1K731

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k73100
3CXCZ 3CCQZ 3CCSZ 1N8R1 2OTJ1 3CC21 1VQL1 1Q862 1K9M1 2OTL1 3I551 1VQ51 3I56Z 1JJ2Z 1YJ91 3OW2Y 1YJN1 3CCQ1 1K731 3CC71 1VQ4Z 3CPWY 3CCMZ 1YHQZ 1YI2Z 1KD11 1VQMZ 1Q861 1VQNZ 1YJWZ 2QEXZ 1VQO1 1W2BZ 1S721 1VQ81 1YITZ 1QVGZ 3CCEZ 3G6E1 3CCRZ 1QVFY 1VQ9Z 1VQKZ 1VQPZ 2QEX1 3CCJZ 3CMAZ 1NJI2 1JJ2Y 1VQ6Z 3CCS1 3CCVZ 1KQSY 3CCLZ 1VQ7Z 3CCUZ 3G4SZ 1NJI1 1VQK1 2QA4Z 3I561 3CC4Z 3CMEZ 1Q7Y2 3CXCY 1VQ41 1M1K2 1VQ61 3CCM1 1YHQ1 1YI21 1QVGY 3OW2Z 1VQM1 1KC82 3CPWZ 1Q822 1VQN1 1YIJZ 1VQ71 1YJW1 1Q7Y1 3CCU1 3CC2Z 1VQLZ 1Q812 1M1K1 3CME1 1YIT1 3I55Z 1KC81 1Q821 1VQ5Z 3G71Z 1K9M2 1K8A2 1YJ9Z 3CCE1 1YJNZ 3CCR1 3CC7Z 3CD6Z 1Q811 1YIJ1 1VQ91 1K732 1VQP1 1KD12 1QVFZ 3CCJ1 3CMA1 1W2BY 1K8A1 1M902 3CCV1 1VQOZ 3G711 3CCL1 1S72Z 1VQ8Z 1KQSZ 2OTJZ 3CD61 3G6EZ 3G4S1 1N8R2 2QA41 3CC41 1M901 2OTLZ
chains in the Genus database with same CATH superfamily
3CXCZ 3CCSZ 1N8R1 2OTJ1 3CC21 3U50C 1K9M1 1KRLA 4NBDA 3I551 1NP6A 1WCMI 3NDJA 1YJN1 3CPWY 1VQ4Z 3S1QI 1KD11 2JIOA 1RO4A 4NBAA 5AN9F 4E32A 1VQNZ 3VB9A 4A3MI 3CQZI 3GTPI 5C44I 3KIFA 1SFOI 4AYBA 4HGZA 3HOYI 1LQLA 4A3CI 4RS4A 3G6E1 3HOUI 4A3LI 1SIWA 2K5RA 2IZ4A 3IFUA 4NB8A 3CCJZ 2DE6A 3CCLZ 4BBSI 5IP9I 3I4NI 3G4SZ 1PFTA 3MZLB 2GTHA 3I561 1Q7Y2 4CL1A 3GTOI 1M1K2 2WB1A 1YHQ1 3JAMf 1YI21 1QVGY 1VQM1 2ZAEB 1Q822 2JIMA 2OOXB 1VQLZ 1Q812 3D6WA 3S1RI 2GU2A 4NBHA 5T6BA 2JA7I 4RV9A 1KC81 1VQ5Z 4EWCA 1K9M2 3MZKB 1YJ9Z 2VPYA 3CC7Z 3GTGI 1VQ91 1Z01A 2LFUA 1VQP1 1KD12 2I3CA 1TWGI 3CMA1 1K8A1 1RQFA 4NBCA 3S1NI 2NVXI 1P9NA 1JWHC 2VPWA 3JAMb 1VQ8Z 4TNUA 3VMIA 2PMZA 2VPZA 3CC41 1M901 3ESWA 1X3ZA 1ZH1A 3M3YI 2DE7A 2EGTA 1I50I 1Q862 1USPB 2NAPA 4E2WA 2DE5A 2IV2X 2Q4ZA 4E2YA 3NH8A 3OW2Y 1K731 4NB9A 3CCMZ 3PO2I 3GCFA 2QREB 1I3QI 1K83I 4QTUA 5D1OA 5A2Qf 3GTMS 4S1TA 1W2BZ 1YITZ 3P5JB 1QF8A 4X6AI 5LL6f 3S2DI 2JMOA 3CCEZ 2QR1B 5FLXf 3J7A4 1VQKZ 4A3JI 2R93I 2E2JI 4MH4A 1TWHI 1NJI2 1VQ6Z 3HOXI 3CCS1 1KQSY 2E2HI 3KIHA 1QXFA 3I4MI 1VQK1 5FLMI 2QA4Z 5IP7I 3VTNA 5A2Qb 3FKII 3GKQA 2K3RA 1VQ41 1VQ61 1Y8CA 1Y1WI 3CPWZ 4A3BI 1VQN1 