1QVFZ

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qvfZ00
1VQLZ 1VQ7Z 2OTL1 1K9M2 1VQ41 3G6EZ 1K8A1 1QVGZ 1YIT1 1YJ9Z 1Q811 1KC82 3CCQZ 3G711 1VQN1 3CCLZ 1M901 1NJI2 1VQ91 3CC71 3CMA1 3G4SZ 1KD12 3CC21 3CPWY 1VQOZ 3CCEZ 3CCRZ 1W2BY 1Q821 3CC4Z 1YHQZ 1YI2Z 3CCS1 1YIJ1 1VQ5Z 3CXCY 1VQP1 3CCV1 1YJW1 3CCJ1 1VQ61 1S72Z 3I561 2QA4Z 3CPWZ 1Q7Y2 2QEXZ 3CD6Z 3G4S1 1VQK1 1KC81 1W2BZ 1KQSY 2OTJZ 1VQO1 1K732 3I551 1NJI1 1VQM1 3CMEZ 3CCMZ 3CXCZ 1M1K2 1KD11 1YJNZ 1VQL1 1VQ71 1JJ2Y 1VQ8Z 3G6E1 1N8R2 1KQSZ 1YJ91 3CCQ1 3CCUZ 3CCL1 1K9M1 2OTLZ 1M902 1Q7Y1 1VQ4Z 3OW2Y 1Q862 1JJ2Z 3G71Z 3CCE1 3CCR1 1K731 1VQ9Z 3CC7Z 3CC41 1YHQ1 1YI21 1M1K1 3CMAZ 1QVFY 3CC2Z 1VQ51 3OW2Z 3CCU1 1S721 2QA41 1N8R1 1K8A2 2QEX1 3CD61 1Q812 3CCSZ 1YIJZ 1VQPZ 3CCVZ 1YJWZ 2OTJ1 3CCJZ 1VQ6Z 1QVFZ 3I56Z 3CME1 3CCM1 1YITZ 1Q861 1YJN1 1VQKZ 1QVGY 1VQNZ 3I55Z 1VQ81 1VQMZ 1Q822
chains in the Genus database with same CATH superfamily
2WB1A 1VQLZ 1VQ7Z 1DL6A 4AYBA 5IP7I 3U50C 1QVGZ 2IZ3A 1P9NA 3CCQZ 2Y0SA 3CCLZ 3NDJA 2G2KA 3GKQA 3VMGA 2IV2X 3HOVI 3CQZI 4E2YA 3CC21 3D6WA 2KI7B 1PFTA 1VQOZ 2DE6A 3CCRZ 5T6BA 1Q821 1YHQZ 2JA6I 1YI2Z 2JS4A 4QTUA 1KRLA 3F3PC 5A2Qf 3CXCY 3CCV1 3J7A4 3I561 2F4OA 5A2Qb 1TWCI 2QA4Z 3CPWZ 4A3LI 1VQK1 3GTLI 3BG0B 3I551 3PO2I 1NJI1 3CCMZ 3VTNA 1USPA 2EGTA 1ML8A 1VQL1 1VQ71 3S16I 2NAPA 1KQSZ 1Z02A 3IF8A 4E32A 1TWHI 1TWGI 3CCQ1 2H85A 3EEDA 2OOYB 3CCL1 1K9M1 1VLAA 3S2DI 2VUGA 1Q7Y1 1JJ2Z 1TWAI 3FQMA 3G71Z 3H3VJ 2KPIA 2P3YA 3CCR1 4MONA 1QXFA 4EWCA 2GU2A 4MXUA 3CC7Z 4A3FI 1YHQ1 1YI21 2RT9A 1AA6A 3I07A 3EERA 2R7ZI 1QYPA 3NDIA 2QA41 3FQQA 2QRDB 4A3II 1Q812 2PMZA 1I50I 1QVFZ 1WJ2A 2R93I 3CCM1 4DGLA 2R92I 3HKZA 4NBBA 1X3ZA 4HGZA 2E2HI 4E30A 3M4OI 3S1NI 3NH8A 2LIYA 5FLMI 1JWHC 2YADA 1K8A1 2R6MA 4MD9A 1YIT1 4BY1I 2IZ4A 2DE5A 3G711 3KIFA 2YU9I 1ZB9A 3CC71 2VPYA 4XX2A 4NBGA 2GTHA 1KD12 2JA8I 4RVDA 5IT9f 2F4MA 4S1TA 1W2BY 5IT9b 1RQFA 3VB9A 2M6NA 2WAQA 2RPRA 1RO0A 1YUKA 2AKLA 1FDIA 3GCFA 2NVQI 3P5JB 4E33A 4A3DI 3S17I 4MRIA 4A3KI 2JA5I 2M48A 2W04A 1Y1VS 2V8JA 2JMOA 5C3EI 3CMEZ 3CXCZ 1M1K2 4A3GI 1I3QI 2Q4ZA 3GTGI 2LEXA 