1QVFZ

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvfZ00
3G4S1 1K8A1 1VQM1 1N8R1 1VQ9Z 1Q862 3CCV1 2QA41 1VQ6Z 3CPWY 3CCJ1 3I561 1Q861 3CC41 1YJWZ 1YJ91 1M902 1M1K1 3CCU1 1YI21 3CCE1 3OW2Y 1Q7Y1 1QVFY 3CCM1 3CC71 1VQMZ 1YJNZ 1JJ2Z 1KD12 3CC21 1KC82 3G711 3CCVZ 3CCR1 1VQ81 3I551 1YIJ1 3CCJZ 1K9M2 1Q811 3CMA1 1W2BZ 3I56Z 1KC81 3CC4Z 3CD6Z 1YJ9Z 3CCUZ 1YI2Z 3CCEZ 2OTJ1 3CME1 3CCMZ 3CC2Z 3G71Z 1VQN1 3CCS1 1VQ8Z 1YIJZ 1JJ2Y 3G4SZ 1VQ71 3G6E1 1S721 1M901 1VQP1 1Q822 2QA4Z 1YHQ1 3CMEZ 2OTJZ 1W2BY 1VQK1 1K732 1VQ41 1QVGZ 1NJI2 1KD11 3CCL1 1KQSZ 1K9M1 1VQ7Z 3CXCZ 3G6EZ 1S72Z 3CC7Z 1VQ51 3CCRZ 2OTL1 1VQKZ 3I55Z 2QEX1 1VQL1 1K8A2 1VQ4Z 3CMAZ 3CCLZ 1N8R2 1QVGY 1VQO1 1YJN1 1KQSY 3CCQ1 1YIT1 1M1K2 1VQ5Z 1Q821 2OTLZ 1VQNZ 3CXCY 3CCSZ 1Q7Y2 1K731 2QEXZ 1VQLZ 3CPWZ 3CD61 1NJI1 1VQ91 1VQPZ 1VQ61 1YHQZ 3OW2Z 1VQOZ 1Q812 3CCQZ 1YITZ 1QVFZ 1YJW1
chains in the Genus database with same CATH superfamily
3G4S1 1TWHI 4MD8A 1K8A1 1VQM1 1VQ9Z 3EERA 3CPWY 2RHBA 2QKDA 4DK1A 5A2Qb 3GTKI 4RVGA 3M3YI 1YI21 3HKZA 3JAMb 2K3RA 3LUSA 5CM2M 2JIRA 3CCVZ 1WCMI 2JIMA 2PM9A 5AN9F 3I551 1YIJ1 4BBRI 1K9M2 4XX2A 1Q811 2R6MA 3I56Z 3VMHA 4A3LI 2G2KA 2OTJ1 2VPWA 3RZDI 3CME1 4S1TA 1JWHC 1P9NA 2F4MA 2HF1A 1YUKA 3VB9A 2JIPA 3G4SZ 2VPZA 3NH5A 2AKLA 3PO3I 4NFRA 4RVFA 4A3JI 2GTHA 2M48A 3H0GI 3PO3S 3HOZI 1W2BY 1K732 4TNUA 5D1OA 3CCL1 2P3YA 1N2FA 3CXCZ 1RO4A 1X3WA 3S2DI 2OTL1 3I55Z 2QEX1 2JA7I 1USPB 1QVGY 2GU2A 2O4HA 4NH1C 4A3MI 1KQSY 4NBBA 3J81f 3M4OI 2RIQA 1M1K2 2KI7B 1Q7Y2 2PMZA 1VQLZ 1NJI1 3ESWA 2YADA 1TWGI 3D9XA 1VQ91 2JUBA 5T67A 1FDOA 2IV2X 1VQOZ 1QF8A 4E31A 3S2HI 2B63I 2NVTI 1N8R1 3GTPI 3CCV1 2AYDA 3RZOI 4BY7I 4Y7NI 3F3FC 3I561 4CL1A 1YJWZ 1M902 1TWAI 2IZ3A 1WZNA 4NBGA 4QTTA 2JS4A 4RS4A 1LQLA 4MD7A 1S7MA 3CC71 1JJ2Z 2QLVB 3U50C 1KD12 3S15I 4EWCA 1KC82 4BXXI 3S1NI 3CMA1 1KC81 3CC4Z 5FLXb 1YJ9Z 3CCUZ 4HGYA 3GTJI 3CCEZ 1Y1VI 1TWFI 1Y1VS 2LFUA 5D1OB 1SIWA 1X3ZA 2RBLA 3FQMA 4A3FI 1K83I 3FKII 3KIHA 1RO2A 1AA6A 2JIOA 3H3VJ 4BBSI 2LEXA 1Y1WI 2E2HI 4NBAA 1WIIA 2VUGA 5C4JI 1Q822 2H85A 1YHQ1 2E2JI 4MH4A 1L1OC 3TDHB 3HOVI 5IP7I 