3S16I 1S7MA 1YIJZ 1X3WA 3H0GI 2JR6A 1L1OC 2OOYB 5D1PA 1ZB9A 2GTIA 4E33A 2E2II 1I6HI 1TFIA 3G71Z 2VF1A 3VMHA 4E31A 2QLVB 4NOZA 3CD6Z 2W03A 4A3FI 1YIJ1 3GTKI 1K732 4A3GI 4BXXI 2F4MA 3VMGA 3CCJ1 3IF8A 4DGLA 1VQOZ 3G711 3CCL1 1S72Z 2R92I 2QKDA 2JA8I 3S14I 3D2LA 3S1MI 3CD61 2LEXA 2R7ZI 3G4S1 1N8R2 3TDHB 2VPXA 3J80f 5CM2M 3RZDI 2OTLZ 4BBRI 4MD7A 4NFRA 2RHBA 4QTTA 3CCQZ 2JUBA 1X0TA 1WZNA 2QRCB 4Y7NI 1R9TI 1TWFI 1VQL1 4A3DI 3T4NB 2JA6I 2OTL1 2IZ3A 1VQ51 3EEDA 1JJ2Z 4NBGA 1YJ91 4E2ZA 3Q87A 3CCQ1 3CC71 4HH4A 2R6MA 4NBEA 1FDOA 3J81f 3HOWI 4DQYB 2YU9I 3GTQI 2RT9A 1YJWZ 3J80b 4NBFA 1VQ81 1RNIA 1DL6A 3CCRZ 1QVFY 3RZOI 2OZKA 4MD9A 2O53A 2V45A 3CCVZ 2NVYI 3NH4A 2JIRA 3J81b 3CCUZ 3GTLI 1NUIA 1VLAA 1RO2A 2PK7A 2E9HA 1WIIA 3CXCY 5T67A 2VUMI 3NDIA 3CCM1 3OW2Z 2E7ZA 1KC82 4Y52I 2O4HA 1Q7Y1 2VUGA 3CC2Z 3CCU1 1QYPA 1M1K1 3M4OI 1YIT1 2QRDB 3I55Z 1RO0A 1Q821 1K8A2 3CCE1 3TE5B 1YJNZ 2W04A 1Q811 3F3FC 3GTMI 1N2FA 3IX0A 3IR7A 5C4XI 1M902 4A3II 1ZB8A 1TWAI 5FLXb 1KQSZ 3BG0B 3GTJI 5D1OB 3G6EZ 2QA41 3S17I 3H3VJ 4RVFA 2HU9A 4MXUA 3PO3S 4E30A 3FQMA 2V8KA 3EERA 2PM9A 2WAQA 3HOZI 1Z03A 2Y0SA 3HOVI 3I56Z 1Z02A 1WW9A 2YADA 3NFZA 1YHQZ 2M6NA 1YI2Z 1VQMZ 1Q861 1YUKA 1ML8A 2AYDA 3I07A 3S2HI 2LIYA 2HF1A 2J6AA 2QEXZ 2P28A 3HKZA 1VQO1 4A3EI 1S721 1RLYA 2G2KA 1QVGZ 2NVTI 3PO3I 2JNYA 1FDIA 3D9XA 3FQQA 2V8JA 2BJOA 2V3VA 1TWCI 1VQ9Z 1VQPZ 2QEX1 4DK1A 2RIQA 5C4JI 1USPA 3CMAZ 1JJ2Y 4RVGA 2JA5I 4BY1I 5C3EI 1WJ2A 1Q16A 2Q51A 1VQ7Z 2AKLA 4RVDA 4A3KI 1NJI1 4XX2A 3CMEZ 3CC4Z 2V8IA 1AA6A 5IT9f 2KI7B 2NVQI 4MRIA 2KPIA 3MONA 1Y1VS 3K7AI 4RVHA 1VQ71 1YJW1 4A93I 2H85A 2RPRA 3S15I 3CME1 1YUAA 3NH5A 2JIPA 2JS4A 4HGYA 3CCR1 2M48A 4NH1C 4MONA 4E2XA 4MD8A 1QVFZ 4BY7I 1W2BY 2RBLA 3F3PC 3CCV1 2B63I 5IT9b 3LUSA 2OTJZ 4NBBA 2F4OA 5T64A 1Y1VI 2P3YA 3BG1B 3QWUA 2JIQA
chains in the Genus database with same CATH topology