5LL6f 1N8R2 2Q51A 1Q16A 1WZNA 5IP9I 5T64A 1VQ4Z 4BBSI 3NH4A 2V8KA 3KIHA 1RO4A 2E2II 2DE7A 1X0TA 2JIRA 2K3RA 4RVHA 3FKII 1LQLA 2O4HA 1ZH1A 1YIJZ 1L1OC 5AN9F 2QRCB 3CME1 3TDHB 1YITZ 3VMIA 4MD8A 4MD7A 2I3CA 4QTTA 3HOUI 5D1OB 4A3JI 1SIWA 2BJOA 3Q87A 1K9M2 2NVYI 3J80f 1VQ41 2AYDA 5FLXf 4RV9A 4E31A 3T4NB 3J80b 1Q811 1KC82 5FLXb 4A3EI 2JNYA 1M901 4A93I 1WCMI 3IFUA 4Y52I 2K5RA 4X6AI 4NOZA 2RHBA 1X3WA 2VPZA 1Z01A 1YIJ1 2HF1A 3HOXI 2VUMI 3I4NI 3G4S1 1W2BZ 2E2JI 4NBDA 1K732 3JAMf 2J6AA 2QR1B 3GTOI 3JAMb 1NUIA 2JIQA 1YJNZ 1KD11 3PO3S 3J81f 3K7AI 1WIIA 4BBRI 4HGYA 1VQ8Z 3MZLB 3J81b 3HOZI 4NBHA 1S7MA 2V45A 2OTLZ 1TWFI 3OW2Y 1Q862 2HU9A 1Y1VI 1Z03A 1NP6A 1I6HI 2VPWA 1VQ9Z 3RZDI 4DQYB 1M1K1 3CMAZ 3RZOI 3GTMS 4E2ZA 3CCU1 1YUAA 4NB8A 1N8R1 5C4JI 4A3CI 2E7ZA 3CCSZ 4A3BI 1R9TI 2RIQA 1VQPZ 1YJWZ 2JUBA 3CCJZ 1VQ6Z 3GTQI 2VPXA 3BG1B 4RVFA 3ESWA 4RS4A 1YJN1 4Y7NI 4NBEA 1QVGY 4NH1C 4E2WA 1VQ81 2O53A 1VQMZ 1Q822 2PK7A 2LFUA 5C4XI 1RLYA 3MONA 2OTL1 2VF1A 2NVXI 3S1RI 2B63I 3D2LA 3G6EZ 3IR7A 1YJ9Z 2NVTI 3I4MI 3S14I 4DK1A 1VQN1 1NJI2 1VQ91 3GTKI 2QKDA 5C44I 4NFRA 3CMA1 3G4SZ 3CPWY 3CCEZ 3GTPI 3S1MI 2W03A 3NH5A 3CC4Z 2JIMA 3LUSA 2GTIA 3CCS1 1WW9A 4BXXI 1VQ5Z 1VQP1 5D1PA 1YJW1 2E9HA 3CCJ1 4HH4A 1VQ61 1S72Z 2ZAEB 1K83I 4CL1A 3S15I 2RBLA 4BY7I 1Q7Y2 1SFOI 2QEXZ 3CD6Z 2V8IA 3F3FC 1KC81 1KQSY 4MH4A 2QREB 1VQO1 2OTJZ 1QF8A 1VQM1 1Y8CA 4RVGA 3MZKB 2JA7I 3S1QI 1Y1WI 3HOWI 3S2HI 2V3VA 1JJ2Y 4NBFA 3G6E1 2JR6A 3M3YI 1YJ91 1RNIA 3CCUZ 1TFIA 3QWUA 1RO2A 3NFZA 1M902 2JIOA 5CM2M 5T67A 3CCE1 1K731 3CC41 3PO3I 1QVFY 3CC2Z 4NB9A 2PM9A 1VQ51 3OW2Z 3IX0A 1S721 3HOYI 5D1OA 2QLVB 1K8A2 2QEX1 3CD61 2JIPA 3GTJI 4A3MI 3H0GI 1ZB8A 3CCVZ 2OTJ1 3I56Z 3TE5B 2P28A 1Q861 1USPB 1N2FA 4NBAA 3D9XA 1VQKZ 2OZKA 1VQNZ 2OOXB 4NBCA 3I55Z 4E2XA 4TNUA 3GTMI 1FDOA 3VMHA
chains in the Genus database with same CATH topology
