 1VQPZ 1VQ61 4QTTA 3GTQI 3VMIA 1YJ91 1VQN1 3PO2I 3CCJ1 4NBAA 1VQ8Z 1WW9A 1WJ2A 2PK7A 4E2ZA 1I6HI 4A3MI 2YADA 1L1OC 1P9NA 3EERA 2KI7B 2VPXA 2J6AA 1X3ZA 3IF8A 4A3JI 2W03A 3S14I 4BY1I 4A3LI 4NBCA 3CC7Z 1YUKA 3RZDI 1VQ81 4RVGA 1TWCI 2P28A 3KIHA 3GTGI 3H3VJ 3G6EZ 3BG0B 4MD9A 3H0GI 4RS4A 1VQ4Z 2JIRA 3I07A 1VLAA 2BJOA 3CPWZ 2JS4A 3CCEZ 3S1QI 3CC71 2V8IA 1Q812 4RVFA 4A3GI 3I4MI 4BXXI 3OW2Y 4NBHA 5C3EI 3TDHB 2VF1A 5IT9f
chains in the Genus database with same CATH topology
1Y1VI 1NJI2 1VQMZ 3CMA1 3CCE1 2QA4Z 1USPA 2K5RA 5T64A 4NB8A 2IZ4A 1RNIA 1VQO1 3NFZA 2JA6I 4NFRA 2VUGA 1YJN1 1RO0A 1VQM1 1M901 3HOVI 2M48A 1N8R2 1KD11 2RHBA 5FLMI 2JA5I 1K732 3EEDA 3G4SZ 4S1TA 1K9M2 1W2BY 1M1K1 2E2II 2AKLA 3CC4Z 1S72Z 1Q7Y1 3TE5B 3CCQZ 2R6MA 2GTIA 5C44I 2OTL1 3PO3S 5C4JI 2WAQA 3NH5A 1TWGI 2H85A 3CD6Z 4NBGA 2QEXZ 4DGLA 1RO2A 3CC41 1VQ6Z 2F4MA 4AYBA 3F3PC 2PMZA 1S721 4A3II 4QTUA 3FQQA 4MRIA 1VQ7Z 3HOWI 2DE7A 3HOUI 2Q51A 4NOZA 2QEX1 1YIJZ 1KQSZ 3S1NI 3CPWY 3GTLI 3G711 3CCU1 4NBEA 5A2Qb 1Y1WI 4X6AI 1VQ71 2RPRA 3NH4A 5A2Qf 2E2HI 3P5JB 1X3WA 4A3KI 1K83I 1VQLZ 4MD7A 1QF8A 2Y0SA 1QYPA 1YIJ1 3I56Z 1Q862 3VMHA 1KC82 3MONA 3S2DI 3F3FC 5D1OA 1LQLA 3S1RI 2LIYA 3D9XA 3CC21 2QRDB 1NUIA 2JR6A 1RO4A 1VQ51 2RBLA 3PO3I 1Q822 1VQL1 5T67A 2OZKA 2NVYI 3I561 3NH8A 5AN9F 2NVTI 3MZLB 3CMAZ 1YHQZ 4BY7I 1USPB 3CXCY 3GTJI 1VQOZ 2V8JA 1VQKZ 1QVFZ 3BG1B 3K7AI 2OOYB 4A3EI 2JUBA 1JWHC 1YHQ1 3HOXI 2HU9A 2DE6A 1TWAI 4NBFA 3U50C 1K8A2 2O53A 1I50I 2QRCB 1VQK1 1KC81 2EGTA 1Z01A 1ML8A 1S7MA 1JJ2Y 3JAMb 4E2YA 3JAMf 1YI2Z 2OTLZ 4NB9A 3T4NB 3GKQA 1R9TI 1DL6A 3VB9A 3HOZI 3NDJA 2E2JI 1Q811 4DQYB 4NBDA 3S17I 2QREB 3GTPI 1YI21 2E9HA 4RVHA 1KRLA 4MH4A 1NJI1 1Z03A 3M4OI 3OW2Z 2QKDA 3G71Z 2OTJZ 3CCUZ 3QWUA 2DE5A 3GTKI 3Q87A 4E2WA 1N2FA 4E30A 3MZKB 2JA8I 1TFIA 2GTHA 1N8R1 3CCMZ 1X0TA 3IFUA 2PM9A 1K731 2OTJ1 2WB1A 1Z02A 1K9M1 2HF1A 3CCRZ 4A3CI 5D1OB 4MD8A 1QVGZ 4BBSI 4DK1A 