3S17I 3NDJA 5LL6f 3HOYI 3MZLB 1K9M1 2I3CA 3F3PC 2V8JA 3QWUA 4A93I 2RPRA 3G6EZ 1S72Z 1Z03A 3CC7Z 4NBFA 3GTQI 1VQL1 4NBCA 3I07A 4E32A 3CMAZ 4X6AI 3Q87A 2JNYA 2NVYI 1VQO1 3GKQA 1FDIA 2OZKA 1R9TI 1VQ5Z 1TFIA 2QRDB 3CXCY 1QYPA 1K731 2QREB 3FQQA 5C3EI 4MD9A 2K5RA 2R7ZI 1YHQZ 2E7ZA 3OW2Z 3CCQZ 2V3VA 1YITZ 1QVFZ 1RQFA 2DE7A 1YJW1 3GTGI 4NBHA 1Q862 1Q16A 2QA41 2O53A 2W03A 2Y0SA 2JA5I 3J80f 3S16I 4E2ZA 1Q861 3CC41 2R93I 5IT9f 1YJ91 1M1K1 3CCU1 3CCE1 1Q7Y1 3S1MI 5FLMI 2OOXB 3EEDA 2NVXI 1I50I 3NDIA 3CCR1 2RT9A 3CCJZ 3VTNA 2V8KA 3S14I 4MONA 4RVDA 1I3QI 3CCMZ 1QXFA 1YUAA 3GTLI 3CC2Z 3G71Z 1VQN1 5C4XI 5A2Qf 1VQ8Z 2EGTA 2ZAEB 1JJ2Y 3G6E1 1X0TA 1S721 1M901 2VPYA 3J81b 3JAMf 3S1QI 2QA4Z 2E9HA 2V8IA 3J80b 4E30A 1KD11 2WAQA 3J7A4 4DGLA 5IT9b 1VQ7Z 2W04A 1VLAA 4RV9A 3IR7A 3D2LA 2JMOA 1VQ51 3CCRZ 1VQKZ 2F4OA 2BJOA 1K8A2 3P5JB 1VQ4Z 4AYBA 4E33A 3S1RI 2IZ4A 3CQZI 4E2WA 2PK7A 2YU9I 3VMGA 2R92I 1YJN1 3CCQ1 1RO0A 1YIT1 1Q821 1VQNZ 2VF1A 4NB8A 3CPWZ 1NUIA 4A3CI 3CD61 2LIYA 3HOWI 1WJ2A 2JR6A 3NFZA 1SFOI 1RNIA 4DQYB 1Q812 3D6WA 3MZKB 3GTOI 5D1PA 2DE5A 1RLYA 2WB1A 1VQ6Z 3CCJ1 3GCFA 2P28A 2JA8I 4QTUA 3IFUA 2NVQI 3T4NB 3K7AI 3OW2Y 3KIFA 1QVFY 3CCM1 1WW9A 1VQMZ 4A3KI 1YJNZ 4NB9A 3CC21 3G711 1VQ81 2QR1B 5T64A 3BG0B 5IP9I 1W2BZ 2E2II 3CD6Z 1KRLA 2VPXA 2JIQA 1YI2Z 4MRIA 4NBEA 5T6BA 1ZB8A 3NH4A 1ZB9A 2JA6I 3TE5B 4A3II 3I4MI 3CCS1 2V45A 3HOXI 1YIJZ 2M6NA 3IX0A 2QRCB 3IF8A 1VQ71 3MONA 4NOZA 1VQP1 2NAPA 1NP6A 2OTJZ 2J6AA 3CMEZ 3VMIA 1VQK1 5C44I 1VQ41 1QVGZ 3BG1B 1NJI2 1KQSZ 2DE6A 4RVHA 3GTMI 5FLXf 4HGZA 3GTMS 1ZH1A 2OOYB 4A3EI 3I4NI 4A3BI 2HU9A 2GTIA 3CCLZ 1N8R2 2Q51A 1I6HI 4MXUA 4E2XA 4HH4A 1DL6A 4E2YA 2Q4ZA 2OTLZ 1ML8A 3CCSZ 3PO2I 1Y8CA 1PFTA 2KPIA 2QEXZ 4A3GI 4Y52I 1USPA 3HOUI 4NBDA 4A3DI 1VQPZ 1Z01A 1VQ61 3NH8A 2VUMI 1Z02A 4BY1I 1TWCI
chains in the Genus database with same CATH topology