3CXCZ 3CCSZ 1N8R1 2OTJ1 3CC21 3U50C 1K9M1 1KRLA 4NBDA 3I551 1NP6A 1WCMI 3NDJA 1YJN1 3CPWY 1VQ4Z 3S1QI 1KD11 1RO4A 4NBAA 5AN9F 4E32A 1VQNZ 3VB9A 4A3MI 3CQZI 3GTPI 5C44I 3KIFA 1SFOI 4AYBA 4HGZA 3HOYI 1LQLA 4A3CI 4RS4A 3G6E1 3HOUI 4A3LI 2K5RA 2IZ4A 3IFUA 4NB8A 3CCJZ 2DE6A 3CCLZ 4BBSI 5IP9I 3I4NI 3G4SZ 1PFTA 3MZLB 2GTHA 3I561 1Q7Y2 4CL1A 3GTOI 1M1K2 2WB1A 1YHQ1 3JAMf 1YI21 1QVGY 1VQM1 2ZAEB 1Q822 2OOXB 1VQLZ 1Q812 3D6WA 3S1RI 2GU2A 4NBHA 5T6BA 2JA7I 4RV9A 1KC81 1VQ5Z 4EWCA 1K9M2 3MZKB 1YJ9Z 3CC7Z 3GTGI 1VQ91 1Z01A 2LFUA 1VQP1 1KD12 2I3CA 1TWGI 3CMA1 1K8A1 1RQFA 4NBCA 3S1NI 2NVXI 1P9NA 1JWHC 3JAMb 1VQ8Z 4TNUA 3VMIA 2PMZA 3CC41 1M901 3ESWA 1X3ZA 1ZH1A 3M3YI 2DE7A 2EGTA 1I50I 1Q862 1USPB 4E2WA 2DE5A 2Q4ZA 4E2YA 3NH8A 3OW2Y 1K731 4NB9A 3CCMZ 3PO2I 3GCFA 2QREB 1I3QI 1K83I 4QTUA 5D1OA 5A2Qf 3GTMS 4S1TA 1W2BZ 1YITZ 3P5JB 1QF8A 4X6AI 5LL6f 3S2DI 2JMOA 3CCEZ 2QR1B 5FLXf 3J7A4 1VQKZ 4A3JI 2R93I 2E2JI 4MH4A 1TWHI 1NJI2 1VQ6Z 3HOXI 3CCS1 1KQSY 2E2HI 3KIHA 3I4MI 1VQK1 5FLMI 2QA4Z 5IP7I 3VTNA 5A2Qb 3FKII 3GKQA 2K3RA 1VQ41 1VQ61 1Y1WI 3CPWZ 4A3BI 1VQN1 3S16I 1S7MA 1YIJZ 1X3WA 3H0GI 2JR6A 1L1OC 2OOYB 5D1PA 1ZB9A 2GTIA 4E33A 2E2II 1I6HI 1TFIA 3G71Z 2VF1A 3VMHA 4E31A 2QLVB 4NOZA 3CD6Z 2W03A 4A3FI 1YIJ1 3GTKI 1K732 4A3GI 4BXXI 2F4MA 3VMGA 3CCJ1 3IF8A 4DGLA 1VQOZ 3G711 3CCL1 1S72Z 2R92I 2QKDA 2JA8I 3S14I 3S1MI 3CD61 2R7ZI 3G4S1 1N8R2 3TDHB 3J80f 5CM2M 3RZDI 2OTLZ 4BBRI 4MD7A 4NFRA 2RHBA 4QTTA 3CCQZ 2JUBA 1X0TA 2QRCB 4Y7NI 1R9TI 1TWFI 1VQL1 4A3DI 3T4NB 2JA6I 2OTL1 2IZ3A 1VQ51 3EEDA 1JJ2Z 4NBGA 1YJ91 4E2ZA 3Q87A 3CCQ1 3CC71 4HH4A 2R6MA 4NBEA 3J81f 3HOWI 4DQYB 2YU9I 3GTQI 2RT9A 1YJWZ 3J80b 4NBFA 1VQ81 1RNIA 1DL6A 3CCRZ 1QVFY 3RZOI 2OZKA 4MD9A 2O53A 3CCVZ 2NVYI 3NH4A 3J81b 3CCUZ 3GTLI 1NUIA 1VLAA 1RO2A 2PK7A 2E9HA 1WIIA 3CXCY 5T67A 2VUMI 3NDIA 3CCM1 3OW2Z 1KC82 4Y52I 2O4HA 1Q7Y1 2VUGA 3CC2Z 3CCU1 1QYPA 1M1K1 3M4OI 1YIT1 2QRDB 3I55Z 1RO0A 1Q821 1K8A2 3CCE1 3TE5B 1YJNZ 2W04A 1Q811 3F3FC 3GTMI 1N2FA 3IX0A 5C4XI 1M902 4A3II 1ZB8A 1TWAI 5FLXb 1KQSZ 3BG0B 3GTJI 5D1OB 3G6EZ 2QA41 3S17I 3H3VJ 4RVFA 2HU9A 4MXUA 3PO3S 4E30A 3FQMA 2V8KA 3EERA 2PM9A 2WAQA 3HOZI 1Z03A 2Y0SA 3HOVI 3I56Z 1Z02A 1WW9A 2YADA 3NFZA 1YHQZ 2M6NA 1YI2Z 1VQMZ 1Q861 1YUKA 1ML8A 3I07A 3S2HI 2LIYA 2HF1A 2J6AA 2QEXZ 2P28A 3HKZA 1VQO1 4A3EI 1S721 1RLYA 2G2KA 1QVGZ 2NVTI 3PO3I 2JNYA 