1K731

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k73100
3CD6Z 3CCS1 1VQN1 3CCJZ 3CCJ1 1YIT1 1K9M1 1VQ51 1YI21 3CCVZ 3CCRZ 1VQMZ 1W2BY 1VQK1 1YJN1 1Q812 1YIJZ 1K731 1YHQZ 1M902 1KD12 1VQPZ 3G4S1 3I56Z 1VQ7Z 1VQLZ 3G71Z 1S721 1Q811 3CCQZ 3CC71 3CD61 1M901 3CMEZ 1KD11 1QVFZ 1VQ4Z 1QVGY 1K8A1 1Q822 3CXCZ 3CCV1 3CCR1 3CPWY 3CC2Z 1VQM1 3OW2Y 1VQ9Z 2QEXZ 1YIJ1 1YHQ1 1W2BZ 1Q821 1KQSZ 1VQP1 1VQ6Z 3I561 1VQ71 1JJ2Y 1VQL1 1YJ9Z 3CC4Z 3G711 3CCQ1 2OTJZ 3CME1 1YJWZ 1VQ41 1VQOZ 3I55Z 3G6EZ 1NJI2 3CCMZ 1VQ8Z 1M1K2 3CCUZ 3CC21 2QA4Z 1N8R2 2OTLZ 3CCLZ 1VQ91 1Q862 2QEX1 1Q7Y2 3CMAZ 3CCEZ 3OW2Z 1QVFY 1VQ61 3CCSZ 1VQNZ 1M1K1 3CXCY 1N8R1 1YITZ 3CC41 1YJ91 1K732 1Q861 1Q7Y1 2OTJ1 1YI2Z 1VQ5Z 1JJ2Z 1YJW1 1VQO1 3I551 1VQKZ 1YJNZ 3G6E1 1KQSY 1KC82 3CCM1 1QVGZ 1VQ81 3CCU1 2QA41 2OTL1 3G4SZ 3CCL1 1K8A2 3CPWZ 1K9M2 3CMA1 3CCE1 1S72Z 1NJI1 1KC81 3CC7Z
chains in the Genus database with same CATH superfamily
2KI7B 3CCS1 1YIT1 4BBSI 3HOXI 3CCRZ 1S7MA 4A3JI 2V8JA 3NDIA 4MXUA 5IP7I 3GTPI 4RS4A 5C3EI 2VUGA 3S1QI 2G2KA 1VQPZ 4NB8A 2E9HA 4HGYA 4NOZA 1QF8A 1S721 1Q811 2W03A 3CCQZ 2JA5I 3PO3I 4BY7I 2OOXB 1PFTA 3T4NB 2BJOA 3S1NI 3CXCZ 2E2II 1L1OC 3CCV1 4BBRI 2V45A 3J80b 2QRDB 2AKLA 4DQYB 1YIJ1 2R93I 1YHQ1 3M3YI 2PMZA 1Q821 4RVFA 3VMIA 1VQL1 3CC4Z 4MRIA 2VPYA 4RVHA 2VF1A 3CME1 1VQ41 3CQZI 3I55Z 4NH1C 4E2YA 2JS4A 1NJI2 3CCMZ 3J81f 1VQ8Z 3PO2I 1KRLA 2QA4Z 2OTLZ 3TDHB 1Q862 2QEX1 2JIOA 3CMAZ 4NB9A 2VPXA 1QVFY 1X0TA 1TWAI 2PM9A 1VQNZ 2F4OA 5T6BA 1WJ2A 5D1PA 1VLAA 2R7ZI 4Y7NI 1N2FA 3U50C 2OTJ1 3MZLB 1YJW1 1SIWA 1KQSY 4NBDA 1ZB9A 3NH8A 2HU9A 3GTJI 3RZDI 3GKQA 3NH4A 4E2ZA 3GTMS 3CCE1 4TNUA 5LL6f 2Y0SA 3CC7Z 3GTGI 1USPB 3JAMb 3CD6Z 3J7A4 3GCFA 4XX2A 2NVYI 1VQ51 1VQMZ 1W2BY 1WIIA 1YJN1 3I07A 1KD12 1LQLA 3I56Z 3D2LA 3G71Z 2GTHA 1ZB8A 2PK7A 2RIQA 1M901 2NVXI 2JIMA 2WAQA 1TFIA 1QVGY 2OOYB 4A3MI 1Y1VS 2RPRA 4MD8A 3CCR1 3CPWY 2VPZA 2JIQA 3OW2Y 1VQ9Z 1USPA 2ZAEB 4S1TA 2NVQI 4NBHA 4A3KI 2AYDA 3S14I 3I4MI 1W2BZ 2J6AA 1FDIA 3NFZA 1VQP1 4E2XA 1VQ6Z 4NBGA 3CCQ1 4HH4A 2IV2X 3GTQI 2R6MA 3G6EZ 2DE6A 1TWHI 1Y1WI 1M1K2 3CCUZ 2NVTI 