4TNUA 1RLYA 4HGZA 3CC2Z 3I55Z 5LL6f 3GTMS 1QVFY 1VQ5Z 1YJWZ 1NP6A 4E31A 1YITZ 4MXUA 3CCM1 1W2BZ 4A93I 2NVXI 4A3DI 3VMGA 4A3BI 2LFUA 1SFOI 2R92I 3CCR1 3CQZI 1ZB9A 5FLXb 2IZ3A 2O4HA 3I4NI 4E32A 3I551 1YJW1 3GCFA 3VTNA 5FLXf 3S16I 1YIT1 1VQP1 2NVQI 3D6WA 5C4XI 3KIFA 2JA7I 3S2HI 5D1PA 2YU9I 3CCSZ 2R93I 4Y52I 2OOXB 1WCMI 2VUMI 1M902 2R7ZI 1KD12 4Y7NI 2Q4ZA 3FQMA 1VQ41 2QR1B 1M1K2 3CCS1 2B63I 3CCLZ 1VQ9Z 1Q861 2JMOA 5IT9b 1Q7Y2 3J7A4 2GU2A 3G6E1 5IP9I 3GTMI 3J81b 1YJNZ 3CCVZ 2K3RA 4MONA 3J80b 4CL1A 1TWHI 3IX0A 3J81f 1Q821 4EWCA 3CCL1 2ZAEB 4E2XA 3J80f 3LUSA 1VQ91 2F4OA 1PFTA 4BBRI 3M3YI 1YUAA 4RV9A 1KQSY 1ZB8A 3CCV1 1TWFI 4XX2A 2M6NA 2I3CA 1QVGY 2JNYA 2QA41 4A3FI 3NDIA 3CXCZ 2QLVB 3FKII 4NBBA 5CM2M 5IP7I 3HOYI 3RZOI 1K8A1 1I3QI 1WIIA 3HKZA 2V8KA 1RQFA 2P3YA 2RT9A 4HH4A 4E33A 5T6BA 2KPIA 4HGYA 1ZH1A 3G4S1 3S1MI 3CMEZ 2G2KA 3ESWA 1JJ2Z 1YJ9Z 1VQNZ 2W04A 3CCJZ 3CCQ1 3GTOI 4NH1C 3S15I 2RIQA 3CD61 3CME1 1Y1VS 4RVDA 1VQPZ 1VQ61 4QTTA 3GTQI 3VMIA 1YJ91 1VQN1 3PO2I 3CCJ1 4NBAA 1VQ8Z 1WW9A 2PK7A 4E2ZA 1I6HI 4A3MI 2YADA 1L1OC 1P9NA 3EERA 2KI7B 2J6AA 1X3ZA 3IF8A 4A3JI 2W03A 3S14I 4BY1I 4A3LI 4NBCA 3CC7Z 1YUKA 3RZDI 1VQ81 4RVGA 1TWCI 2P28A 3KIHA 3GTGI 3H3VJ 3G6EZ 3BG0B 4MD9A 3H0GI 4RS4A 1VQ4Z 3I07A 1VLAA 2BJOA 3CPWZ 2JS4A 3CCEZ 3S1QI 3CC71 2V8IA 1Q812 4RVFA 4A3GI 3I4MI 4BXXI 3OW2Y 4NBHA 5C3EI 3TDHB 2VF1A 5IT9f
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 2;  3CC2 1;  1K73 1;  1VQM Z;  2OTJ 1;  3CXC Z;  1K9M 1;  1VQ5 1;  3CMA 1;  3CCE 1;  3CCR Z;  2QA4 Z;  1Q82 2;  1VQL 1;  1QVG Z;  3I56 1;  3CC2 Z;  3I55 Z;  1K8A 1;  1VQO 1;  1QVF Y;  1VQ5 Z;  3CMA Z;  1YHQ Z;  1YJW Z;  1YIT Z;  3CCM 1;  1W2B Z;  1YJN 1;  3CXC Y;  1VQO Z;  1VQM 1;  1M90 1;  3G4S 1;  1VQK Z;  1QVF Z;  3CCR 1;  3CME Z;  1N8R 2;  1KD1 1;  3I55 1;  1K73 2;  1JJ2 Z;  3G4S Z;  1YJW 1;  1YHQ 1;  1YJ9 Z;  1W2B Y;  1K9M 2;  1VQN Z;  3CCJ Z;  3CCQ 