3FQQA 3D9XA 2V8JA 2BJOA 1TWCI 1VQ9Z 1VQPZ 2QEX1 4DK1A 2RIQA 5C4JI 1USPA 3CMAZ 1JJ2Y 4RVGA 2JA5I 4BY1I 5C3EI 2Q51A 1VQ7Z 2AKLA 4RVDA 4A3KI 1NJI1 4XX2A 3CMEZ 3CC4Z 2V8IA 5IT9f 2KI7B 2NVQI 4MRIA 2KPIA 3MONA 1Y1VS 3K7AI 4RVHA 1VQ71 1YJW1 4A93I 2H85A 2RPRA 3S15I 3CME1 1YUAA 3NH5A 2JS4A 4HGYA 3CCR1 2M48A 4NH1C 4MONA 4E2XA 4MD8A 1QVFZ 4BY7I 1W2BY 2RBLA 3F3PC 3CCV1 2B63I 5IT9b 3LUSA 2OTJZ 4NBBA 2F4OA 5T64A 1Y1VI 2P3YA 3BG1B 3QWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC Z;  3CCQ Z;  3CCS Z;  1N8R 1;  2OTJ 1;  3CC2 1;  1VQL 1;  1Q86 2;  1K9M 1;  2OTL 1;  3I55 1;  1VQ5 1;  3I56 Z;  1JJ2 Z;  1YJ9 1;  3OW2 Y;  1YJN 1;  3CCQ 1;  1K73 1;  3CC7 1;  1VQ4 Z;  3CPW Y;  3CCM Z;  1YHQ Z;  1YI2 Z;  1KD1 1;  1VQM Z;  1Q86 1;  1VQN Z;  1YJW Z;  2QEX Z;  1VQO 1;  1W2B Z;  1S72 1;  1VQ8 1;  1YIT Z;  1QVG Z;  3CCE Z;  3G6E 1;  3CCR Z;  1QVF Y;  1VQ9 Z;  1VQK Z;  1VQP Z;  2QEX 1;  3CCJ Z;  3CMA Z;  1NJI 2;  1JJ2 Y;  1VQ6 Z;  3CCS 1;  3CCV Z;  1KQS Y;  3CCL Z;  1VQ7 Z;  3CCU Z;  3G4S Z;  1NJI 1;  1VQK 1;  2QA4 Z;  3I56 1;  3CC4 Z;  3CME Z;  1Q7Y 2;  3CXC Y;  1VQ4 1;  1M1K 2;  1VQ6 1;  3CCM 1;  1YHQ 1;  1YI2 1;  1QVG Y;  3OW2 Z;  1VQM 1;  1KC8 2;  3CPW Z;  1Q82 2;  1VQN 1;  1YIJ Z;  1VQ7 1;  1YJW 1;  1Q7Y 1;  3CCU 1;  3CC2 Z;  1VQL Z;  1Q81 2;  1M1K 1;  3CME 1;  1YIT 1;  3I55 Z;  1KC8 1;  1Q82 1;  1VQ5 Z;  3G71 Z;  1K9M 2;  1K8A 2;  1YJ9 Z;  3CCE 1;  1YJN Z;  3CCR 1;  3CC7 Z;  3CD6 Z;  1Q81 1;  1YIJ 1;  1VQ9 1;  1K73 2;  1VQP 1;  1KD1 2;  1QVF Z;  3CCJ 1;  3CMA 1;  1W2B Y;  1K8A 1;  1M90 2;  3CCV 1;  1VQO Z;  3G71 1;  3CCL 1;  1S72 Z;  1VQ8 Z;  1KQS Z;  2OTJ Z;  3CD6 1;  3G6E Z;  3G4S 1;  1N8R 2;  2QA4 1;  3CC4 1;  1M90 1;  2OTL Z; 
#chains in the Genus database with same CATH topology
 3CXC Z;  3CCS Z;  1N8R 1;  2OTJ 1;  3CC2 1;  3U50 C;  1K9M 1;  1KRL A;  4NBD A;  3I55 1;  1NP6 A;  1WCM I;  3NDJ A;  1YJN 1;  3CPW Y;  1VQ4 Z;  3S1Q I;  1KD1 1;  2JIO A;  1RO4 A;  4NBA A;  5AN9 F;  4E32 A;  1VQN Z;  3VB9 A;  4A3M I;  3CQZ I;  3GTP I;  5C44 I;  3KIF A;  1SFO I;  4AYB A;  4HGZ A;  3HOY I;  1LQL A;  