2WB1A 1VQLZ 1VQ7Z 1DL6A 4AYBA 5IP7I 3U50C 1QVGZ 2IZ3A 1P9NA 3CCQZ 2Y0SA 3CCLZ 3NDJA 2G2KA 3GKQA 3VMGA 3HOVI 3CQZI 4E2YA 3CC21 3D6WA 2KI7B 1PFTA 1VQOZ 2DE6A 3CCRZ 5T6BA 1Q821 1YHQZ 2JA6I 1YI2Z 2JS4A 4QTUA 1KRLA 3F3PC 5A2Qf 3CXCY 3CCV1 3J7A4 3I561 2F4OA 5A2Qb 1TWCI 2QA4Z 3CPWZ 4A3LI 1VQK1 3GTLI 3BG0B 3I551 3PO2I 1NJI1 3CCMZ 3VTNA 1USPA 2EGTA 1ML8A 1VQL1 1VQ71 3S16I 1KQSZ 1Z02A 3IF8A 4E32A 1TWHI 1TWGI 3CCQ1 2H85A 3EEDA 2OOYB 3CCL1 1K9M1 1VLAA 3S2DI 2VUGA 1Q7Y1 1JJ2Z 1TWAI 3FQMA 3G71Z 3H3VJ 2KPIA 2P3YA 3CCR1 4MONA 4EWCA 2GU2A 4MXUA 3CC7Z 4A3FI 1YHQ1 1YI21 2RT9A 3I07A 3EERA 2R7ZI 1QYPA 3NDIA 2QA41 3FQQA 2QRDB 4A3II 1Q812 2PMZA 1I50I 1QVFZ 2R93I 3CCM1 4DGLA 2R92I 3HKZA 4NBBA 1X3ZA 4HGZA 2E2HI 4E30A 3M4OI 3S1NI 3NH8A 2LIYA 5FLMI 1JWHC 2YADA 1K8A1 2R6MA 4MD9A 1YIT1 4BY1I 2IZ4A 2DE5A 3G711 3KIFA 2YU9I 1ZB9A 3CC71 4XX2A 4NBGA 2GTHA 1KD12 2JA8I 4RVDA 5IT9f 2F4MA 4S1TA 1W2BY 5IT9b 1RQFA 3VB9A 2M6NA 2WAQA 2RPRA 1RO0A 1YUKA 2AKLA 3GCFA 2NVQI 3P5JB 4E33A 4A3DI 3S17I 4MRIA 4A3KI 2JA5I 2M48A 2W04A 1Y1VS 2V8JA 2JMOA 5C3EI 3CMEZ 3CXCZ 1M1K2 4A3GI 1I3QI 2Q4ZA 3GTGI 5LL6f 1N8R2 2Q51A 5IP9I 5T64A 1VQ4Z 4BBSI 3NH4A 2V8KA 3KIHA 1RO4A 2E2II 2DE7A 1X0TA 2K3RA 4RVHA 3FKII 1LQLA 2O4HA 1ZH1A 1YIJZ 1L1OC 5AN9F 2QRCB 3CME1 3TDHB 1YITZ 3VMIA 4MD8A 4MD7A 2I3CA 4QTTA 3HOUI 5D1OB 4A3JI 2BJOA 3Q87A 1K9M2 2NVYI 3J80f 1VQ41 5FLXf 4RV9A 4E31A 3T4NB 3J80b 1Q811 1KC82 5FLXb 4A3EI 2JNYA 1M901 4A93I 1WCMI 3IFUA 4Y52I 2K5RA 4X6AI 4NOZA 2RHBA 1X3WA 1Z01A 1YIJ1 2HF1A 3HOXI 2VUMI 3I4NI 3G4S1 1W2BZ 2E2JI 4NBDA 1K732 3JAMf 2J6AA 2QR1B 3GTOI 3JAMb 1NUIA 1KD11 1YJNZ 3PO3S 3J81f 3K7AI 1WIIA 4BBRI 4HGYA 1VQ8Z 3MZLB 3J81b 3HOZI 4NBHA 1S7MA 2OTLZ 1TWFI 3OW2Y 1Q862 2HU9A 1Y1VI 1Z03A 1NP6A 1I6HI 1VQ9Z 3RZDI 4DQYB 1M1K1 3CMAZ 3RZOI 3GTMS 4E2ZA 3CCU1 1YUAA 4NB8A 1N8R1 5C4JI 4A3CI 3CCSZ 4A3BI 1R9TI 2RIQA 1VQPZ 1YJWZ 2JUBA 3CCJZ 1VQ6Z 3GTQI 3BG1B 4RVFA 3ESWA 4RS4A 1YJN1 4Y7NI 4NBEA 1QVGY 4NH1C 4E2WA 1VQ81 2O53A 1VQMZ 1Q822 2PK7A 2LFUA 5C4XI 1RLYA 3MONA 2OTL1 2VF1A 2NVXI 3S1RI 2B63I 3G6EZ 1YJ9Z 2NVTI 3I4MI 3S14I 4DK1A 1VQN1 1NJI2 1VQ91 3GTKI 2QKDA 5C44I 4NFRA 3CMA1 3G4SZ 3CPWY 3CCEZ 3GTPI 3S1MI 2W03A 3NH5A 3CC4Z 3LUSA 2GTIA 3CCS1 1WW9A 4BXXI 1VQ5Z 1VQP1 5D1PA 1YJW1 2E9HA 3CCJ1 4HH4A 1VQ61 1S72Z 2ZAEB 1K83I 4CL1A 3S15I 2RBLA 4BY7I 1Q7Y2 1SFOI 2QEXZ 3CD6Z 2V8IA 3F3FC 1KC81 