1N8R2 5C44I 1RLYA 2M48A 4A3II 1Q7Y2 4HGZA 5IP9I 3IFUA 3OW2Z 3PO3S 2V8KA 3I4NI 3HOUI 3CC41 2IZ4A 3H3VJ 3FKII 1YI2Z 3KIFA 4A3FI 3S17I 3D9XA 3S1RI 1NUIA 3I551 3F3FC 1VQKZ 2JUBA 3CCM1 1Q16A 2W04A 3KIHA 4QTTA 1TWFI 1ZH1A 2OZKA 1VQ81 2VUMI 5IT9f 3VB9A 1I3QI 2QA41 2OTL1 3G4SZ 2GTIA 3CMA1 5D1OB 5A2Qf 1KC81 3RZOI 1VQN1 1Z03A 3CCJZ 3CCJ1 2KPIA 1K9M1 2QRCB 5FLXf 3ESWA 1Y8CA 2K5RA 1R9TI 4NBBA 2JR6A 1Q812 4A3BI 1TWGI 1K731 4NBAA 3S15I 3GTOI 2P28A 2VPWA 2O53A 2B63I 1TWCI 1VQ7Z 3S1MI 1Z02A 3HOVI 4A3CI 3CC71 2JMOA 3CD61 1QVFZ 4Y52I 2I3CA 2LIYA 1K8A1 4BY1I 1Q822 3GTLI 3HKZA 2JIPA 1RQFA 3CC2Z 1VQM1 3Q87A 4NFRA 3J81b 1RO0A 1I50I 5D1OA 5IT9b 1X3WA 1RO4A 2HF1A 2WB1A 1KQSZ 2NAPA 2JA6I 3I561 4RV9A 1YJ9Z 3G711 4CL1A 3IX0A 2YU9I 3QWUA 1VQOZ 1Y1VI 3J80f 4EWCA 2DE5A 2V3VA 4A93I 2QR1B 3K7AI 4MD9A 2QLVB 2IZ3A 3CCLZ 1VQ91 2K3RA 1YUKA 4MH4A 1X3ZA 5C4JI 1VQ61 4E32A 3CCSZ 3MZKB 3CXCY 2E2JI 1YITZ 3VMGA 1K732 4RVDA 1Q861 2QKDA 3NDJA 3S2DI 3MONA 3EERA 3BG1B 4E31A 3TE5B 4A3EI 3G6E1 1YUAA 1QVGZ 3CCU1 2EGTA 3FQMA 2JNYA 1K8A2 3CPWZ 2DE7A 2QREB 2V8IA 1S72Z 1I6HI 4DGLA 4E33A 1RNIA 1YI21 2RHBA 3NH5A 3CCVZ 1SFOI 5C4XI 4A3DI 1VQK1 1YIJZ 4NBCA 1WCMI 1YHQZ 3VMHA 1M902 2Q51A 2RBLA 4QTUA 3S16I 3G4S1 2JIRA 1JWHC 4MD7A 1VQLZ 2Q4ZA 5FLMI 3JAMf 5T67A 3CMEZ 1KD11 3IF8A 1AA6A 1VQ4Z 4NBEA 3H0GI 3S2HI 1WZNA 2LFUA 4X6AI 1QXFA 2YADA 3LUSA 2M6NA 3M4OI 2QEXZ 2P3YA 2E2HI 3D6WA 3VTNA 3HOWI 2JA7I 3F3PC 3IR7A 1VQ71 1DL6A 1NP6A 1JJ2Y 4E2WA 3GTMI 2OTJZ 2H85A 1YJWZ 1RO2A 3P5JB 4RVGA 2JA8I 4A3LI 3CC21 1K83I 1Z01A 4BXXI 1WW9A 3CCEZ 5A2Qb 1M1K1 3FQQA 5T64A 1N8R1 2LEXA 2F4MA 1YJ91 3HOZI 1FDOA 2O4HA 1Q7Y1 1VQ5Z 3EEDA 1JJ2Z 3BG0B 3HOYI 4NBFA 5CM2M 5FLXb 1VQO1 2GU2A 1YJNZ 1QYPA 1KC82 2E7ZA 2RT9A 4AYBA 5AN9F 4MONA 4DK1A 3CCL1 1K9M2 1ML8A 4E30A 1NJI1 4A3GI 2R92I 1P9NA 3GTKI
chains in the Genus database with same CATH topology
