1K731

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k73100
1Q7Y1 1JJ2Y 1KD11 1Q822 1Q861 1K9M1 3I551 1YHQ1 1VQL1 1K731 1VQOZ 3CCV1 3CC2Z 3CMAZ 1YJ91 3CCR1 1YIJ1 1K8A1 1VQ9Z 1YI21 3CCJ1 1NJI2 1W2BY 3CCL1 3CCEZ 1K8A2 1KD12 1S721 3G711 3CCS1 1VQ7Z 3CCJZ 1K732 3CD61 1VQM1 3CCQZ 1M901 1YI2Z 1VQNZ 3G71Z 3CC21 1KC82 3CD6Z 3CPWZ 1VQK1 1VQP1 1VQ5Z 2OTJ1 1YJW1 3CXCY 3G4S1 1VQ81 3CPWY 1M1K2 3CCVZ 1Q862 1YIJZ 3CME1 2QA41 3CC41 1JJ2Z 3I55Z 1YHQZ 3G6E1 3I56Z 1YITZ 2OTLZ 1W2BZ 1VQ41 1VQ51 1YIT1 1N8R1 2OTJZ 1YJNZ 3I561 1VQ8Z 3CXCZ 2QEX1 1Q7Y2 1YJWZ 1VQPZ 3CCMZ 1VQN1 3CCUZ 3CCQ1 1N8R2 1VQMZ 1Q821 1NJI1 3CCE1 3CCSZ 3CC71 1VQ6Z 1VQKZ 1M902 3OW2Y 1M1K1 1KQSY 1QVGZ 1VQ71 3CC7Z 1VQ61 1S72Z 1Q811 3CCLZ 1KC81 3CCU1 3CCM1 2QEXZ 1YJ9Z 1VQ91 1VQ4Z 1VQO1 1K9M2 3CCRZ 1VQLZ 2OTL1 1QVFZ 3CMA1 3G6EZ 1YJN1 1Q812 2QA4Z 1QVGY 3CC4Z 1KQSZ 1QVFY 3OW2Z 3CMEZ 3G4SZ
chains in the Genus database with same CATH superfamily
1Q7Y1 2NVYI 1ZB9A 3FKII 2PK7A 2E2HI 1K9M1 1ZB8A 3I551 2GU2A 5D1OA 3S17I 2KI7B 1YIJ1 2DE5A 4CL1A 1I50I 1NJI2 2OZKA 1TWHI 2F4OA 4NBDA 2PMZA 3H0GI 2QREB 1VQ7Z 4BY1I 3CCJZ 4BBSI 3GTQI 1VQM1 3JAMb 2K3RA 3G71Z 3J81b 4RS4A 2V8KA 2AYDA 4A3EI 1VLAA 3J80b 5T64A 3ESWA 1M1K2 3CPWY 5A2Qf 2QA41 1USPA 1X3WA 4XX2A 3S2HI 3I56Z 1PFTA 3HOVI 2JS4A 2JMOA 4A3LI 3CXCZ 2QEX1 1YJWZ 4E30A 3S1RI 2RBLA 2F4MA 3IX0A 3CCQ1 3S16I 5IT9f 2P3YA 4A3BI 3VMHA 3GCFA 3CCE1 2W03A 3GKQA 2E2JI 3OW2Y 1M1K1 1TFIA 2NVQI 1QYPA 5C4JI 1VQ71 5D1OB 5FLXf 2G2KA 1S72Z 4E32A 1Q811 3S1QI 1KC81 2QRDB 2V8IA 1NP6A 3NH5A 3TE5B 5C3EI 2H85A 1VQ4Z 1TWCI 1VQO1 4A3JI 1RO0A 2OTL1 1QVFZ 3CC4Z 2VUMI 3OW2Z 4MH4A 3HOYI 3GTMS 3BG1B 1KD11 4Y52I 1Q861 1YHQ1 1K731 1VQOZ 4E2ZA 3CCV1 1YJ91 2I3CA 3IFUA 1K8A1 1RLYA 1WZNA 3CCJ1 1W2BY 1AA6A 1WIIA 2HU9A 1KD12 3G711 2IZ3A 2QKDA 2JIPA 5IT9b 2NVTI 3M4OI 1YI2Z 1VQNZ 1P9NA 1WCMI 1ZH1A 4NBAA 4MD7A 2OTJ1 