1KQSY 4MH4A 2QREB 1VQO1 2OTJZ 1QF8A 1VQM1 4RVGA 3MZKB 2JA7I 3S1QI 1Y1WI 3HOWI 3S2HI 1JJ2Y 4NBFA 3G6E1 2JR6A 3M3YI 1YJ91 1RNIA 3CCUZ 1TFIA 3QWUA 1RO2A 3NFZA 1M902 5CM2M 5T67A 3CCE1 1K731 3CC41 3PO3I 1QVFY 3CC2Z 4NB9A 2PM9A 1VQ51 3OW2Z 3IX0A 1S721 3HOYI 5D1OA 2QLVB 1K8A2 2QEX1 3CD61 3GTJI 4A3MI 3H0GI 1ZB8A 3CCVZ 2OTJ1 3I56Z 3TE5B 2P28A 1Q861 1USPB 1N2FA 4NBAA 3D9XA 1VQKZ 2OZKA 1VQNZ 2OOXB 4NBCA 3I55Z 4E2XA 4TNUA 3GTMI 3VMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Z;  1VQ7 Z;  2OTL 1;  1K9M 2;  1VQ4 1;  3G6E Z;  1K8A 1;  1QVG Z;  1YIT 1;  1YJ9 Z;  1Q81 1;  1KC8 2;  3CCQ Z;  3G71 1;  1VQN 1;  3CCL Z;  1M90 1;  1NJI 2;  1VQ9 1;  3CC7 1;  3CMA 1;  3G4S Z;  1KD1 2;  3CC2 1;  3CPW Y;  1VQO Z;  3CCE Z;  3CCR Z;  1W2B Y;  1Q82 1;  3CC4 Z;  1YHQ Z;  1YI2 Z;  3CCS 1;  1YIJ 1;  1VQ5 Z;  3CXC Y;  1VQP 1;  3CCV 1;  1YJW 1;  3CCJ 1;  1VQ6 1;  1S72 Z;  3I56 1;  2QA4 Z;  3CPW Z;  1Q7Y 2;  2QEX Z;  3CD6 Z;  3G4S 1;  1VQK 1;  1KC8 1;  1W2B Z;  1KQS Y;  2OTJ Z;  1VQO 1;  1K73 2;  3I55 1;  1NJI 1;  1VQM 1;  3CME Z;  3CCM Z;  3CXC Z;  1M1K 2;  1KD1 1;  1YJN Z;  1VQL 1;  1VQ7 1;  1JJ2 Y;  1VQ8 Z;  3G6E 1;  1N8R 2;  1KQS Z;  1YJ9 1;  3CCQ 1;  3CCU Z;  3CCL 1;  1K9M 1;  2OTL Z;  1M90 2;  1Q7Y 1;  1VQ4 Z;  3OW2 Y;  1Q86 2;  1JJ2 Z;  3G71 Z;  3CCE 1;  3CCR 1;  1K73 1;  1VQ9 Z;  3CC7 Z;  3CC4 1;  1YHQ 1;  1YI2 1;  1M1K 1;  3CMA Z;  1QVF Y;  3CC2 Z;  1VQ5 1;  3OW2 Z;  3CCU 1;  1S72 1;  2QA4 1;  1N8R 1;  1K8A 2;  2QEX 1;  3CD6 1;  1Q81 2;  3CCS Z;  1YIJ Z;  1VQP Z;  3CCV Z;  1YJW Z;  2OTJ 1;  3CCJ Z;  1VQ6 Z;  1QVF Z;  3I56 Z;  3CME 1;  3CCM 1;  1YIT Z;  1Q86 1;  1YJN 1;  1VQK Z;  1QVG Y;  1VQN Z;  3I55 Z;  1VQ8 1;  1VQM Z;  1Q82 2; 
#chains in the Genus database with same CATH topology
 2WB1 A;  1VQL Z;  1VQ7 Z;  1DL6 A;  4AYB A;  5IP7 I;  3U50 C;  1QVG Z;  2IZ3 A;  1P9N A;  3CCQ Z;  2Y0S A;  3CCL Z;  3NDJ A;  2G2K A;  3GKQ A;  3VMG A;  2IV2 X;  3HOV I;  3CQZ I;  4E2Y A;  3CC2 1;  3D6W A;  2KI7 B;  1PFT A;  1VQO Z;  2DE6 A;  3CCR Z;  5T6B A;  1Q82 1;  1YHQ Z;  2JA6 I;  1YI2 Z;  2JS4 A;  4QTU A;  1KRL