1;  1M1K 1;  1YIT 1;  1VQP 1;  3CC4 Z;  1K8A 2;  1S72 Z;  1Q7Y 1;  3CCQ Z;  1VQK 1;  1KC8 1;  3CME 1;  3CD6 1;  3CCS Z;  1VQP Z;  1JJ2 Y;  2OTL 1;  1VQ6 1;  1M90 2;  1YJ9 1;  1VQN 1;  3CD6 Z;  3CCJ 1;  1KD1 2;  2QEX Z;  1VQ8 Z;  1YI2 Z;  2OTL Z;  3CC4 1;  1VQ6 Z;  1S72 1;  1VQ4 1;  1M1K 2;  3CCS 1;  1Q81 1;  3CCL Z;  1VQ7 Z;  1VQ9 Z;  1Q86 1;  1Q7Y 2;  3G6E 1;  3CC7 Z;  2QEX 1;  1VQ8 1;  1YI2 1;  1YIJ Z;  3CCV Z;  1KQS Z;  3CPW Y;  1NJI 1;  3G6E Z;  3G71 1;  3CCU 1;  1Q82 1;  1VQ4 Z;  3CCL 1;  3OW2 Z;  1VQ7 1;  1VQ9 1;  3G71 Z;  2OTJ Z;  3CCU Z;  3CPW Z;  3CCE Z;  3CC7 1;  1KQS Y;  1VQL Z;  1Q81 2;  1YIJ 1;  3I56 Z;  3CCV 1;  1Q86 2;  1KC8 2;  3OW2 Y;  1QVG Y;  2QA4 1;  1N8R 1;  3CCM Z;  1YJN Z; 
#chains in the Genus database with same CATH topology
 1WZN A;  1Y1V I;  1NJI 2;  1VQM Z;  3CMA 1;  3CCE 1;  2QA4 Z;  1USP A;  2K5R A;  5T64 A;  4NB8 A;  2IZ4 A;  1RNI A;  1VQO 1;  3NFZ A;  2JA6 I;  1SIW A;  4NFR A;  2VUG A;  1YJN 1;  1RO0 A;  2V45 A;  1VQM 1;  1M90 1;  3HOV I;  2M48 A;  1N8R 2;  1KD1 1;  2RHB A;  5FLM I;  2JA5 I;  1K73 2;  3EED A;  3G4S Z;  4S1T A;  1K9M 2;  1W2B Y;  1M1K 1;  2E2I I;  2AKL A;  3CC4 Z;  1S72 Z;  1Q7Y 1;  3TE5 B;  3CCQ Z;  2R6M A;  2GTI A;  5C44 I;  2OTL 1;  3PO3 S;  5C4J I;  2WAQ A;  3NH5 A;  1TWG I;  2H85 A;  3CD6 Z;  4NBG A;  2QEX Z;  4DGL A;  1RO2 A;  3CC4 1;  1VQ6 Z;  2F4M A;  4AYB A;  3F3P C;  2PMZ A;  1S72 1;  4A3I I;  4QTU A;  3FQQ A;  4MRI A;  1VQ7 Z;  1AA6 A;  3HOW I;  2VPW A;  2DE7 A;  3HOU I;  2Q51 A;  4NOZ A;  2QEX 1;  1YIJ Z;  1KQS Z;  3S1N I;  3CPW Y;  3GTL I;  3G71 1;  2LEX A;  3CCU 1;  4NBE A;  5A2Q b;  1Y1W I;  4X6A I;  1VQ7 1;  2RPR A;  3NH4 A;  1FDO A;  5A2Q f;  2E2H I;  3P5J B;  1X3W A;  4A3K I;  1K83 I;  1VQL Z;  4MD7 A;  1QF8 A;  2Y0S A;  1QYP A;  1YIJ 1;  3I56 Z;  1Q86 2;  3VMH A;  1KC8 2;  3MON A;  3S2D I;  3F3F C;  5D1O A;  1LQL A;  3S1R I;  2LIY