2KI7B 3CCS1 1YIT1 4BBSI 3HOXI 3CCRZ 1S7MA 4A3JI 2V8JA 3NDIA 4MXUA 5IP7I 3GTPI 4RS4A 5C3EI 2VUGA 3S1QI 2G2KA 1VQPZ 4NB8A 2E9HA 4HGYA 4NOZA 1QF8A 1S721 1Q811 2W03A 3CCQZ 2JA5I 3PO3I 4BY7I 2OOXB 1PFTA 3T4NB 2BJOA 3S1NI 3CXCZ 2E2II 1L1OC 3CCV1 4BBRI 3J80b 2QRDB 2AKLA 4DQYB 1YIJ1 2R93I 1YHQ1 3M3YI 2PMZA 1Q821 4RVFA 3VMIA 1VQL1 3CC4Z 4MRIA 4RVHA 2VF1A 3CME1 1VQ41 3CQZI 3I55Z 4NH1C 4E2YA 2JS4A 1NJI2 3CCMZ 3J81f 1VQ8Z 3PO2I 1KRLA 2QA4Z 2OTLZ 3TDHB 1Q862 2QEX1 3CMAZ 4NB9A 1QVFY 1X0TA 1TWAI 2PM9A 1VQNZ 2F4OA 5T6BA 5D1PA 1VLAA 2R7ZI 4Y7NI 1N2FA 3U50C 2OTJ1 3MZLB 1YJW1 1KQSY 4NBDA 1ZB9A 3NH8A 2HU9A 3GTJI 3RZDI 3GKQA 3NH4A 4E2ZA 3GTMS 3CCE1 4TNUA 5LL6f 2Y0SA 3CC7Z 3GTGI 1USPB 3JAMb 3CD6Z 3J7A4 3GCFA 4XX2A 2NVYI 1VQ51 1VQMZ 1W2BY 1WIIA 1YJN1 3I07A 1KD12 1LQLA 3I56Z 3G71Z 2GTHA 1ZB8A 2PK7A 2RIQA 1M901 2NVXI 2WAQA 1TFIA 1QVGY 2OOYB 4A3MI 1Y1VS 2RPRA 4MD8A 3CCR1 3CPWY 3OW2Y 1VQ9Z 1USPA 2ZAEB 4S1TA 2NVQI 4NBHA 4A3KI 3S14I 3I4MI 1W2BZ 2J6AA 3NFZA 1VQP1 4E2XA 1VQ6Z 4NBGA 3CCQ1 4HH4A 3GTQI 2R6MA 3G6EZ 2DE6A 1TWHI 1Y1WI 1M1K2 3CCUZ 2NVTI 1N8R2 5C44I 1RLYA 2M48A 4A3II 1Q7Y2 4HGZA 5IP9I 3IFUA 3OW2Z 3PO3S 2V8KA 3I4NI 3HOUI 3CC41 2IZ4A 3H3VJ 3FKII 1YI2Z 3KIFA 4A3FI 3S17I 3D9XA 3S1RI 1NUIA 3I551 3F3FC 1VQKZ 2JUBA 3CCM1 2W04A 3KIHA 4QTTA 1TWFI 1ZH1A 2OZKA 1VQ81 2VUMI 5IT9f 3VB9A 1I3QI 2QA41 2OTL1 3G4SZ 2GTIA 3CMA1 5D1OB 5A2Qf 1KC81 3RZOI 1VQN1 1Z03A 3CCJZ 3CCJ1 2KPIA 1K9M1 2QRCB 5FLXf 3ESWA 1R9TI 2K5RA 4NBBA 2JR6A 1Q812 4A3BI 1TWGI 1K731 4NBAA 3S15I 3GTOI 2P28A 2O53A 2B63I 1TWCI 1VQ7Z 3S1MI 1Z02A 3HOVI 4A3CI 3CC71 2JMOA 3CD61 1QVFZ 4Y52I 2I3CA 2LIYA 1K8A1 4BY1I 1Q822 3GTLI 3HKZA 1RQFA 1VQM1 3CC2Z 3Q87A 4NFRA 3J81b 1RO0A 1I50I 5D1OA 5IT9b 1X3WA 1RO4A 2HF1A 2WB1A 1KQSZ 2JA6I 3I561 4RV9A 1YJ9Z 3G711 4CL1A 3IX0A 2YU9I 3QWUA 1VQOZ 1Y1VI 3J80f 4EWCA 2DE5A 4A93I 2QR1B 3K7AI 4MD9A 2QLVB 2IZ3A 3CCLZ 1VQ91 2K3RA 1YUKA 4MH4A 1X3ZA 5C4JI 1VQ61 4E32A 3CCSZ 3MZKB 3CXCY 2E2JI 1YITZ 3VMGA 1K732 4RVDA 1Q861 2QKDA 3NDJA 3S2DI 3MONA 3EERA 3BG1B 4E31A 3TE5B 4A3EI 3G6E1 1YUAA 1QVGZ 3CCU1 2EGTA 3FQMA 2JNYA 1K8A2 3CPWZ 2DE7A 2QREB 2V8IA 1S72Z 1I6HI 4DGLA 4E33A 1RNIA 1YI21 2RHBA 3NH5A 3CCVZ 1SFOI 5C4XI 4A3DI 1VQK1 1YIJZ 4NBCA 1WCMI 1YHQZ 3VMHA 1M902 2Q51A 2RBLA 4QTUA 3S16I 3G4S1 1JWHC 4MD7A 1VQLZ 2Q4ZA 5FLMI 3JAMf 5T67A 3CMEZ 1KD11 3IF8A 1VQ4Z 4NBEA 3H0GI 3S2HI 