2V45A 3NDIA 4A3KI 1VQ81 1YUKA 3GTLI 2V3VA 4BBRI 3HOZI 3CME1 2E9HA 3RZOI 3CC41 3I55Z 2DE6A 3G6E1 2V8JA 3KIHA 4HH4A 4RVHA 4MXUA 2DE7A 3PO2I 4DQYB 1JWHC 5A2Qb 2OTJZ 1YJNZ 1VQ8Z 1Q7Y2 2M48A 2VPYA 3MONA 4RVGA 2E7ZA 3HKZA 3CCMZ 2R6MA 2EGTA 2JA6I 2J6AA 1NJI1 3CCSZ 2B63I 3VMIA 1M902 2RHBA 3D2LA 2ZAEB 2YU9I 1VQ61 3LUSA 2OOXB 3HOXI 4NFRA 3CCLZ 1SFOI 2W04A 3FQMA 4MD8A 2IZ4A 2QEXZ 4TNUA 2R7ZI 3M3YI 2VPXA 1VQ91 1K9M2 4EWCA 2JA5I 1USPB 1Q812 1QVGY 2BJOA 1L1OC 3I07A 4NBHA 2JNYA 5FLXb 1JJ2Y 2JIQA 4E2YA 1Q822 4RVFA 5FLMI 1TWAI 2LIYA 1VQL1 2VF1A 4Y7NI 3MZLB 1Y1VI 3CC2Z 3CMAZ 3IR7A 1Z03A 4HGZA 3GTPI 4E33A 4BY7I 4BXXI 3CCR1 1X3ZA 1YI21 1Y1WI 3CCL1 3CCEZ 3KIFA 4NBEA 3F3FC 1QF8A 1S721 3CCS1 4A3DI 2JA7I 2Y0SA 5C4XI 2Q4ZA 3VB9A 1Y8CA 1M901 2VPZA 5T67A 3CC21 5D1PA 1LQLA 2IV2X 4DK1A 1KC82 3CD6Z 4NBFA 2NVXI 2GTHA 2OOYB 1VQP1 2JUBA 1VQ5Z 3S2DI 1YJW1 5T6BA 3JAMf 3HOWI 2GTIA 1QXFA 2M6NA 3BG0B 3CCVZ 1Q862 3S1MI 3IF8A 2R92I 3EEDA 3CQZI 2AKLA 1S7MA 5IP9I 1N2FA 1YHQZ 2YADA 4A3CI 4E2XA 1W2BZ 1VQ41 3Q87A 1VQ51 1N8R1 3NH8A 4NBGA 2JIMA 1Z01A 1K83I 4MONA 3PO3I 1DL6A 2RIQA 5IP7I 3GTKI 1Y1VS 2O53A 3D9XA 1N8R2 3I4MI 1Q821 1NUIA 1VQ6Z 4QTTA 4MRIA 3CC7Z 2JR6A 4X6AI 2WB1A 4NH1C 3S15I 1YJ9Z 1YUAA 1X0TA 1KRLA 2QR1B 1RNIA 2JIRA 1RO2A 3G6EZ 1YJN1 2QA4Z 3T4NB 4AYBA 4NBBA 1KQSZ 1I3QI 1RQFA 1QVFY 3NDJA 2JIOA 1FDIA 3G4SZ 3PO3S 3QWUA 2QLVB 3J80f 4A3FI 3U50C 4RVDA 1FDOA 2VPWA 3D6WA 2PM9A 2QRCB 1WJ2A 3VTNA 1VQ9Z 4A3II 5C44I 1K8A2 1Z02A 3S14I 4E2WA 1K732 3VMGA 5LL6f 3CD61 1R9TI 2RPRA 3CCQZ 3GTOI 1WW9A 1RO4A 2E2II 3S1NI 4A93I 4NB9A 3GTGI 3CPWZ 3F3PC 1SIWA 3MZKB 3TDHB 4A3MI 1VQK1 2HF1A 3CXCY 3G4S1 4NBCA 5CM2M 1YIJZ 5AN9F 2R93I 3P5JB 1JJ2Z 3RZDI 2KPIA 2Q51A 1YITZ 2OTLZ 4MD9A 1YIT1 3I561 1VQPZ 4QTUA 3HOUI 2JA8I 4NB8A 1ML8A 1VQN1 2K5RA 3I4NI 3CCUZ 4NOZA 1VQMZ 4S1TA 4E31A 2VUGA 3CC71 1VQKZ 3GTMI 2O4HA 2WAQA 4HGYA 1KQSY 3FQQA 1QVGZ 4A3GI 1TWFI 3J81f 2RT9A 3NFZA 3CCU1 2NAPA 3CCM1 3GTJI 2LFUA 1I6HI 1TWGI 2P28A 3NH4A 3EERA 4RV9A 3CCRZ 1VQLZ 2LEXA 3CMA1 3H3VJ 3J7A4 1Q16A 4DGLA 3K7AI 3CMEZ