3G4S1 1TWHI 4MD8A 1K8A1 1VQM1 1VQ9Z 3EERA 3CPWY 2RHBA 2QKDA 4DK1A 5A2Qb 3GTKI 4RVGA 3M3YI 1YI21 3HKZA 3JAMb 2K3RA 3LUSA 5CM2M 3CCVZ 1WCMI 2PM9A 5AN9F 3I551 1YIJ1 4BBRI 1K9M2 4XX2A 1Q811 2R6MA 3I56Z 3VMHA 4A3LI 2G2KA 2OTJ1 3RZDI 3CME1 4S1TA 1JWHC 1P9NA 2F4MA 2HF1A 1YUKA 3VB9A 3G4SZ 3NH5A 2AKLA 3PO3I 4NFRA 4RVFA 4A3JI 2GTHA 2M48A 3H0GI 3PO3S 3HOZI 1W2BY 1K732 4TNUA 5D1OA 3CCL1 2P3YA 1N2FA 3CXCZ 1RO4A 1X3WA 3S2DI 2OTL1 3I55Z 2QEX1 2JA7I 1USPB 1QVGY 2GU2A 2O4HA 4NH1C 4A3MI 1KQSY 4NBBA 3J81f 3M4OI 2RIQA 1M1K2 2KI7B 1Q7Y2 2PMZA 1VQLZ 1NJI1 3ESWA 2YADA 1TWGI 3D9XA 1VQ91 2JUBA 5T67A 1VQOZ 1QF8A 4E31A 3S2HI 2B63I 2NVTI 1N8R1 3GTPI 3CCV1 3RZOI 4BY7I 4Y7NI 3F3FC 3I561 4CL1A 1YJWZ 1M902 1TWAI 2IZ3A 4NBGA 4QTTA 2JS4A 4RS4A 1LQLA 4MD7A 1S7MA 3CC71 1JJ2Z 2QLVB 3U50C 1KD12 3S15I 4EWCA 1KC82 4BXXI 3S1NI 3CMA1 1KC81 3CC4Z 5FLXb 1YJ9Z 3CCUZ 4HGYA 3GTJI 3CCEZ 1Y1VI 1TWFI 1Y1VS 2LFUA 5D1OB 1X3ZA 2RBLA 3FQMA 4A3FI 1K83I 3FKII 3KIHA 1RO2A 4BBSI 3H3VJ 1Y1WI 2E2HI 4NBAA 1WIIA 2VUGA 5C4JI 1Q822 2H85A 1YHQ1 2E2JI 4MH4A 1L1OC 3TDHB 3HOVI 5IP7I 3S17I 3NDJA 5LL6f 3HOYI 3MZLB 1K9M1 2I3CA 3F3PC 2V8JA 3QWUA 4A93I 2RPRA 3G6EZ 1S72Z 1Z03A 3CC7Z 4NBFA 3GTQI 1VQL1 4NBCA 3I07A 4E32A 3CMAZ 4X6AI 3Q87A 2JNYA 2NVYI 1VQO1 3GKQA 2OZKA 1R9TI 1VQ5Z 1TFIA 2QRDB 3CXCY 1QYPA 1K731 2QREB 3FQQA 5C3EI 4MD9A 2K5RA 2R7ZI 1YHQZ 3OW2Z 3CCQZ 1YITZ 1QVFZ 1RQFA 2DE7A 1YJW1 3GTGI 4NBHA 1Q862 2QA41 2O53A 2W03A 2Y0SA 2JA5I 3J80f 3S16I 4E2ZA 1Q861 3CC41 2R93I 5IT9f 1YJ91 1M1K1 3CCU1 3CCE1 1Q7Y1 3S1MI 5FLMI 2OOXB 3EEDA 2NVXI 1I50I 3NDIA 3CCR1 2RT9A 3CCJZ 3VTNA 2V8KA 3S14I 4MONA 4RVDA 1I3QI 3CCMZ 1YUAA 3GTLI 3CC2Z 3G71Z 1VQN1 5C4XI 5A2Qf 1VQ8Z 2EGTA 2ZAEB 1JJ2Y 3G6E1 1X0TA 1S721 1M901 3J81b 3JAMf 3S1QI 2QA4Z 2E9HA 2V8IA 3J80b 4E30A 1KD11 2WAQA 3J7A4 4DGLA 5IT9b 1VQ7Z 2W04A 1VLAA 4RV9A 2JMOA 1VQ51 3CCRZ 1VQKZ 2F4OA 2BJOA 1K8A2 3P5JB 1VQ4Z 4AYBA 4E33A 3S1RI 2IZ4A 3CQZI 4E2WA 2PK7A 2YU9I 3VMGA 2R92I 1YJN1 3CCQ1 1RO0A 1YIT1 1Q821 1VQNZ 2VF1A 4NB8A 3CPWZ 1NUIA 4A3CI 3CD61 2LIYA 3HOWI 2JR6A 3NFZA 1SFOI 1RNIA 4DQYB 1Q812 3D6WA 3MZKB 3GTOI 5D1PA 2DE5A 1RLYA 2WB1A 1VQ6Z 3CCJ1 3GCFA 2P28A 2JA8I 4QTUA 3IFUA 2NVQI 3T4NB 3K7AI 3OW2Y 3KIFA 1QVFY 3CCM1 1WW9A 1VQMZ 4A3KI 1YJNZ 4NB9A 3CC21 3G711 1VQ81 2QR1B 5T64A 3BG0B 5IP9I 1W2BZ 2E2II 3CD6Z 1KRLA 1YI2Z 4MRIA 4NBEA 5T6BA 1ZB8A 3NH4A 1ZB9A 