2LFUA 4X6AI 2YADA 3LUSA 2M6NA 3M4OI 2QEXZ 2P3YA 2E2HI 3D6WA 3VTNA 3HOWI 2JA7I 3F3PC 1VQ71 1DL6A 1NP6A 1JJ2Y 4E2WA 3GTMI 2OTJZ 2H85A 1YJWZ 1RO2A 3P5JB 4RVGA 2JA8I 4A3LI 3CC21 1K83I 1Z01A 4BXXI 1WW9A 3CCEZ 5A2Qb 1M1K1 3FQQA 5T64A 1N8R1 2F4MA 1YJ91 3HOZI 2O4HA 1Q7Y1 1VQ5Z 3EEDA 1JJ2Z 3BG0B 3HOYI 4NBFA 5CM2M 5FLXb 1VQO1 2GU2A 1YJNZ 1QYPA 1KC82 2RT9A 4AYBA 5AN9F 4MONA 4DK1A 3CCL1 1K9M2 1ML8A 4E30A 1NJI1 4A3GI 2R92I 1P9NA 3GTKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Z;  3CCS 1;  1VQN 1;  3CCJ Z;  3CCJ 1;  1YIT 1;  1K9M 1;  1VQ5 1;  1YI2 1;  3CCV Z;  3CCR Z;  1VQM Z;  1W2B Y;  1VQK 1;  1YJN 1;  1Q81 2;  1YIJ Z;  1K73 1;  1YHQ Z;  1M90 2;  1KD1 2;  1VQP Z;  3G4S 1;  3I56 Z;  1VQ7 Z;  1VQL Z;  3G71 Z;  1S72 1;  1Q81 1;  3CCQ Z;  3CC7 1;  3CD6 1;  1M90 1;  3CME Z;  1KD1 1;  1QVF Z;  1VQ4 Z;  1QVG Y;  1K8A 1;  1Q82 2;  3CXC Z;  3CCV 1;  3CCR 1;  3CPW Y;  3CC2 Z;  1VQM 1;  3OW2 Y;  1VQ9 Z;  2QEX Z;  1YIJ 1;  1YHQ 1;  1W2B Z;  1Q82 1;  1KQS Z;  1VQP 1;  1VQ6 Z;  3I56 1;  1VQ7 1;  1JJ2 Y;  1VQL 1;  1YJ9 Z;  3CC4 Z;  3G71 1;  3CCQ 1;  2OTJ Z;  3CME 1;  1YJW Z;  1VQ4 1;  1VQO Z;  3I55 Z;  3G6E Z;  1NJI 2;  3CCM Z;  1VQ8 Z;  1M1K 2;  3CCU Z;  3CC2 1;  2QA4 Z;  1N8R 2;  2OTL Z;  3CCL Z;  1VQ9 1;  1Q86 2;  2QEX 1;  1Q7Y 2;  3CMA Z;  3CCE Z;  3OW2 Z;  1QVF Y;  1VQ6 1;  3CCS Z;  1VQN Z;  1M1K 1;  3CXC Y;  1N8R 1;  1YIT Z;  3CC4 1;  1YJ9 1;  1K73 2;  1Q86 1;  1Q7Y 1;  2OTJ 1;  1YI2 Z;  1VQ5 Z;  1JJ2 Z;  1YJW 1;  1VQO 1;  3I55 1;  1VQK Z;  1YJN Z;  3G6E 1;  1KQS Y;  1KC8 2;  3CCM 1;  1QVG Z;  1VQ8 1;  3CCU 1;  2QA4 1;  2OTL 1;  3G4S Z;  3CCL 1;  1K8A 2;  3CPW Z;  1K9M 2;  3CMA 1;  3CCE 1;  1S72 Z;  1NJI 1;  1KC8 1;  3CC7 Z; 
#chains in the Genus database with same CATH topology
 2KI7 B;  3CCS 1;  1YIT 1;  4BBS I;  3HOX I;  3CCR Z;  1S7M A;  4A3J I;  2V8J A;  3NDI A;  4MXU A;  5IP7 I;  3GTP I;  4RS4 A;  5C3E I;  2VUG A;  3S1Q I;  2G2K A;  1VQP Z;  4NB8 A;  2E9H A;  4HGY A;  4NOZ A;  1QF8 A;  1S72 1;  1Q81 1;  2W03 A;  3CCQ Z;  2JA5 I;  3PO3 I;  4BY7 I;  2OOX B;  1PFT A;  3T4N B;  2BJO A;  3S1N