chains in the Genus database with same CATH topology
1Q7Y1 2NVYI 1ZB9A 3FKII 2PK7A 2E2HI 1K9M1 1ZB8A 3I551 2GU2A 5D1OA 3S17I 2KI7B 1YIJ1 2DE5A 4CL1A 1I50I 1NJI2 2OZKA 1TWHI 2F4OA 4NBDA 2PMZA 3H0GI 2QREB 1VQ7Z 4BY1I 3CCJZ 4BBSI 3GTQI 1VQM1 3JAMb 2K3RA 3G71Z 3J81b 4RS4A 2V8KA 4A3EI 1VLAA 3J80b 5T64A 3ESWA 1M1K2 3CPWY 5A2Qf 2QA41 1USPA 1X3WA 4XX2A 3S2HI 3I56Z 1PFTA 3HOVI 2JS4A 2JMOA 4A3LI 3CXCZ 2QEX1 1YJWZ 4E30A 3S1RI 2RBLA 2F4MA 3IX0A 3CCQ1 3S16I 5IT9f 2P3YA 4A3BI 3VMHA 3GCFA 3CCE1 2W03A 3GKQA 2E2JI 3OW2Y 1M1K1 1TFIA 2NVQI 1QYPA 5C4JI 1VQ71 5D1OB 5FLXf 2G2KA 1S72Z 4E32A 1Q811 3S1QI 1KC81 2QRDB 2V8IA 1NP6A 3NH5A 3TE5B 5C3EI 2H85A 1VQ4Z 1TWCI 1VQO1 4A3JI 1RO0A 2OTL1 1QVFZ 3CC4Z 2VUMI 3OW2Z 4MH4A 3HOYI 3GTMS 3BG1B 1KD11 4Y52I 1Q861 1YHQ1 1K731 1VQOZ 4E2ZA 3CCV1 1YJ91 2I3CA 3IFUA 1K8A1 1RLYA 3CCJ1 1W2BY 1WIIA 2HU9A 1KD12 3G711 2IZ3A 2QKDA 5IT9b 2NVTI 3M4OI 1YI2Z 1VQNZ 1P9NA 1WCMI 1ZH1A 4NBAA 4MD7A 2OTJ1 3NDIA 4A3KI 1VQ81 1YUKA 3GTLI 4BBRI 3HOZI 3CME1 2E9HA 3RZOI 3CC41 3I55Z 2DE6A 3G6E1 2V8JA 3KIHA 4HH4A 4RVHA 4MXUA 2DE7A 3PO2I 4DQYB 1JWHC 5A2Qb 2OTJZ 1YJNZ 1VQ8Z 1Q7Y2 2M48A 3MONA 4RVGA 3HKZA 3CCMZ 2R6MA 2EGTA 2JA6I 2J6AA 1NJI1 3CCSZ 2B63I 3VMIA 1M902 2RHBA 2ZAEB 2YU9I 1VQ61 3LUSA 2OOXB 3HOXI 4NFRA 3CCLZ 1SFOI 2W04A 3FQMA 4MD8A 2IZ4A 2QEXZ 4TNUA 2R7ZI 3M3YI 1VQ91 1K9M2 4EWCA 2JA5I 1USPB 1Q812 1QVGY 2BJOA 1L1OC 3I07A 4NBHA 2JNYA 5FLXb 1JJ2Y 4E2YA 1Q822 4RVFA 5FLMI 1TWAI 2LIYA 1VQL1 2VF1A 4Y7NI 3MZLB 1Y1VI 3CC2Z 3CMAZ 3GTPI 1Z03A 4HGZA 4BY7I 4E33A 4BXXI 3CCR1 1X3ZA 1YI21 1Y1WI 3CCL1 3CCEZ 3KIFA 4NBEA 3F3FC 1QF8A 1S721 3CCS1 4A3DI 2JA7I 2Y0SA 5C4XI 2Q4ZA 3VB9A 1M901 5T67A 3CC21 5D1PA 1LQLA 4DK1A 