2JA6I 3TE5B 4A3II 3I4MI 3CCS1 3HOXI 1YIJZ 2M6NA 3IX0A 2QRCB 3IF8A 1VQ71 3MONA 4NOZA 1VQP1 1NP6A 2OTJZ 2J6AA 3CMEZ 3VMIA 1VQK1 5C44I 1VQ41 1QVGZ 3BG1B 1NJI2 1KQSZ 2DE6A 4RVHA 3GTMI 5FLXf 4HGZA 3GTMS 1ZH1A 2OOYB 4A3EI 3I4NI 4A3BI 2HU9A 2GTIA 3CCLZ 1N8R2 2Q51A 1I6HI 4MXUA 4E2XA 4HH4A 1DL6A 4E2YA 2Q4ZA 2OTLZ 1ML8A 3CCSZ 3PO2I 1PFTA 2KPIA 2QEXZ 4A3GI 4Y52I 1USPA 3HOUI 4NBDA 4A3DI 1VQPZ 1Z01A 1VQ61 3NH8A 2VUMI 1Z02A 4BY1I 1TWCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S 1;  1K8A 1;  1VQM 1;  1N8R 1;  1VQ9 Z;  1Q86 2;  3CCV 1;  2QA4 1;  1VQ6 Z;  3CPW Y;  3CCJ 1;  3I56 1;  1Q86 1;  3CC4 1;  1YJW Z;  1YJ9 1;  1M90 2;  1M1K 1;  3CCU 1;  1YI2 1;  3CCE 1;  3OW2 Y;  1Q7Y 1;  1QVF Y;  3CCM 1;  3CC7 1;  1VQM Z;  1YJN Z;  1JJ2 Z;  1KD1 2;  3CC2 1;  1KC8 2;  3G71 1;  3CCV Z;  3CCR 1;  1VQ8 1;  3I55 1;  1YIJ 1;  3CCJ Z;  1K9M 2;  1Q81 1;  3CMA 1;  1W2B Z;  3I56 Z;  1KC8 1;  3CC4 Z;  3CD6 Z;  1YJ9 Z;  3CCU Z;  1YI2 Z;  3CCE Z;  2OTJ 1;  3CME 1;  3CCM Z;  3CC2 Z;  3G71 Z;  1VQN 1;  3CCS 1;  1VQ8 Z;  1YIJ Z;  1JJ2 Y;  3G4S Z;  1VQ7 1;  3G6E 1;  1S72 1;  1M90 1;  1VQP 1;  1Q82 2;  2QA4 Z;  1YHQ 1;  3CME Z;  2OTJ Z;  1W2B Y;  1VQK 1;  1K73 2;  1VQ4 1;  1QVG Z;  1NJI 2;  1KD1 1;  3CCL 1;  1KQS Z;  1K9M 1;  1VQ7 Z;  3CXC Z;  3G6E Z;  1S72 Z;  3CC7 Z;  1VQ5 1;  3CCR Z;  2OTL 1;  1VQK Z;  3I55 Z;  2QEX 1;  1VQL 1;  1K8A 2;  1VQ4 Z;  3CMA Z;  3CCL Z;  1N8R 2;  1QVG Y;  1VQO 1;  1YJN 1;  1KQS Y;  3CCQ 1;  1YIT 1;  1M1K 2;  1VQ5 Z;  1Q82 1;  2OTL Z;  1VQN Z;  3CXC Y;  3CCS Z;  1Q7Y 2;  1K73 1;  2QEX Z;  1VQL Z;  3CPW Z;  3CD6 1;  1NJI 1;  1VQ9 1;  1VQP Z;  1VQ6 1;  1YHQ Z;  3OW2 Z;  1VQO Z;  1Q81 2;  3CCQ Z;  1YIT Z;  1QVF Z;  1YJW 1; 
#chains in the Genus database with same CATH topology
 3G4S 1;  1TWH I;  4MD8 A;  1K8A 1;  1VQM 1;  1VQ9 Z;  3EER A;  3CPW Y;  2RHB A;  2QKD A;  4DK1 A;  5A2Q b;  3GTK I;  4RVG A;  3M3Y I;  1YI2 1;  3HKZ A;  3JAM b;  2K3R A;  3LUS A;  5CM2 M;  2JIR A;  3CCV Z;  1WCM I;  2JIM A;  2PM9 A;  5AN9 F;  3I55 1;  1YIJ 1;  4BBR I;  1K9M 2;  4XX2 A;  1Q81 1;  2R6M A;  3I56 Z;  