I;  3CXC Z;  2E2I I;  1L1O C;  3CCV 1;  4BBR I;  2V45 A;  3J80 b;  2QRD B;  2AKL A;  4DQY B;  1YIJ 1;  2R93 I;  1YHQ 1;  3M3Y I;  2PMZ A;  1Q82 1;  4RVF A;  3VMI A;  1VQL 1;  3CC4 Z;  4MRI A;  2VPY A;  4RVH A;  2VF1 A;  3CME 1;  1VQ4 1;  3CQZ I;  3I55 Z;  4NH1 C;  4E2Y A;  2JS4 A;  1NJI 2;  3CCM Z;  3J81 f;  1VQ8 Z;  3PO2 I;  1KRL A;  2QA4 Z;  2OTL Z;  3TDH B;  1Q86 2;  2QEX 1;  2JIO A;  3CMA Z;  4NB9 A;  2VPX A;  1QVF Y;  1X0T A;  1TWA I;  2PM9 A;  1VQN Z;  2F4O A;  5T6B A;  1WJ2 A;  5D1P A;  1VLA A;  2R7Z I;  4Y7N I;  1N2F A;  3U50 C;  2OTJ 1;  3MZL B;  1YJW 1;  1SIW A;  1KQS Y;  4NBD A;  1ZB9 A;  3NH8 A;  2HU9 A;  3GTJ I;  3RZD I;  3GKQ A;  3NH4 A;  4E2Z A;  3GTM S;  3CCE 1;  4TNU A;  5LL6 f;  2Y0S A;  3CC7 Z;  3GTG I;  1USP B;  3JAM b;  3CD6 Z;  3J7A 4;  3GCF A;  4XX2 A;  2NVY I;  1VQ5 1;  1VQM Z;  1W2B Y;  1WII A;  1YJN 1;  3I07 A;  1KD1 2;  1LQL A;  3I56 Z;  3D2L A;  3G71 Z;  2GTH A;  1ZB8 A;  2PK7 A;  2RIQ A;  1M90 1;  2NVX I;  2JIM A;  2WAQ A;  1TFI A;  1QVG Y;  2OOY B;  4A3M I;  1Y1V S;  2RPR A;  4MD8 A;  3CCR 1;  3CPW Y;  2VPZ A;  2JIQ A;  3OW2 Y;  1VQ9 Z;  1USP A;  2ZAE B;  4S1T A;  2NVQ I;  4NBH A;  4A3K I;  2AYD A;  3S14 I;  3I4M I;  1W2B Z;  2J6A A;  1FDI A;  3NFZ A;  1VQP 1;  4E2X A;  1VQ6 Z;  4NBG A;  3CCQ 1;  4HH4 A;  2IV2 X;  3GTQ I;  2R6M A;  3G6E Z;  2DE6 A;  1TWH I;  1Y1W I;  1M1K 2;  3CCU Z;  2NVT I;  1N8R 2;  5C44 I;  1RLY A;  2M48 A;  4A3I I;  1Q7Y 2;  4HGZ A;  5IP9 I;  3IFU A;  3OW2 Z;  3PO3 S;  2V8K A;  3I4N I;  3HOU I;  3CC4 1;  2IZ4 A;  3H3V J;  3FKI I;  1YI2 Z;  3KIF A;  4A3F I;  3S17 I;  3D9X A;  3S1R I;  1NUI A;  3I55 1;  3F3F C;  1VQK Z;  2JUB A;  3CCM 1;  1Q16 A;  2W04 A;  3KIH A;  4QTT A;  1TWF I;  1ZH1 A;  2OZK A;  1VQ8 1;  2VUM I;  5IT9 f;  3VB9 A;  1I3Q I;  2QA4 1;  2OTL 1;  3G4S Z;  2GTI A;  3CMA 1;  5D1O B;  5A2Q f;  1KC8 1;  3RZO I;  1VQN 1;  1Z03 A;  3CCJ Z;  3CCJ 1;  2KPI A;  1K9M 1;  2QRC B;  5FLX f;  3ESW A;  1Y8C A;  2K5R A;  1R9T I;  4NBB A;  2JR6 A;  1Q81 2;  4A3B I;  1TWG I;  1K73 1;  4NBA A;  3S15 I;  3GTO I;  2P28 A;  2VPW A;  