4A3C I;  4RS4 A;  3G6E 1;  3HOU I;  4A3L I;  1SIW A;  2K5R A;  2IZ4 A;  3IFU A;  4NB8 A;  3CCJ Z;  2DE6 A;  3CCL Z;  4BBS I;  5IP9 I;  3I4N I;  3G4S Z;  1PFT A;  3MZL B;  2GTH A;  3I56 1;  1Q7Y 2;  4CL1 A;  3GTO I;  1M1K 2;  2WB1 A;  1YHQ 1;  3JAM f;  1YI2 1;  1QVG Y;  1VQM 1;  2ZAE B;  1Q82 2;  2JIM A;  2OOX B;  1VQL Z;  1Q81 2;  3D6W A;  3S1R I;  2GU2 A;  4NBH A;  5T6B A;  2JA7 I;  4RV9 A;  1KC8 1;  1VQ5 Z;  4EWC A;  1K9M 2;  3MZK B;  1YJ9 Z;  2VPY A;  3CC7 Z;  3GTG I;  1VQ9 1;  1Z01 A;  2LFU A;  1VQP 1;  1KD1 2;  2I3C A;  1TWG I;  3CMA 1;  1K8A 1;  1RQF A;  4NBC A;  3S1N I;  2NVX I;  1P9N A;  1JWH C;  2VPW A;  3JAM b;  1VQ8 Z;  4TNU A;  3VMI A;  2PMZ A;  2VPZ A;  3CC4 1;  1M90 1;  3ESW A;  1X3Z A;  1ZH1 A;  3M3Y I;  2DE7 A;  2EGT A;  1I50 I;  1Q86 2;  1USP B;  2NAP A;  4E2W A;  2DE5 A;  2IV2 X;  2Q4Z A;  4E2Y A;  3NH8 A;  3OW2 Y;  1K73 1;  4NB9 A;  3CCM Z;  3PO2 I;  3GCF A;  2QRE B;  1I3Q I;  1K83 I;  4QTU A;  5D1O A;  5A2Q f;  3GTM S;  4S1T A;  1W2B Z;  1YIT Z;  3P5J B;  1QF8 A;  4X6A I;  5LL6 f;  3S2D I;  2JMO A;  3CCE Z;  2QR1 B;  5FLX f;  3J7A 4;  1VQK Z;  4A3J I;  2R93 I;  2E2J I;  4MH4 A;  1TWH I;  1NJI 2;  1VQ6 Z;  3HOX I;  3CCS 1;  1KQS Y;  2E2H I;  3KIH A;  1QXF A;  3I4M I;  1VQK 1;  5FLM I;  2QA4 Z;  5IP7 I;  3VTN A;  5A2Q b;  3FKI I;  3GKQ A;  2K3R A;  1VQ4 1;  1VQ6 1;  1Y8C A;  1Y1W I;  3CPW Z;  4A3B I;  1VQN 1;  3S16 I;  1S7M A;  1YIJ Z;  1X3W A;  3H0G I;  2JR6 A;  1L1O C;  2OOY B;  5D1P A;  1ZB9 A;  2GTI A;  4E33 A;  2E2I I;  1I6H I;  1TFI A;  3G71 Z;  2VF1 A;  3VMH A;  4E31 A;  2QLV B;  4NOZ A;  3CD6 Z;  2W03 A;  4A3F I;  1YIJ 1;  3GTK I;  1K73 2;  4A3G I;  4BXX I;  2F4M A;  3VMG A;  3CCJ 1;  3IF8 A;  4DGL A;  1VQO Z;  3G71 1;  3CCL 1;  1S72 Z;  2R92 I;  2QKD A;  2JA8 I;  3S14 I;  3D2L A;  3S1M I;  3CD6 1;  2LEX A;  2R7Z I;  3G4S 1;  1N8R 2;  3TDH B;  2VPX A;  3J80 f;  5CM2 M;  3RZD I;  2OTL Z;  4BBR I;  4MD7 A;  4NFR A;  2RHB A;  4QTT A;  3CCQ Z;  2JUB A;  1X0T A;  1WZN A;  2QRC B;  4Y7N I;  1R9T I;  1TWF I;  1VQL 1;  4A3D I;  3T4N B;  2JA6 I;  2OTL 1;  2IZ3 A;  