3VMH A;  4A3L I;  2G2K A;  2OTJ 1;  2VPW A;  3RZD I;  3CME 1;  4S1T A;  1JWH C;  1P9N A;  2F4M A;  2HF1 A;  1YUK A;  3VB9 A;  2JIP A;  3G4S Z;  2VPZ A;  3NH5 A;  2AKL A;  3PO3 I;  4NFR A;  4RVF A;  4A3J I;  2GTH A;  2M48 A;  3H0G I;  3PO3 S;  3HOZ I;  1W2B Y;  1K73 2;  4TNU A;  5D1O A;  3CCL 1;  2P3Y A;  1N2F A;  3CXC Z;  1RO4 A;  1X3W A;  3S2D I;  2OTL 1;  3I55 Z;  2QEX 1;  2JA7 I;  1USP B;  1QVG Y;  2GU2 A;  2O4H A;  4NH1 C;  4A3M I;  1KQS Y;  4NBB A;  3J81 f;  3M4O I;  2RIQ A;  1M1K 2;  2KI7 B;  1Q7Y 2;  2PMZ A;  1VQL Z;  1NJI 1;  3ESW A;  2YAD A;  1TWG I;  3D9X A;  1VQ9 1;  2JUB A;  5T67 A;  1FDO A;  2IV2 X;  1VQO Z;  1QF8 A;  4E31 A;  3S2H I;  2B63 I;  2NVT I;  1N8R 1;  3GTP I;  3CCV 1;  2AYD A;  3RZO I;  4BY7 I;  4Y7N I;  3F3F C;  3I56 1;  4CL1 A;  1YJW Z;  1M90 2;  1TWA I;  2IZ3 A;  1WZN A;  4NBG A;  4QTT A;  2JS4 A;  4RS4 A;  1LQL A;  4MD7 A;  1S7M A;  3CC7 1;  1JJ2 Z;  2QLV B;  3U50 C;  1KD1 2;  3S15 I;  4EWC A;  1KC8 2;  4BXX I;  3S1N I;  3CMA 1;  1KC8 1;  3CC4 Z;  5FLX b;  1YJ9 Z;  3CCU Z;  4HGY A;  3GTJ I;  3CCE Z;  1Y1V I;  1TWF I;  1Y1V S;  2LFU A;  5D1O B;  1SIW A;  1X3Z A;  2RBL A;  3FQM A;  4A3F I;  1K83 I;  3FKI I;  3KIH A;  1RO2 A;  1AA6 A;  2JIO A;  3H3V J;  4BBS I;  2LEX A;  1Y1W I;  2E2H I;  4NBA A;  1WII A;  2VUG A;  5C4J I;  1Q82 2;  2H85 A;  1YHQ 1;  2E2J I;  4MH4 A;  1L1O C;  3TDH B;  3HOV I;  5IP7 I;  3S17 I;  3NDJ A;  5LL6 f;  3HOY I;  3MZL B;  1K9M 1;  2I3C A;  3F3P C;  2V8J A;  3QWU A;  4A93 I;  2RPR A;  3G6E Z;  1S72 Z;  1Z03 A;  3CC7 Z;  4NBF A;  3GTQ I;  1VQL 1;  4NBC A;  3I07 A;  4E32 A;  3CMA Z;  4X6A I;  3Q87 A;  2JNY A;  2NVY I;  1VQO 1;  3GKQ A;  1FDI A;  2OZK A;  1R9T I;  1VQ5 Z;  1TFI A;  2QRD B;  3CXC Y;  1QYP A;  1K73 1;  2QRE B;  3FQQ A;  5C3E I;  4MD9 A;  2K5R A;  2R7Z I;  1YHQ Z;  2E7Z A;  3OW2 Z;  3CCQ Z;  2V3V A;  1YIT Z;  1QVF Z;  1RQF A;  2DE7 A;  1YJW 1;  3GTG I;  4NBH A;  1Q86 2;  1Q16 A;  2QA4 1;  2O53 A;  2W03 A;  2Y0S A;  2JA5 I;  3J80 f;  3S16 I;  4E2Z A;  1Q86 1;  3CC4 1;  2R93 I;  5IT9 f;  1YJ9 1;  1M1K 1;  3CCU 1;  3CCE 1;  