2O53 A;  2B63 I;  1TWC I;  1VQ7 Z;  3S1M I;  1Z02 A;  3HOV I;  4A3C I;  3CC7 1;  2JMO A;  3CD6 1;  1QVF Z;  4Y52 I;  2I3C A;  2LIY A;  1K8A 1;  4BY1 I;  1Q82 2;  3GTL I;  3HKZ A;  2JIP A;  1RQF A;  3CC2 Z;  1VQM 1;  3Q87 A;  4NFR A;  3J81 b;  1RO0 A;  1I50 I;  5D1O A;  5IT9 b;  1X3W A;  1RO4 A;  2HF1 A;  2WB1 A;  1KQS Z;  2NAP A;  2JA6 I;  3I56 1;  4RV9 A;  1YJ9 Z;  3G71 1;  4CL1 A;  3IX0 A;  2YU9 I;  3QWU A;  1VQO Z;  1Y1V I;  3J80 f;  4EWC A;  2DE5 A;  2V3V A;  4A93 I;  2QR1 B;  3K7A I;  4MD9 A;  2QLV B;  2IZ3 A;  3CCL Z;  1VQ9 1;  2K3R A;  1YUK A;  4MH4 A;  1X3Z A;  5C4J I;  1VQ6 1;  4E32 A;  3CCS Z;  3MZK B;  3CXC Y;  2E2J I;  1YIT Z;  3VMG A;  1K73 2;  4RVD A;  1Q86 1;  2QKD A;  3NDJ A;  3S2D I;  3MON A;  3EER A;  3BG1 B;  4E31 A;  3TE5 B;  4A3E I;  3G6E 1;  1YUA A;  1QVG Z;  3CCU 1;  2EGT A;  3FQM A;  2JNY A;  1K8A 2;  3CPW Z;  2DE7 A;  2QRE B;  2V8I A;  1S72 Z;  1I6H I;  4DGL A;  4E33 A;  1RNI A;  1YI2 1;  2RHB A;  3NH5 A;  3CCV Z;  1SFO I;  5C4X I;  4A3D I;  1VQK 1;  1YIJ Z;  4NBC A;  1WCM I;  1YHQ Z;  3VMH A;  1M90 2;  2Q51 A;  2RBL A;  4QTU A;  3S16 I;  3G4S 1;  2JIR A;  1JWH C;  4MD7 A;  1VQL Z;  2Q4Z A;  5FLM I;  3JAM f;  5T67 A;  3CME Z;  1KD1 1;  3IF8 A;  1AA6 A;  1VQ4 Z;  4NBE A;  3H0G I;  3S2H I;  1WZN A;  2LFU A;  4X6A I;  1QXF A;  2YAD A;  3LUS A;  2M6N A;  3M4O I;  2QEX Z;  2P3Y A;  2E2H I;  3D6W A;  3VTN A;  3HOW I;  2JA7 I;  3F3P C;  3IR7 A;  1VQ7 1;  1DL6 A;  1NP6 A;  1JJ2 Y;  4E2W A;  3GTM I;  2OTJ Z;  2H85 A;  1YJW Z;  1RO2 A;  3P5J B;  4RVG A;  2JA8 I;  4A3L I;  3CC2 1;  1K83 I;  1Z01 A;  4BXX I;  1WW9 A;  3CCE Z;  5A2Q b;  1M1K 1;  3FQQ A;  5T64 A;  1N8R 1;  2LEX A;  2F4M A;  1YJ9 1;  3HOZ I;  1FDO A;  2O4H A;  1Q7Y 1;  1VQ5 Z;  3EED A;  1JJ2 Z;  3BG0 B;  3HOY I;  4NBF A;  5CM2 M;  5FLX b;  1VQO 1;  2GU2 A;  1YJN Z;  1QYP A;  1KC8 2;  2E7Z A;  2RT9 A;  4AYB A;  5AN9 F;  4MON A;  4DK1 A;  3CCL 1;  1K9M 2;  1ML8 A;  4E30 A;  1NJI 1;  4A3G I;  2R92 I;  1P9N A;  3GTK I; 
#chains in the Genus database with same CATH homology