A;  1FDI A;  3D9X A;  3CC2 1;  2QRD B;  1NUI A;  2JR6 A;  1RO4 A;  1VQ5 1;  2RBL A;  3PO3 I;  1Q82 2;  1VQL 1;  5T67 A;  2OZK A;  2NVY I;  3I56 1;  3NH8 A;  5AN9 F;  2NVT I;  3MZL B;  3CMA Z;  1YHQ Z;  4BY7 I;  1USP B;  3CXC Y;  3GTJ I;  1VQO Z;  2V8J A;  1VQK Z;  1QVF Z;  3BG1 B;  3K7A I;  2OOY B;  2E7Z A;  4A3E I;  2JUB A;  1JWH C;  1YHQ 1;  2JIM A;  3HOX I;  2HU9 A;  2DE6 A;  1TWA I;  4NBF A;  3U50 C;  1K8A 2;  2O53 A;  1I50 I;  2QRC B;  1VQK 1;  2AYD A;  1KC8 1;  2EGT A;  1Z01 A;  1ML8 A;  1S7M A;  2JIO A;  1JJ2 Y;  3JAM b;  3D2L A;  4E2Y A;  3JAM f;  1YI2 Z;  2OTL Z;  4NB9 A;  3T4N B;  3GKQ A;  1R9T I;  1DL6 A;  3VB9 A;  3HOZ I;  3NDJ A;  2E2J I;  1Q81 1;  4DQY B;  4NBD A;  3S17 I;  2QRE B;  3GTP I;  1YI2 1;  2E9H A;  4RVH A;  1KRL A;  4MH4 A;  1NJI 1;  1Z03 A;  2V3V A;  3M4O I;  3OW2 Z;  1QXF A;  2QKD A;  3G71 Z;  2OTJ Z;  3CCU Z;  3QWU A;  2DE5 A;  3GTK I;  2VPY A;  3Q87 A;  4E2W A;  1N2F A;  4E30 A;  3MZK B;  2JA8 I;  1TFI A;  2GTH A;  1N8R 1;  3CCM Z;  1X0T A;  3IFU A;  2PM9 A;  1K73 1;  2OTJ 1;  2WB1 A;  1Z02 A;  1K9M 1;  2HF1 A;  3CCR Z;  4A3C I;  5D1O B;  4MD8 A;  1QVG Z;  4BBS I;  4DK1 A;  4TNU A;  1RLY A;  4HGZ A;  3CC2 Z;  3I55 Z;  5LL6 f;  3GTM S;  1QVF Y;  1VQ5 Z;  1YJW Z;  1NP6 A;  4E31 A;  1YIT Z;  4MXU A;  3CCM 1;  1W2B Z;  4A93 I;  2NVX I;  4A3D I;  3VMG A;  3IR7 A;  4A3B I;  2LFU A;  1SFO I;  2R92 I;  2IV2 X;  3CQZ I;  3CCR 1;  1ZB9 A;  5FLX b;  2IZ3 A;  2O4H A;  3I4N I;  4E32 A;  3I55 1;  1YJW 1;  3GCF A;  3VTN A;  5FLX f;  3S16 I;  1YIT 1;  1VQP 1;  2NVQ I;  3D6W A;  5C4X I;  3KIF A;  2JA7 I;  3S2H I;  5D1P A;  2YU9 I;  3CCS Z;  2R93 I;  4Y52 I;  2OOX B;  1WCM I;  2VUM I;  1M90 2;  2R7Z I;  1KD1 2;  2VPZ A;  4Y7N I;  2Q4Z A;  3FQM A;  1VQ4 1;  2NAP A;  2QR1 B;  1M1K 2;  3CCS 1;  2B63 I;  3CCL Z;  1VQ9 Z;  1Q86 1;  2JMO A;  5IT9 b;  1Q7Y 2;  3J7A 4;  2GU2 A;  3G6E 1;  5IP9 