1Q7Y 1;  3S1M I;  5FLM I;  2OOX B;  3EED A;  2NVX I;  1I50 I;  3NDI A;  3CCR 1;  2RT9 A;  3CCJ Z;  3VTN A;  2V8K A;  3S14 I;  4MON A;  4RVD A;  1I3Q I;  3CCM Z;  1QXF A;  1YUA A;  3GTL I;  3CC2 Z;  3G71 Z;  1VQN 1;  5C4X I;  5A2Q f;  1VQ8 Z;  2EGT A;  2ZAE B;  1JJ2 Y;  3G6E 1;  1X0T A;  1S72 1;  1M90 1;  2VPY A;  3J81 b;  3JAM f;  3S1Q I;  2QA4 Z;  2E9H A;  2V8I A;  3J80 b;  4E30 A;  1KD1 1;  2WAQ A;  3J7A 4;  4DGL A;  5IT9 b;  1VQ7 Z;  2W04 A;  1VLA A;  4RV9 A;  3IR7 A;  3D2L A;  2JMO A;  1VQ5 1;  3CCR Z;  1VQK Z;  2F4O A;  2BJO A;  1K8A 2;  3P5J B;  1VQ4 Z;  4AYB A;  4E33 A;  3S1R I;  2IZ4 A;  3CQZ I;  4E2W A;  2PK7 A;  2YU9 I;  3VMG A;  2R92 I;  1YJN 1;  3CCQ 1;  1RO0 A;  1YIT 1;  1Q82 1;  1VQN Z;  2VF1 A;  4NB8 A;  3CPW Z;  1NUI A;  4A3C I;  3CD6 1;  2LIY A;  3HOW I;  1WJ2 A;  2JR6 A;  3NFZ A;  1SFO I;  1RNI A;  4DQY B;  1Q81 2;  3D6W A;  3MZK B;  3GTO I;  5D1P A;  2DE5 A;  1RLY A;  2WB1 A;  1VQ6 Z;  3CCJ 1;  3GCF A;  2P28 A;  2JA8 I;  4QTU A;  3IFU A;  2NVQ I;  3T4N B;  3K7A I;  3OW2 Y;  3KIF A;  1QVF Y;  3CCM 1;  1WW9 A;  1VQM Z;  4A3K I;  1YJN Z;  4NB9 A;  3CC2 1;  3G71 1;  1VQ8 1;  2QR1 B;  5T64 A;  3BG0 B;  5IP9 I;  1W2B Z;  2E2I I;  3CD6 Z;  1KRL A;  2VPX A;  2JIQ A;  1YI2 Z;  4MRI A;  4NBE A;  5T6B A;  1ZB8 A;  3NH4 A;  1ZB9 A;  2JA6 I;  3TE5 B;  4A3I I;  3I4M I;  3CCS 1;  2V45 A;  3HOX I;  1YIJ Z;  2M6N A;  3IX0 A;  2QRC B;  3IF8 A;  1VQ7 1;  3MON A;  4NOZ A;  1VQP 1;  2NAP A;  1NP6 A;  2OTJ Z;  2J6A A;  3CME Z;  3VMI A;  1VQK 1;  5C44 I;  1VQ4 1;  1QVG Z;  3BG1 B;  1NJI 2;  1KQS Z;  2DE6 A;  4RVH A;  3GTM I;  5FLX f;  4HGZ A;  3GTM S;  1ZH1 A;  2OOY B;  4A3E I;  3I4N I;  4A3B I;  2HU9 A;  2GTI A;  3CCL Z;  1N8R 2;  2Q51 A;  1I6H I;  4MXU A;  4E2X A;  4HH4 A;  1DL6 A;  4E2Y A;  2Q4Z A;  2OTL Z;  1ML8 A;  3CCS Z;  3PO2 I;  1Y8C A;  1PFT A;  2KPI A;  2QEX Z;  4A3G I;  4Y52 I;  1USP A;  3HOU I;  4NBD A;  4A3D I;  1VQP Z;  1Z01 A;  1VQ6 1;  3NH8 A;  2VUM I;  1Z02 A;  4BY1 I;  1TWC I; 
#chains in the Genus database with same CATH homology