 2KI7 B;  3CCS 1;  1YIT 1;  4BBS I;  3HOX I;  3CCR Z;  1S7M A;  4A3J I;  2V8J A;  3NDI A;  4MXU A;  5IP7 I;  3GTP I;  4RS4 A;  5C3E I;  2VUG A;  3S1Q I;  2G2K A;  1VQP Z;  4NB8 A;  2E9H A;  4HGY A;  4NOZ A;  1QF8 A;  1S72 1;  1Q81 1;  2W03 A;  3CCQ Z;  2JA5 I;  3PO3 I;  4BY7 I;  2OOX B;  1PFT A;  3T4N B;  2BJO A;  3S1N I;  3CXC Z;  2E2I I;  1L1O C;  3CCV 1;  4BBR I;  3J80 b;  2QRD B;  2AKL A;  4DQY B;  1YIJ 1;  2R93 I;  1YHQ 1;  3M3Y I;  2PMZ A;  1Q82 1;  4RVF A;  3VMI A;  1VQL 1;  3CC4 Z;  4MRI A;  4RVH A;  2VF1 A;  3CME 1;  1VQ4 1;  3CQZ I;  3I55 Z;  4NH1 C;  4E2Y A;  2JS4 A;  1NJI 2;  3CCM Z;  3J81 f;  1VQ8 Z;  3PO2 I;  1KRL A;  2QA4 Z;  2OTL Z;  3TDH B;  1Q86 2;  2QEX 1;  3CMA Z;  4NB9 A;  1QVF Y;  1X0T A;  1TWA I;  2PM9 A;  1VQN Z;  2F4O A;  5T6B A;  5D1P A;  1VLA A;  2R7Z I;  4Y7N I;  1N2F A;  3U50 C;  2OTJ 1;  3MZL B;  1YJW 1;  1KQS Y;  4NBD A;  1ZB9 A;  3NH8 A;  2HU9 A;  3GTJ I;  3RZD I;  3GKQ A;  3NH4 A;  4E2Z A;  3GTM S;  3CCE 1;  4TNU A;  5LL6 f;  2Y0S A;  3CC7 Z;  3GTG I;  1USP B;  3JAM b;  3CD6 Z;  3J7A 4;  3GCF A;  4XX2 A;  2NVY I;  1VQ5 1;  1VQM Z;  1W2B Y;  1WII A;  1YJN 1;  3I07 A;  1KD1 2;  1LQL A;  3I56 Z;  3G71 Z;  2GTH A;  1ZB8 A;  2PK7 A;  2RIQ A;  1M90 1;  2NVX I;  2WAQ A;  1TFI A;  1QVG Y;  2OOY B;  4A3M I;  1Y1V S;  2RPR A;  4MD8 A;  3CCR 1;  3CPW Y;  3OW2 Y;  1VQ9 Z;  1USP A;  2ZAE B;  4S1T A;  2NVQ I;  4NBH A;  4A3K I;  3S14 I;  3I4M I;  1W2B Z;  2J6A A;  3NFZ A;  1VQP 1;  4E2X A;  1VQ6 Z;  4NBG A;  3CCQ 1;  4HH4 A;  3GTQ I;  2R6M A;  3G6E Z;  2DE6 A;  1TWH I;  1Y1W I;  1M1K 2;  3CCU Z;  2NVT I;  1N8R 2;  5C44 I;  1RLY A;  2M48 A;  4A3I I;  1Q7Y 2;  4HGZ A;  5IP9 I;  3IFU A;  3OW2 Z;  3PO3 S;  2V8K A;  3I4N I;  3HOU I;  3CC4 1;  2IZ4 A;  3H3V J;  3FKI I;  1YI2 Z;  3KIF A;  4A3F I;  3S17 I;  3D9X A;  3S1R I;  1NUI A;  3I55 1;  3F3F C;  1VQK Z;  2JUB A;  3CCM 1;  2W04 A;  3KIH A;  4QTT A;  1TWF I;  1ZH1 A;  2OZK A;  1VQ8 1;  2VUM I;  5IT9 f;  3VB9 A;  1I3Q I;  2QA4 1;  2OTL 1;  3G4S Z;  2GTI A;  3CMA 1;  5D1O B;  5A2Q f;  1KC8 1;  3RZO I;  1VQN 1;  1Z03 A;  3CCJ Z;  3CCJ 1;  2KPI A;  1K9M 1;  