I;  3GTM I;  3J81 b;  1YJN Z;  3CCV Z;  2K3R A;  4MON A;  3J80 b;  4CL1 A;  1TWH I;  3IX0 A;  3J81 f;  1Q82 1;  4EWC A;  3CCL 1;  2ZAE B;  4E2X A;  3J80 f;  3LUS A;  1VQ9 1;  2F4O A;  1PFT A;  4BBR I;  3M3Y I;  1YUA A;  4RV9 A;  1KQS Y;  1ZB8 A;  1Q16 A;  3CCV 1;  1TWF I;  4XX2 A;  2M6N A;  2I3C A;  1QVG Y;  2JNY A;  2QA4 1;  1Y8C A;  4A3F I;  3NDI A;  3CXC Z;  2QLV B;  3FKI I;  4NBB A;  5CM2 M;  5IP7 I;  3HOY I;  3RZO I;  1K8A 1;  1I3Q I;  1WII A;  3HKZ A;  2V8K A;  1RQF A;  2P3Y A;  2RT9 A;  4HH4 A;  4E33 A;  5T6B A;  2KPI A;  4HGY A;  1ZH1 A;  3G4S 1;  3S1M I;  3CME Z;  2G2K A;  3ESW A;  1JJ2 Z;  1YJ9 Z;  1VQN Z;  2JIQ A;  2W04 A;  3CCJ Z;  3CCQ 1;  3GTO I;  2JIP A;  4NH1 C;  3S15 I;  2RIQ A;  3CD6 1;  3CME 1;  1Y1V S;  4RVD A;  1VQP Z;  1VQ6 1;  4QTT A;  3GTQ I;  3VMI A;  1YJ9 1;  1VQN 1;  3PO2 I;  3CCJ 1;  4NBA A;  1VQ8 Z;  1WW9 A;  1WJ2 A;  2PK7 A;  4E2Z A;  1I6H I;  4A3M I;  2YAD A;  1L1O C;  1P9N A;  3EER A;  2KI7 B;  2VPX A;  2J6A A;  1X3Z A;  3IF8 A;  4A3J I;  2W03 A;  3S14 I;  4BY1 I;  4A3L I;  4NBC A;  3CC7 Z;  1YUK A;  3RZD I;  1VQ8 1;  4RVG A;  1TWC I;  2P28 A;  3KIH A;  3GTG I;  3H3V J;  3G6E Z;  3BG0 B;  4MD9 A;  3H0G I;  4RS4 A;  1VQ4 Z;  2JIR A;  3I07 A;  1VLA A;  2BJO A;  3CPW Z;  2JS4 A;  3CCE Z;  3S1Q I;  3CC7 1;  2V8I A;  1Q81 2;  4RVF A;  4A3G I;  3I4M I;  4BXX I;  3OW2 Y;  4NBH A;  5C3E I;  3TDH B;  2VF1 A;  5IT9 f; 
#chains in the Genus database with same CATH homology
 1Y1V I;  1NJI 2;  1VQM Z;  3CMA 1;  3CCE 1;  2QA4 Z;  1USP A;  2K5R A;  5T64 A;  4NB8 A;  2IZ4 A;  1RNI A;  1VQO 1;  3NFZ A;  2JA6 I;  4NFR A;  2VUG A;  1YJN 1;  1RO0 A;  1VQM 1;  1M90 1;  3HOV I;  2M48 A;  1N8R 2;  1KD1 1;  2RHB A;  5FLM I;  2JA5 I;  1K73 2;  3EED A;  3G4S Z;  4S1T A;  1K9M 2;  1W2B Y;  1M1K 1;  2E2I I;  2AKL A;  3CC4 Z;  1S72 Z;  1Q7Y 1;  3TE5 B;  3CCQ Z;  2R6M A;  2GTI A;  5C44 I;  2OTL 