1VQ5 1;  3EED A;  1JJ2 Z;  4NBG A;  1YJ9 1;  4E2Z A;  3Q87 A;  3CCQ 1;  3CC7 1;  4HH4 A;  2R6M A;  4NBE A;  1FDO A;  3J81 f;  3HOW I;  4DQY B;  2YU9 I;  3GTQ I;  2RT9 A;  1YJW Z;  3J80 b;  4NBF A;  1VQ8 1;  1RNI A;  1DL6 A;  3CCR Z;  1QVF Y;  3RZO I;  2OZK A;  4MD9 A;  2O53 A;  2V45 A;  3CCV Z;  2NVY I;  3NH4 A;  2JIR A;  3J81 b;  3CCU Z;  3GTL I;  1NUI A;  1VLA A;  1RO2 A;  2PK7 A;  2E9H A;  1WII A;  3CXC Y;  5T67 A;  2VUM I;  3NDI A;  3CCM 1;  3OW2 Z;  2E7Z A;  1KC8 2;  4Y52 I;  2O4H A;  1Q7Y 1;  2VUG A;  3CC2 Z;  3CCU 1;  1QYP A;  1M1K 1;  3M4O I;  1YIT 1;  2QRD B;  3I55 Z;  1RO0 A;  1Q82 1;  1K8A 2;  3CCE 1;  3TE5 B;  1YJN Z;  2W04 A;  1Q81 1;  3F3F C;  3GTM I;  1N2F A;  3IX0 A;  3IR7 A;  5C4X I;  1M90 2;  4A3I I;  1ZB8 A;  1TWA I;  5FLX b;  1KQS Z;  3BG0 B;  3GTJ I;  5D1O B;  3G6E Z;  2QA4 1;  3S17 I;  3H3V J;  4RVF A;  2HU9 A;  4MXU A;  3PO3 S;  4E30 A;  3FQM A;  2V8K A;  3EER A;  2PM9 A;  2WAQ A;  3HOZ I;  1Z03 A;  2Y0S A;  3HOV I;  3I56 Z;  1Z02 A;  1WW9 A;  2YAD A;  3NFZ A;  1YHQ Z;  2M6N A;  1YI2 Z;  1VQM Z;  1Q86 1;  1YUK A;  1ML8 A;  2AYD A;  3I07 A;  3S2H I;  2LIY A;  2HF1 A;  2J6A A;  2QEX Z;  2P28 A;  3HKZ A;  1VQO 1;  4A3E I;  1S72 1;  1RLY A;  2G2K A;  1QVG Z;  2NVT I;  3PO3 I;  2JNY A;  1FDI A;  3D9X A;  3FQQ A;  2V8J A;  2BJO A;  2V3V A;  1TWC I;  1VQ9 Z;  1VQP Z;  2QEX 1;  4DK1 A;  2RIQ A;  5C4J I;  1USP A;  3CMA Z;  1JJ2 Y;  4RVG A;  2JA5 I;  4BY1 I;  5C3E I;  1WJ2 A;  1Q16 A;  2Q51 A;  1VQ7 Z;  2AKL A;  4RVD A;  4A3K I;  1NJI 1;  4XX2 A;  3CME Z;  3CC4 Z;  2V8I A;  1AA6 A;  5IT9 f;  2KI7 B;  2NVQ I;  4MRI A;  2KPI A;  3MON A;  1Y1V S;  3K7A I;  4RVH A;  1VQ7 1;  1YJW 1;  4A93 I;  2H85 A;  2RPR A;  3S15 I;  3CME 1;  1YUA A;  3NH5 A;  2JIP A;  2JS4 A;  4HGY A;  3CCR 1;  2M48 A;  4NH1 C;  4MON A;  4E2X A;  4MD8 A;  1QVF Z;  4BY7 I;  1W2B Y;  2RBL A;  3F3P C;  3CCV 1;  2B63 I;  5IT9 b;  3LUS A;  2OTJ Z;  4NBB A;  2F4O A;  5T64 A;  1Y1V I;  2P3Y A;  3BG1 B;  3QWU A;  2JIQ A; 
#chains in the Genus database with same CATH homology