2QRC B;  5FLX f;  3ESW A;  1R9T I;  2K5R A;  4NBB A;  2JR6 A;  1Q81 2;  4A3B I;  1TWG I;  1K73 1;  4NBA A;  3S15 I;  3GTO I;  2P28 A;  2O53 A;  2B63 I;  1TWC I;  1VQ7 Z;  3S1M I;  1Z02 A;  3HOV I;  4A3C I;  3CC7 1;  2JMO A;  3CD6 1;  1QVF Z;  4Y52 I;  2I3C A;  2LIY A;  1K8A 1;  4BY1 I;  1Q82 2;  3GTL I;  3HKZ A;  1RQF A;  1VQM 1;  3CC2 Z;  3Q87 A;  4NFR A;  3J81 b;  1RO0 A;  1I50 I;  5D1O A;  5IT9 b;  1X3W A;  1RO4 A;  2HF1 A;  2WB1 A;  1KQS Z;  2JA6 I;  3I56 1;  4RV9 A;  1YJ9 Z;  3G71 1;  4CL1 A;  3IX0 A;  2YU9 I;  3QWU A;  1VQO Z;  1Y1V I;  3J80 f;  4EWC A;  2DE5 A;  4A93 I;  2QR1 B;  3K7A I;  4MD9 A;  2QLV B;  2IZ3 A;  3CCL Z;  1VQ9 1;  2K3R A;  1YUK A;  4MH4 A;  1X3Z A;  5C4J I;  1VQ6 1;  4E32 A;  3CCS Z;  3MZK B;  3CXC Y;  2E2J I;  1YIT Z;  3VMG A;  1K73 2;  4RVD A;  1Q86 1;  2QKD A;  3NDJ A;  3S2D I;  3MON A;  3EER A;  3BG1 B;  4E31 A;  3TE5 B;  4A3E I;  3G6E 1;  1YUA A;  1QVG Z;  3CCU 1;  2EGT A;  3FQM A;  2JNY A;  1K8A 2;  3CPW Z;  2DE7 A;  2QRE B;  2V8I A;  1S72 Z;  1I6H I;  4DGL A;  4E33 A;  1RNI A;  1YI2 1;  2RHB A;  3NH5 A;  3CCV Z;  1SFO I;  5C4X I;  4A3D I;  1VQK 1;  1YIJ Z;  4NBC A;  1WCM I;  1YHQ Z;  3VMH A;  1M90 2;  2Q51 A;  2RBL A;  4QTU A;  3S16 I;  3G4S 1;  1JWH C;  4MD7 A;  1VQL Z;  2Q4Z A;  5FLM I;  3JAM f;  5T67 A;  3CME Z;  1KD1 1;  3IF8 A;  1VQ4 Z;  4NBE A;  3H0G I;  3S2H I;  2LFU A;  4X6A I;  2YAD A;  3LUS A;  2M6N A;  3M4O I;  2QEX Z;  2P3Y A;  2E2H I;  3D6W A;  3VTN A;  3HOW I;  2JA7 I;  3F3P C;  1VQ7 1;  1DL6 A;  1NP6 A;  1JJ2 Y;  4E2W A;  3GTM I;  2OTJ Z;  2H85 A;  1YJW Z;  1RO2 A;  3P5J B;  4RVG A;  2JA8 I;  4A3L I;  3CC2 1;  1K83 I;  1Z01 A;  4BXX I;  1WW9 A;  3CCE Z;  5A2Q b;  1M1K 1;  3FQQ A;  5T64 A;  1N8R 1;  2F4M A;  1YJ9 1;  3HOZ I;  2O4H A;  1Q7Y 1;  1VQ5 Z;  3EED A;  1JJ2 Z;  3BG0 B;  3HOY I;  4NBF A;  5CM2 M;  5FLX b;  1VQO 1;  2GU2 A;  1YJN Z;  1QYP A;  1KC8 2;  2RT9 A;  4AYB A;  5AN9 F;  4MON A;  4DK1 A;  3CCL 1;  1K9M 2;  1ML8 A;  4E30 A;  1NJI 1;  4A3G I;  2R92 I;  1P9N A;  3GTK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...