1;  3PO3 S;  5C4J I;  2WAQ A;  3NH5 A;  1TWG I;  2H85 A;  3CD6 Z;  4NBG A;  2QEX Z;  4DGL A;  1RO2 A;  3CC4 1;  1VQ6 Z;  2F4M A;  4AYB A;  3F3P C;  2PMZ A;  1S72 1;  4A3I I;  4QTU A;  3FQQ A;  4MRI A;  1VQ7 Z;  3HOW I;  2DE7 A;  3HOU I;  2Q51 A;  4NOZ A;  2QEX 1;  1YIJ Z;  1KQS Z;  3S1N I;  3CPW Y;  3GTL I;  3G71 1;  3CCU 1;  4NBE A;  5A2Q b;  1Y1W I;  4X6A I;  1VQ7 1;  2RPR A;  3NH4 A;  5A2Q f;  2E2H I;  3P5J B;  1X3W A;  4A3K I;  1K83 I;  1VQL Z;  4MD7 A;  1QF8 A;  2Y0S A;  1QYP A;  1YIJ 1;  3I56 Z;  1Q86 2;  3VMH A;  1KC8 2;  3MON A;  3S2D I;  3F3F C;  5D1O A;  1LQL A;  3S1R I;  2LIY A;  3D9X A;  3CC2 1;  2QRD B;  1NUI A;  2JR6 A;  1RO4 A;  1VQ5 1;  2RBL A;  3PO3 I;  1Q82 2;  1VQL 1;  5T67 A;  2OZK A;  2NVY I;  3I56 1;  3NH8 A;  5AN9 F;  2NVT I;  3MZL B;  3CMA Z;  1YHQ Z;  4BY7 I;  1USP B;  3CXC Y;  3GTJ I;  1VQO Z;  2V8J A;  1VQK Z;  1QVF Z;  3BG1 B;  3K7A I;  2OOY B;  4A3E I;  2JUB A;  1JWH C;  1YHQ 1;  3HOX I;  2HU9 A;  2DE6 A;  1TWA I;  4NBF A;  3U50 C;  1K8A 2;  2O53 A;  1I50 I;  2QRC B;  1VQK 1;  1KC8 1;  2EGT A;  1Z01 A;  1ML8 A;  1S7M A;  1JJ2 Y;  3JAM b;  4E2Y A;  3JAM f;  1YI2 Z;  2OTL Z;  4NB9 A;  3T4N B;  3GKQ A;  1R9T I;  1DL6 A;  3VB9 A;  3HOZ I;  3NDJ A;  2E2J I;  1Q81 1;  4DQY B;  4NBD A;  3S17 I;  2QRE B;  3GTP I;  1YI2 1;  2E9H A;  4RVH A;  1KRL A;  4MH4 A;  1NJI 1;  1Z03 A;  3M4O I;  3OW2 Z;  2QKD A;  3G71 Z;  2OTJ Z;  3CCU Z;  3QWU A;  2DE5 A;  3GTK I;  3Q87 A;  4E2W A;  1N2F A;  4E30 A;  3MZK B;  2JA8 I;  1TFI A;  2GTH A;  1N8R 1;  3CCM Z;  1X0T A;  3IFU A;  2PM9 A;  1K73 1;  2OTJ 1;  2WB1 A;  1Z02 A;  1K9M 1;  2HF1 A;  3CCR Z;  4A3C I;  5D1O B;  4MD8 A;  1QVG Z;  4BBS I;  4DK1 A;  4TNU A;  1RLY A;  4HGZ A;  3CC2 Z;  3I55 Z;  5LL6 f;  3GTM S;  1QVF Y;  1VQ5 Z;  1YJW Z;  1NP6 A;  4E31 A;  1YIT Z;  4MXU A;  3CCM 1;  1W2B Z;  4A93 I;  2NVX I;  4A3D I;  3VMG A;  4A3B I;  2LFU