A;  3F3P C;  5A2Q f;  3CXC Y;  3CCV 1;  3J7A 4;  3I56 1;  2F4O A;  5A2Q b;  1TWC I;  2QA4 Z;  3CPW Z;  4A3L I;  1VQK 1;  3GTL I;  3BG0 B;  3I55 1;  3PO2 I;  1NJI 1;  3CCM Z;  3VTN A;  1USP A;  2EGT A;  1ML8 A;  1VQL 1;  1VQ7 1;  3S16 I;  2NAP A;  1KQS Z;  1Z02 A;  3IF8 A;  4E32 A;  1TWH I;  1TWG I;  3CCQ 1;  2H85 A;  3EED A;  2OOY B;  3CCL 1;  1K9M 1;  1VLA A;  3S2D I;  2VUG A;  1Q7Y 1;  1JJ2 Z;  1TWA I;  3FQM A;  3G71 Z;  3H3V J;  2KPI A;  2P3Y A;  3CCR 1;  4MON A;  1QXF A;  4EWC A;  2GU2 A;  4MXU A;  3CC7 Z;  4A3F I;  1YHQ 1;  1YI2 1;  2RT9 A;  1AA6 A;  3I07 A;  3EER A;  2R7Z I;  1QYP A;  3NDI A;  2QA4 1;  3FQQ A;  2QRD B;  4A3I I;  1Q81 2;  2PMZ A;  1I50 I;  1QVF Z;  1WJ2 A;  2R93 I;  3CCM 1;  4DGL A;  2R92 I;  3HKZ A;  4NBB A;  1X3Z A;  4HGZ A;  2E2H I;  4E30 A;  3M4O I;  3S1N I;  3NH8 A;  2LIY A;  5FLM I;  1JWH C;  2YAD A;  1K8A 1;  2R6M A;  4MD9 A;  1YIT 1;  4BY1 I;  2IZ4 A;  2DE5 A;  3G71 1;  3KIF A;  2YU9 I;  1ZB9 A;  3CC7 1;  2VPY A;  4XX2 A;  4NBG A;  2GTH A;  1KD1 2;  2JA8 I;  4RVD A;  5IT9 f;  2F4M A;  4S1T A;  1W2B Y;  5IT9 b;  1RQF A;  3VB9 A;  2M6N A;  2WAQ A;  2RPR A;  1RO0 A;  1YUK A;  2AKL A;  1FDI A;  3GCF A;  2NVQ I;  3P5J B;  4E33 A;  4A3D I;  3S17 I;  4MRI A;  4A3K I;  2JA5 I;  2M48 A;  2W04 A;  1Y1V S;  2V8J A;  2JMO A;  5C3E I;  3CME Z;  3CXC Z;  1M1K 2;  4A3G I;  1I3Q I;  2Q4Z A;  3GTG I;  2LEX A;  5LL6 f;  1N8R 2;  2Q51 A;  1Q16 A;  1WZN A;  5IP9 I;  5T64 A;  1VQ4 Z;  4BBS I;  3NH4 A;  2V8K A;  3KIH A;  1RO4 A;  2E2I I;  2DE7 A;  1X0T A;  2JIR A;  2K3R A;  4RVH A;  3FKI I;  1LQL A;  2O4H A;  1ZH1 A;  1YIJ Z;  1L1O C;  5AN9 F;  2QRC B;  3CME 1;  3TDH B;  1YIT Z;  3VMI A;  4MD8 A;  4MD7 A;  2I3C A;  4QTT A;  3HOU I;  5D1O B;  4A3J I;  1SIW A;  2BJO A;  3Q87 A;  1K9M 2;  2NVY I;  3J80 f;  1VQ4 1;  2AYD A;  5FLX f;  4RV9 A;  4E31 A;  3T4N B;  3J80 b;  1Q81 1;  1KC8 2;  5FLX b;  4A3E I;  2JNY A;  1M90 1;  4A93 I;  1WCM I;  3IFU A;  4Y52 I;  2K5R A;  4X6A I;  4NOZ A;  2RHB A;  1X3W A;  2VPZ A;  1Z01 A;  1YIJ 1;  2HF1 A;  3HOX I;  2VUM I;  3I4N I;  3G4S 1;  