 3CXC Z;  3CCS Z;  1N8R 1;  2OTJ 1;  3CC2 1;  3U50 C;  1K9M 1;  1KRL A;  4NBD A;  3I55 1;  1NP6 A;  1WCM I;  3NDJ A;  1YJN 1;  3CPW Y;  1VQ4 Z;  3S1Q I;  1KD1 1;  1RO4 A;  4NBA A;  5AN9 F;  4E32 A;  1VQN Z;  3VB9 A;  4A3M I;  3CQZ I;  3GTP I;  5C44 I;  3KIF A;  1SFO I;  4AYB A;  4HGZ A;  3HOY I;  1LQL A;  4A3C I;  4RS4 A;  3G6E 1;  3HOU I;  4A3L I;  2K5R A;  2IZ4 A;  3IFU A;  4NB8 A;  3CCJ Z;  2DE6 A;  3CCL Z;  4BBS I;  5IP9 I;  3I4N I;  3G4S Z;  1PFT A;  3MZL B;  2GTH A;  3I56 1;  1Q7Y 2;  4CL1 A;  3GTO I;  1M1K 2;  2WB1 A;  1YHQ 1;  3JAM f;  1YI2 1;  1QVG Y;  1VQM 1;  2ZAE B;  1Q82 2;  2OOX B;  1VQL Z;  1Q81 2;  3D6W A;  3S1R I;  2GU2 A;  4NBH A;  5T6B A;  2JA7 I;  4RV9 A;  1KC8 1;  1VQ5 Z;  4EWC A;  1K9M 2;  3MZK B;  1YJ9 Z;  3CC7 Z;  3GTG I;  1VQ9 1;  1Z01 A;  2LFU A;  1VQP 1;  1KD1 2;  2I3C A;  1TWG I;  3CMA 1;  1K8A 1;  1RQF A;  4NBC A;  3S1N I;  2NVX I;  1P9N A;  1JWH C;  3JAM b;  1VQ8 Z;  4TNU A;  3VMI A;  2PMZ A;  3CC4 1;  1M90 1;  3ESW A;  1X3Z A;  1ZH1 A;  3M3Y I;  2DE7 A;  2EGT A;  1I50 I;  1Q86 2;  1USP B;  4E2W A;  2DE5 A;  2Q4Z A;  4E2Y A;  3NH8 A;  3OW2 Y;  1K73 1;  4NB9 A;  3CCM Z;  3PO2 I;  3GCF A;  2QRE B;  1I3Q I;  1K83 I;  4QTU A;  5D1O A;  5A2Q f;  3GTM S;  4S1T A;  1W2B Z;  1YIT Z;  3P5J B;  1QF8 A;  4X6A I;  5LL6 f;  3S2D I;  2JMO A;  3CCE Z;  2QR1 B;  5FLX f;  3J7A 4;  1VQK Z;  4A3J I;  2R93 I;  2E2J I;  4MH4 A;  1TWH I;  1NJI 2;  1VQ6 Z;  3HOX I;  3CCS 1;  1KQS Y;  2E2H I;  3KIH A;  3I4M I;  1VQK 1;  5FLM I;  2QA4 Z;  5IP7 I;  3VTN A;  5A2Q b;  3FKI I;  3GKQ A;  2K3R A;  1VQ4 1;  1VQ6 1;  1Y1W I;  3CPW Z;  4A3B I;  1VQN 1;  3S16 I;  1S7M A;  1YIJ Z;  1X3W A;  3H0G I;  2JR6 A;  1L1O C;  2OOY B;  5D1P A;  1ZB9 A;  2GTI A;  4E33 A;  2E2I I;  1I6H I;  1TFI A;  3G71 Z;  2VF1 A;  3VMH A;  4E31 A;  2QLV B;  4NOZ A;  3CD6 Z;  2W03 A;  4A3F I;  1YIJ 1;  3GTK I;  1K73 2;  4A3G I;  4BXX I;  2F4M A;  3VMG A;  3CCJ 1;  3IF8 A;  4DGL A;  1VQO Z;  3G71 1;  3CCL 1;  1S72 Z;  2R92 I;  2QKD A;  2JA8 I;  3S14 I;  3S1M I;  3CD6 1;  2R7Z I;  3G4S 1;  1N8R 2;  3TDH B;  3J80 f;  5CM2 M;  3RZD I;  2OTL Z;  4BBR