1KC82 3CD6Z 4NBFA 2NVXI 2GTHA 2OOYB 1VQP1 2JUBA 1VQ5Z 3S2DI 1YJW1 5T6BA 3JAMf 3HOWI 2GTIA 2M6NA 3BG0B 3CCVZ 1Q862 3S1MI 3IF8A 2R92I 3EEDA 3CQZI 2AKLA 1S7MA 5IP9I 1N2FA 1YHQZ 2YADA 4A3CI 4E2XA 1W2BZ 1VQ41 3Q87A 1VQ51 1N8R1 3NH8A 4NBGA 1Z01A 1K83I 4MONA 3PO3I 1DL6A 2RIQA 5IP7I 3GTKI 1Y1VS 2O53A 3D9XA 1N8R2 3I4MI 1Q821 1NUIA 1VQ6Z 4QTTA 4MRIA 3CC7Z 2JR6A 4X6AI 2WB1A 4NH1C 3S15I 1YJ9Z 1YUAA 1X0TA 1KRLA 2QR1B 1RNIA 1RO2A 3G6EZ 1YJN1 2QA4Z 3T4NB 4AYBA 4NBBA 1KQSZ 1I3QI 1RQFA 1QVFY 3NDJA 3G4SZ 3PO3S 3QWUA 2QLVB 3J80f 4A3FI 3U50C 4RVDA 3D6WA 2PM9A 2QRCB 3VTNA 1VQ9Z 4A3II 5C44I 1K8A2 1Z02A 3S14I 4E2WA 1K732 3VMGA 5LL6f 3CD61 1R9TI 2RPRA 3CCQZ 3GTOI 1WW9A 1RO4A 2E2II 3S1NI 4A93I 4NB9A 3GTGI 3CPWZ 3F3PC 3MZKB 3TDHB 4A3MI 1VQK1 2HF1A 3CXCY 3G4S1 4NBCA 5CM2M 1YIJZ 5AN9F 2R93I 3P5JB 1JJ2Z 3RZDI 2KPIA 2Q51A 1YITZ 2OTLZ 4MD9A 1YIT1 3I561 1VQPZ 4QTUA 3HOUI 2JA8I 4NB8A 1ML8A 1VQN1 2K5RA 3I4NI 3CCUZ 4NOZA 1VQMZ 4S1TA 4E31A 2VUGA 3CC71 1VQKZ 3GTMI 2O4HA 2WAQA 4HGYA 1KQSY 3FQQA 1QVGZ 4A3GI 1TWFI 3J81f 2RT9A 3NFZA 3CCU1 3CCM1 3GTJI 2LFUA 1I6HI 1TWGI 2P28A 3NH4A 3EERA 4RV9A 3CCRZ 1VQLZ 3CMA1 3H3VJ 3J7A4 4DGLA 3K7AI 3CMEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 1;  1JJ2 Y;  1KD1 1;  1Q82 2;  1Q86 1;  1K9M 1;  3I55 1;  1YHQ 1;  1VQL 1;  1K73 1;  1VQO Z;  3CCV 1;  3CC2 Z;  3CMA Z;  1YJ9 1;  3CCR 1;  1YIJ 1;  1K8A 1;  1VQ9 Z;  1YI2 1;  3CCJ 1;  1NJI 2;  1W2B Y;  3CCL 1;  3CCE Z;  1K8A 2;  1KD1 2;  1S72 1;  3G71 1;  3CCS 1;  1VQ7 Z;  3CCJ Z;  1K73 2;  3CD6 1;  1VQM 1;  3CCQ Z;  1M90 1;  1YI2 Z;  1VQN Z;  3G71 Z;  3CC2 1;  1KC8 2;  3CD6 Z;  3CPW Z;  1VQK 1;  1VQP 1;  1VQ5 Z;  2OTJ 1;  1YJW 1;  3CXC Y;  3G4S 1;  1VQ8 1;  3CPW Y;  1M1K 2;  3CCV Z;  1Q86 2;  1YIJ Z;  3CME 1;  2QA4 1;  3CC4 1;  1JJ2 Z;  3I55 Z;  1YHQ Z;  3G6E 1;  3I56 Z;  1YIT Z;  2OTL Z;  1W2B Z;  1VQ4 1;  