1W2B Z;  2E2J I;  4NBD A;  1K73 2;  3JAM f;  2J6A A;  2QR1 B;  3GTO I;  3JAM b;  1NUI A;  2JIQ A;  1YJN Z;  1KD1 1;  3PO3 S;  3J81 f;  3K7A I;  1WII A;  4BBR I;  4HGY A;  1VQ8 Z;  3MZL B;  3J81 b;  3HOZ I;  4NBH A;  1S7M A;  2V45 A;  2OTL Z;  1TWF I;  3OW2 Y;  1Q86 2;  2HU9 A;  1Y1V I;  1Z03 A;  1NP6 A;  1I6H I;  2VPW A;  1VQ9 Z;  3RZD I;  4DQY B;  1M1K 1;  3CMA Z;  3RZO I;  3GTM S;  4E2Z A;  3CCU 1;  1YUA A;  4NB8 A;  1N8R 1;  5C4J I;  4A3C I;  2E7Z A;  3CCS Z;  4A3B I;  1R9T I;  2RIQ A;  1VQP Z;  1YJW Z;  2JUB A;  3CCJ Z;  1VQ6 Z;  3GTQ I;  2VPX A;  3BG1 B;  4RVF A;  3ESW A;  4RS4 A;  1YJN 1;  4Y7N I;  4NBE A;  1QVG Y;  4NH1 C;  4E2W A;  1VQ8 1;  2O53 A;  1VQM Z;  1Q82 2;  2PK7 A;  2LFU A;  5C4X I;  1RLY A;  3MON A;  2OTL 1;  2VF1 A;  2NVX I;  3S1R I;  2B63 I;  3D2L A;  3G6E Z;  3IR7 A;  1YJ9 Z;  2NVT I;  3I4M I;  3S14 I;  4DK1 A;  1VQN 1;  1NJI 2;  1VQ9 1;  3GTK I;  2QKD A;  5C44 I;  4NFR A;  3CMA 1;  3G4S Z;  3CPW Y;  3CCE Z;  3GTP I;  3S1M I;  2W03 A;  3NH5 A;  3CC4 Z;  2JIM A;  3LUS A;  2GTI A;  3CCS 1;  1WW9 A;  4BXX I;  1VQ5 Z;  1VQP 1;  5D1P A;  1YJW 1;  2E9H A;  3CCJ 1;  4HH4 A;  1VQ6 1;  1S72 Z;  2ZAE B;  1K83 I;  4CL1 A;  3S15 I;  2RBL A;  4BY7 I;  1Q7Y 2;  1SFO I;  2QEX Z;  3CD6 Z;  2V8I A;  3F3F C;  1KC8 1;  1KQS Y;  4MH4 A;  2QRE B;  1VQO 1;  2OTJ Z;  1QF8 A;  1VQM 1;  1Y8C A;  4RVG A;  3MZK B;  2JA7 I;  3S1Q I;  1Y1W I;  3HOW I;  3S2H I;  2V3V A;  1JJ2 Y;  4NBF A;  3G6E 1;  2JR6 A;  3M3Y I;  1YJ9 1;  1RNI A;  3CCU Z;  1TFI A;  3QWU A;  1RO2 A;  3NFZ A;  1M90 2;  2JIO A;  5CM2 M;  5T67 A;  3CCE 1;  1K73 1;  3CC4 1;  3PO3 I;  1QVF Y;  3CC2 Z;  4NB9 A;  2PM9 A;  1VQ5 1;  3OW2 Z;  3IX0 A;  1S72 1;  3HOY I;  5D1O A;  2QLV B;  1K8A 2;  2QEX 1;  3CD6 1;  2JIP A;  3GTJ I;  4A3M I;  3H0G I;  1ZB8 A;  3CCV Z;  2OTJ 1;  3I56 Z;  3TE5 B;  2P28 A;  1Q86 1;  1USP B;  1N2F A;  4NBA A;  3D9X A;  1VQK Z;  2OZK A;  1VQN Z;  2OOX B;  4NBC A;  3I55 Z;  4E2X A;  4TNU A;  3GTM I;  1FDO A;  3VMH A; 
#chains in the Genus database with same CATH homology