I;  4MD7 A;  4NFR A;  2RHB A;  4QTT A;  3CCQ Z;  2JUB A;  1X0T A;  2QRC B;  4Y7N I;  1R9T I;  1TWF I;  1VQL 1;  4A3D I;  3T4N B;  2JA6 I;  2OTL 1;  2IZ3 A;  1VQ5 1;  3EED A;  1JJ2 Z;  4NBG A;  1YJ9 1;  4E2Z A;  3Q87 A;  3CCQ 1;  3CC7 1;  4HH4 A;  2R6M A;  4NBE A;  3J81 f;  3HOW I;  4DQY B;  2YU9 I;  3GTQ I;  2RT9 A;  1YJW Z;  3J80 b;  4NBF A;  1VQ8 1;  1RNI A;  1DL6 A;  3CCR Z;  1QVF Y;  3RZO I;  2OZK A;  4MD9 A;  2O53 A;  3CCV Z;  2NVY I;  3NH4 A;  3J81 b;  3CCU Z;  3GTL I;  1NUI A;  1VLA A;  1RO2 A;  2PK7 A;  2E9H A;  1WII A;  3CXC Y;  5T67 A;  2VUM I;  3NDI A;  3CCM 1;  3OW2 Z;  1KC8 2;  4Y52 I;  2O4H A;  1Q7Y 1;  2VUG A;  3CC2 Z;  3CCU 1;  1QYP A;  1M1K 1;  3M4O I;  1YIT 1;  2QRD B;  3I55 Z;  1RO0 A;  1Q82 1;  1K8A 2;  3CCE 1;  3TE5 B;  1YJN Z;  2W04 A;  1Q81 1;  3F3F C;  3GTM I;  1N2F A;  3IX0 A;  5C4X I;  1M90 2;  4A3I I;  1ZB8 A;  1TWA I;  5FLX b;  1KQS Z;  3BG0 B;  3GTJ I;  5D1O B;  3G6E Z;  2QA4 1;  3S17 I;  3H3V J;  4RVF A;  2HU9 A;  4MXU A;  3PO3 S;  4E30 A;  3FQM A;  2V8K A;  3EER A;  2PM9 A;  2WAQ A;  3HOZ I;  1Z03 A;  2Y0S A;  3HOV I;  3I56 Z;  1Z02 A;  1WW9 A;  2YAD A;  3NFZ A;  1YHQ Z;  2M6N A;  1YI2 Z;  1VQM Z;  1Q86 1;  1YUK A;  1ML8 A;  3I07 A;  3S2H I;  2LIY A;  2HF1 A;  2J6A A;  2QEX Z;  2P28 A;  3HKZ A;  1VQO 1;  4A3E I;  1S72 1;  1RLY A;  2G2K A;  1QVG Z;  2NVT I;  3PO3 I;  2JNY A;  3FQQ A;  3D9X A;  2V8J A;  2BJO A;  1TWC I;  1VQ9 Z;  1VQP Z;  2QEX 1;  4DK1 A;  2RIQ A;  5C4J I;  1USP A;  3CMA Z;  1JJ2 Y;  4RVG A;  2JA5 I;  4BY1 I;  5C3E I;  2Q51 A;  1VQ7 Z;  2AKL A;  4RVD A;  4A3K I;  1NJI 1;  4XX2 A;  3CME Z;  3CC4 Z;  2V8I A;  5IT9 f;  2KI7 B;  2NVQ I;  4MRI A;  2KPI A;  3MON A;  1Y1V S;  3K7A I;  4RVH A;  1VQ7 1;  1YJW 1;  4A93 I;  2H85 A;  2RPR A;  3S15 I;  3CME 1;  1YUA A;  3NH5 A;  2JS4 A;  4HGY A;  3CCR 1;  2M48 A;  4NH1 C;  4MON A;  4E2X A;  4MD8 A;  1QVF Z;  4BY7 I;  1W2B Y;  2RBL A;  3F3P C;  3CCV 1;  2B63 I;  5IT9 b;  3LUS A;  2OTJ Z;  4NBB A;  2F4O A;  5T64 A;  1Y1V I;  2P3Y A;  3BG1 B;  3QWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...