A;  1SFO I;  2R92 I;  3CCR 1;  3CQZ I;  1ZB9 A;  5FLX b;  2IZ3 A;  2O4H A;  3I4N I;  4E32 A;  3I55 1;  1YJW 1;  3GCF A;  3VTN A;  5FLX f;  3S16 I;  1YIT 1;  1VQP 1;  2NVQ I;  3D6W A;  5C4X I;  3KIF A;  2JA7 I;  3S2H I;  5D1P A;  2YU9 I;  3CCS Z;  2R93 I;  4Y52 I;  2OOX B;  1WCM I;  2VUM I;  1M90 2;  2R7Z I;  1KD1 2;  4Y7N I;  2Q4Z A;  3FQM A;  1VQ4 1;  2QR1 B;  1M1K 2;  3CCS 1;  2B63 I;  3CCL Z;  1VQ9 Z;  1Q86 1;  2JMO A;  5IT9 b;  1Q7Y 2;  3J7A 4;  2GU2 A;  3G6E 1;  5IP9 I;  3GTM I;  3J81 b;  1YJN Z;  3CCV Z;  2K3R A;  4MON A;  3J80 b;  4CL1 A;  1TWH I;  3IX0 A;  3J81 f;  1Q82 1;  4EWC A;  3CCL 1;  2ZAE B;  4E2X A;  3J80 f;  3LUS A;  1VQ9 1;  2F4O A;  1PFT A;  4BBR I;  3M3Y I;  1YUA A;  4RV9 A;  1KQS Y;  1ZB8 A;  3CCV 1;  1TWF I;  4XX2 A;  2M6N A;  2I3C A;  1QVG Y;  2JNY A;  2QA4 1;  4A3F I;  3NDI A;  3CXC Z;  2QLV B;  3FKI I;  4NBB A;  5CM2 M;  5IP7 I;  3HOY I;  3RZO I;  1K8A 1;  1I3Q I;  1WII A;  3HKZ A;  2V8K A;  1RQF A;  2P3Y A;  2RT9 A;  4HH4 A;  4E33 A;  5T6B A;  2KPI A;  4HGY A;  1ZH1 A;  3G4S 1;  3S1M I;  3CME Z;  2G2K A;  3ESW A;  1JJ2 Z;  1YJ9 Z;  1VQN Z;  2W04 A;  3CCJ Z;  3CCQ 1;  3GTO I;  4NH1 C;  3S15 I;  2RIQ A;  3CD6 1;  3CME 1;  1Y1V S;  4RVD A;  1VQP Z;  1VQ6 1;  4QTT A;  3GTQ I;  3VMI A;  1YJ9 1;  1VQN 1;  3PO2 I;  3CCJ 1;  4NBA A;  1VQ8 Z;  1WW9 A;  2PK7 A;  4E2Z A;  1I6H I;  4A3M I;  2YAD A;  1L1O C;  1P9N A;  3EER A;  2KI7 B;  2J6A A;  1X3Z A;  3IF8 A;  4A3J I;  2W03 A;  3S14 I;  4BY1 I;  4A3L I;  4NBC A;  3CC7 Z;  1YUK A;  3RZD I;  1VQ8 1;  4RVG A;  1TWC I;  2P28 A;  3KIH A;  3GTG I;  3H3V J;  3G6E Z;  3BG0 B;  4MD9 A;  3H0G I;  4RS4 A;  1VQ4 Z;  3I07 A;  1VLA A;  2BJO A;  3CPW Z;  2JS4 A;  3CCE Z;  3S1Q I;  3CC7 1;  2V8I A;  1Q81 2;  4RVF A;  4A3G I;  3I4M I;  4BXX I;  3OW2 Y;  4NBH A;  5C3E I;  3TDH B;  2VF1 A;  5IT9 f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...