 2WB1 A;  1VQL Z;  1VQ7 Z;  1DL6 A;  4AYB A;  5IP7 I;  3U50 C;  1QVG Z;  2IZ3 A;  1P9N A;  3CCQ Z;  2Y0S A;  3CCL Z;  3NDJ A;  2G2K A;  3GKQ A;  3VMG A;  3HOV I;  3CQZ I;  4E2Y A;  3CC2 1;  3D6W A;  2KI7 B;  1PFT A;  1VQO Z;  2DE6 A;  3CCR Z;  5T6B A;  1Q82 1;  1YHQ Z;  2JA6 I;  1YI2 Z;  2JS4 A;  4QTU A;  1KRL A;  3F3P C;  5A2Q f;  3CXC Y;  3CCV 1;  3J7A 4;  3I56 1;  2F4O A;  5A2Q b;  1TWC I;  2QA4 Z;  3CPW Z;  4A3L I;  1VQK 1;  3GTL I;  3BG0 B;  3I55 1;  3PO2 I;  1NJI 1;  3CCM Z;  3VTN A;  1USP A;  2EGT A;  1ML8 A;  1VQL 1;  1VQ7 1;  3S16 I;  1KQS Z;  1Z02 A;  3IF8 A;  4E32 A;  1TWH I;  1TWG I;  3CCQ 1;  2H85 A;  3EED A;  2OOY B;  3CCL 1;  1K9M 1;  1VLA A;  3S2D I;  2VUG A;  1Q7Y 1;  1JJ2 Z;  1TWA I;  3FQM A;  3G71 Z;  3H3V J;  2KPI A;  2P3Y A;  3CCR 1;  4MON A;  4EWC A;  2GU2 A;  4MXU A;  3CC7 Z;  4A3F I;  1YHQ 1;  1YI2 1;  2RT9 A;  3I07 A;  3EER A;  2R7Z I;  1QYP A;  3NDI A;  2QA4 1;  3FQQ A;  2QRD B;  4A3I I;  1Q81 2;  2PMZ A;  1I50 I;  1QVF Z;  2R93 I;  3CCM 1;  4DGL A;  2R92 I;  3HKZ A;  4NBB A;  1X3Z A;  4HGZ A;  2E2H I;  4E30 A;  3M4O I;  3S1N I;  3NH8 A;  2LIY A;  5FLM I;  1JWH C;  2YAD A;  1K8A 1;  2R6M A;  4MD9 A;  1YIT 1;  4BY1 I;  2IZ4 A;  2DE5 A;  3G71 1;  3KIF A;  2YU9 I;  1ZB9 A;  3CC7 1;  4XX2 A;  4NBG A;  2GTH A;  1KD1 2;  2JA8 I;  4RVD A;  5IT9 f;  2F4M A;  4S1T A;  1W2B Y;  5IT9 b;  1RQF A;  3VB9 A;  2M6N A;  2WAQ A;  2RPR A;  1RO0 A;  1YUK A;  2AKL A;  3GCF A;  2NVQ I;  3P5J B;  4E33 A;  4A3D I;  3S17 I;  4MRI A;  4A3K I;  2JA5 I;  2M48 A;  2W04 A;  1Y1V S;  2V8J A;  2JMO A;  5C3E I;  3CME Z;  3CXC Z;  1M1K 2;  4A3G I;  1I3Q I;  2Q4Z A;  3GTG I;  5LL6 f;  1N8R 2;  2Q51 A;  5IP9 I;  5T64 A;  1VQ4 Z;  4BBS I;  3NH4 A;  2V8K A;  3KIH A;  1RO4 A;  2E2I I;  2DE7 A;  1X0T A;  2K3R A;  4RVH A;  3FKI I;  1LQL A;  2O4H A;  1ZH1 A;  1YIJ Z;  1L1O C;  5AN9 F;  2QRC B;  3CME 1;  3TDH B;  1YIT Z;  3VMI A;  4MD8 A;  4MD7 A;  2I3C A;  4QTT A;  3HOU I;  5D1O B;  4A3J I;  2BJO A;  3Q87 A;  1K9M 2;  2NVY I;  3J80 f;  1VQ4 1;  5FLX f;  4RV9 A;  4E31 A;  3T4N B;  3J80 b;  1Q81 1;  1KC8 2;  5FLX b;  4A3E I;  2JNY