 3G4S 1;  1TWH I;  4MD8 A;  1K8A 1;  1VQM 1;  1VQ9 Z;  3EER A;  3CPW Y;  2RHB A;  2QKD A;  4DK1 A;  5A2Q b;  3GTK I;  4RVG A;  3M3Y I;  1YI2 1;  3HKZ A;  3JAM b;  2K3R A;  3LUS A;  5CM2 M;  3CCV Z;  1WCM I;  2PM9 A;  5AN9 F;  3I55 1;  1YIJ 1;  4BBR I;  1K9M 2;  4XX2 A;  1Q81 1;  2R6M A;  3I56 Z;  3VMH A;  4A3L I;  2G2K A;  2OTJ 1;  3RZD I;  3CME 1;  4S1T A;  1JWH C;  1P9N A;  2F4M A;  2HF1 A;  1YUK A;  3VB9 A;  3G4S Z;  3NH5 A;  2AKL A;  3PO3 I;  4NFR A;  4RVF A;  4A3J I;  2GTH A;  2M48 A;  3H0G I;  3PO3 S;  3HOZ I;  1W2B Y;  1K73 2;  4TNU A;  5D1O A;  3CCL 1;  2P3Y A;  1N2F A;  3CXC Z;  1RO4 A;  1X3W A;  3S2D I;  2OTL 1;  3I55 Z;  2QEX 1;  2JA7 I;  1USP B;  1QVG Y;  2GU2 A;  2O4H A;  4NH1 C;  4A3M I;  1KQS Y;  4NBB A;  3J81 f;  3M4O I;  2RIQ A;  1M1K 2;  2KI7 B;  1Q7Y 2;  2PMZ A;  1VQL Z;  1NJI 1;  3ESW A;  2YAD A;  1TWG I;  3D9X A;  1VQ9 1;  2JUB A;  5T67 A;  1VQO Z;  1QF8 A;  4E31 A;  3S2H I;  2B63 I;  2NVT I;  1N8R 1;  3GTP I;  3CCV 1;  3RZO I;  4BY7 I;  4Y7N I;  3F3F C;  3I56 1;  4CL1 A;  1YJW Z;  1M90 2;  1TWA I;  2IZ3 A;  4NBG A;  4QTT A;  2JS4 A;  4RS4 A;  1LQL A;  4MD7 A;  1S7M A;  3CC7 1;  1JJ2 Z;  2QLV B;  3U50 C;  1KD1 2;  3S15 I;  4EWC A;  1KC8 2;  4BXX I;  3S1N I;  3CMA 1;  1KC8 1;  3CC4 Z;  5FLX b;  1YJ9 Z;  3CCU Z;  4HGY A;  3GTJ I;  3CCE Z;  1Y1V I;  1TWF I;  1Y1V S;  2LFU A;  5D1O B;  1X3Z A;  2RBL A;  3FQM A;  4A3F I;  1K83 I;  3FKI I;  3KIH A;  1RO2 A;  4BBS I;  3H3V J;  1Y1W I;  2E2H I;  4NBA A;  1WII A;  2VUG A;  5C4J I;  1Q82 2;  2H85 A;  1YHQ 1;  2E2J I;  4MH4 A;  1L1O C;  3TDH B;  3HOV I;  5IP7 I;  3S17 I;  3NDJ A;  5LL6 f;  3HOY I;  3MZL B;  1K9M 1;  2I3C A;  3F3P C;  2V8J A;  3QWU A;  4A93 I;  2RPR A;  3G6E Z;  1S72 Z;  1Z03 A;  3CC7 Z;  4NBF A;  3GTQ I;  1VQL 1;  4NBC A;  3I07 A;  4E32 A;  3CMA Z;  4X6A I;  3Q87 A;  2JNY A;  2NVY I;  1VQO 1;  3GKQ A;  2OZK A;  1R9T I;  1VQ5 Z;  1TFI A;  2QRD B;  3CXC Y;  1QYP A;  1K73 1;  2QRE B;  3FQQ A;  5C3E I;  4MD9 A;  2K5R A;  2R7Z I;  1YHQ Z;  3OW2 Z;  3CCQ Z;  1YIT Z;  1QVF Z;  1RQF A;  2DE7 A;  1YJW 1;  3GTG I;  4NBH A;  1Q86 2;  2QA4 1;  2O53 A;  