A;  1M90 1;  4A93 I;  1WCM I;  3IFU A;  4Y52 I;  2K5R A;  4X6A I;  4NOZ A;  2RHB A;  1X3W A;  1Z01 A;  1YIJ 1;  2HF1 A;  3HOX I;  2VUM I;  3I4N I;  3G4S 1;  1W2B Z;  2E2J I;  4NBD A;  1K73 2;  3JAM f;  2J6A A;  2QR1 B;  3GTO I;  3JAM b;  1NUI A;  1KD1 1;  1YJN Z;  3PO3 S;  3J81 f;  3K7A I;  1WII A;  4BBR I;  4HGY A;  1VQ8 Z;  3MZL B;  3J81 b;  3HOZ I;  4NBH A;  1S7M A;  2OTL Z;  1TWF I;  3OW2 Y;  1Q86 2;  2HU9 A;  1Y1V I;  1Z03 A;  1NP6 A;  1I6H I;  1VQ9 Z;  3RZD I;  4DQY B;  1M1K 1;  3CMA Z;  3RZO I;  3GTM S;  4E2Z A;  3CCU 1;  1YUA A;  4NB8 A;  1N8R 1;  5C4J I;  4A3C I;  3CCS Z;  4A3B I;  1R9T I;  2RIQ A;  1VQP Z;  1YJW Z;  2JUB A;  3CCJ Z;  1VQ6 Z;  3GTQ I;  3BG1 B;  4RVF A;  3ESW A;  4RS4 A;  1YJN 1;  4Y7N I;  4NBE A;  1QVG Y;  4NH1 C;  4E2W A;  1VQ8 1;  2O53 A;  1VQM Z;  1Q82 2;  2PK7 A;  2LFU A;  5C4X I;  1RLY A;  3MON A;  2OTL 1;  2VF1 A;  2NVX I;  3S1R I;  2B63 I;  3G6E Z;  1YJ9 Z;  2NVT I;  3I4M I;  3S14 I;  4DK1 A;  1VQN 1;  1NJI 2;  1VQ9 1;  3GTK I;  2QKD A;  5C44 I;  4NFR A;  3CMA 1;  3G4S Z;  3CPW Y;  3CCE Z;  3GTP I;  3S1M I;  2W03 A;  3NH5 A;  3CC4 Z;  3LUS A;  2GTI A;  3CCS 1;  1WW9 A;  4BXX I;  1VQ5 Z;  1VQP 1;  5D1P A;  1YJW 1;  2E9H A;  3CCJ 1;  4HH4 A;  1VQ6 1;  1S72 Z;  2ZAE B;  1K83 I;  4CL1 A;  3S15 I;  2RBL A;  4BY7 I;  1Q7Y 2;  1SFO I;  2QEX Z;  3CD6 Z;  2V8I A;  3F3F C;  1KC8 1;  1KQS Y;  4MH4 A;  2QRE B;  1VQO 1;  2OTJ Z;  1QF8 A;  1VQM 1;  4RVG A;  3MZK B;  2JA7 I;  3S1Q I;  1Y1W I;  3HOW I;  3S2H I;  1JJ2 Y;  4NBF A;  3G6E 1;  2JR6 A;  3M3Y I;  1YJ9 1;  1RNI A;  3CCU Z;  1TFI A;  3QWU A;  1RO2 A;  3NFZ A;  1M90 2;  5CM2 M;  5T67 A;  3CCE 1;  1K73 1;  3CC4 1;  3PO3 I;  1QVF Y;  3CC2 Z;  4NB9 A;  2PM9 A;  1VQ5 1;  3OW2 Z;  3IX0 A;  1S72 1;  3HOY I;  5D1O A;  2QLV B;  1K8A 2;  2QEX 1;  3CD6 1;  3GTJ I;  4A3M I;  3H0G I;  1ZB8 A;  3CCV Z;  2OTJ 1;  3I56 Z;  3TE5 B;  2P28 A;  1Q86 1;  1USP B;  1N2F A;  4NBA A;  3D9X A;  1VQK Z;  2OZK A;  1VQN Z;  2OOX B;  4NBC A;  3I55 Z;  4E2X A;  4TNU A;  3GTM I;  3VMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...