2W03 A;  2Y0S A;  2JA5 I;  3J80 f;  3S16 I;  4E2Z A;  1Q86 1;  3CC4 1;  2R93 I;  5IT9 f;  1YJ9 1;  1M1K 1;  3CCU 1;  3CCE 1;  1Q7Y 1;  3S1M I;  5FLM I;  2OOX B;  3EED A;  2NVX I;  1I50 I;  3NDI A;  3CCR 1;  2RT9 A;  3CCJ Z;  3VTN A;  2V8K A;  3S14 I;  4MON A;  4RVD A;  1I3Q I;  3CCM Z;  1YUA A;  3GTL I;  3CC2 Z;  3G71 Z;  1VQN 1;  5C4X I;  5A2Q f;  1VQ8 Z;  2EGT A;  2ZAE B;  1JJ2 Y;  3G6E 1;  1X0T A;  1S72 1;  1M90 1;  3J81 b;  3JAM f;  3S1Q I;  2QA4 Z;  2E9H A;  2V8I A;  3J80 b;  4E30 A;  1KD1 1;  2WAQ A;  3J7A 4;  4DGL A;  5IT9 b;  1VQ7 Z;  2W04 A;  1VLA A;  4RV9 A;  2JMO A;  1VQ5 1;  3CCR Z;  1VQK Z;  2F4O A;  2BJO A;  1K8A 2;  3P5J B;  1VQ4 Z;  4AYB A;  4E33 A;  3S1R I;  2IZ4 A;  3CQZ I;  4E2W A;  2PK7 A;  2YU9 I;  3VMG A;  2R92 I;  1YJN 1;  3CCQ 1;  1RO0 A;  1YIT 1;  1Q82 1;  1VQN Z;  2VF1 A;  4NB8 A;  3CPW Z;  1NUI A;  4A3C I;  3CD6 1;  2LIY A;  3HOW I;  2JR6 A;  3NFZ A;  1SFO I;  1RNI A;  4DQY B;  1Q81 2;  3D6W A;  3MZK B;  3GTO I;  5D1P A;  2DE5 A;  1RLY A;  2WB1 A;  1VQ6 Z;  3CCJ 1;  3GCF A;  2P28 A;  2JA8 I;  4QTU A;  3IFU A;  2NVQ I;  3T4N B;  3K7A I;  3OW2 Y;  3KIF A;  1QVF Y;  3CCM 1;  1WW9 A;  1VQM Z;  4A3K I;  1YJN Z;  4NB9 A;  3CC2 1;  3G71 1;  1VQ8 1;  2QR1 B;  5T64 A;  3BG0 B;  5IP9 I;  1W2B Z;  2E2I I;  3CD6 Z;  1KRL A;  1YI2 Z;  4MRI A;  4NBE A;  5T6B A;  1ZB8 A;  3NH4 A;  1ZB9 A;  2JA6 I;  3TE5 B;  4A3I I;  3I4M I;  3CCS 1;  3HOX I;  1YIJ Z;  2M6N A;  3IX0 A;  2QRC B;  3IF8 A;  1VQ7 1;  3MON A;  4NOZ A;  1VQP 1;  1NP6 A;  2OTJ Z;  2J6A A;  3CME Z;  3VMI A;  1VQK 1;  5C44 I;  1VQ4 1;  1QVG Z;  3BG1 B;  1NJI 2;  1KQS Z;  2DE6 A;  4RVH A;  3GTM I;  5FLX f;  4HGZ A;  3GTM S;  1ZH1 A;  2OOY B;  4A3E I;  3I4N I;  4A3B I;  2HU9 A;  2GTI A;  3CCL Z;  1N8R 2;  2Q51 A;  1I6H I;  4MXU A;  4E2X A;  4HH4 A;  1DL6 A;  4E2Y A;  2Q4Z A;  2OTL Z;  1ML8 A;  3CCS Z;  3PO2 I;  1PFT A;  2KPI A;  2QEX Z;  4A3G I;  4Y52 I;  1USP A;  3HOU I;  4NBD A;  4A3D I;  1VQP Z;  1Z01 A;  1VQ6 1;  3NH8 A;  2VUM I;  1Z02 A;  4BY1 I;  1TWC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...