1VQ5 1;  1YIT 1;  1N8R 1;  2OTJ Z;  1YJN Z;  3I56 1;  1VQ8 Z;  3CXC Z;  2QEX 1;  1Q7Y 2;  1YJW Z;  1VQP Z;  3CCM Z;  1VQN 1;  3CCU Z;  3CCQ 1;  1N8R 2;  1VQM Z;  1Q82 1;  1NJI 1;  3CCE 1;  3CCS Z;  3CC7 1;  1VQ6 Z;  1VQK Z;  1M90 2;  3OW2 Y;  1M1K 1;  1KQS Y;  1QVG Z;  1VQ7 1;  3CC7 Z;  1VQ6 1;  1S72 Z;  1Q81 1;  3CCL Z;  1KC8 1;  3CCU 1;  3CCM 1;  2QEX Z;  1YJ9 Z;  1VQ9 1;  1VQ4 Z;  1VQO 1;  1K9M 2;  3CCR Z;  1VQL Z;  2OTL 1;  1QVF Z;  3CMA 1;  3G6E Z;  1YJN 1;  1Q81 2;  2QA4 Z;  1QVG Y;  3CC4 Z;  1KQS Z;  1QVF Y;  3OW2 Z;  3CME Z;  3G4S Z; 
#chains in the Genus database with same CATH topology
 1Q7Y 1;  2NVY I;  1ZB9 A;  3FKI I;  2PK7 A;  2E2H I;  1K9M 1;  1ZB8 A;  3I55 1;  2GU2 A;  5D1O A;  3S17 I;  2KI7 B;  1YIJ 1;  2DE5 A;  4CL1 A;  1I50 I;  1NJI 2;  2OZK A;  1TWH I;  2F4O A;  4NBD A;  2PMZ A;  3H0G I;  2QRE B;  1VQ7 Z;  4BY1 I;  3CCJ Z;  4BBS I;  3GTQ I;  1VQM 1;  3JAM b;  2K3R A;  3G71 Z;  3J81 b;  4RS4 A;  2V8K A;  2AYD A;  4A3E I;  1VLA A;  3J80 b;  5T64 A;  3ESW A;  1M1K 2;  3CPW Y;  5A2Q f;  2QA4 1;  1USP A;  1X3W A;  4XX2 A;  3S2H I;  3I56 Z;  1PFT A;  3HOV I;  2JS4 A;  2JMO A;  4A3L I;  3CXC Z;  2QEX 1;  1YJW Z;  4E30 A;  3S1R I;  2RBL A;  2F4M A;  3IX0 A;  3CCQ 1;  3S16 I;  5IT9 f;  2P3Y A;  4A3B I;  3VMH A;  3GCF A;  3CCE 1;  2W03 A;  3GKQ A;  2E2J I;  3OW2 Y;  1M1K 1;  1TFI A;  2NVQ I;  1QYP A;  5C4J I;  1VQ7 1;  5D1O B;  5FLX f;  2G2K A;  1S72 Z;  4E32 A;  1Q81 1;  3S1Q I;  1KC8 1;  2QRD B;  2V8I A;  1NP6 A;  3NH5 A;  3TE5 B;  5C3E I;  2H85 A;  1VQ4 Z;  1TWC I;  1VQO 1;  4A3J I;  1RO0 A;  2OTL 1;  1QVF Z;  3CC4 Z;  2VUM I;  3OW2 Z;  4MH4 A;  3HOY I;  3GTM S;  3BG1 B;  1KD1 1;  4Y52 I;  1Q86 1;  1YHQ 1;  1K73 1;  1VQO Z;  4E2Z A;  3CCV 1;  1YJ9 1;  2I3C A;  3IFU A;  1K8A 1;  1RLY A;  1WZN A;  3CCJ 1;  1W2B Y;  1AA6 A;  1WII A;  2HU9 A;  1KD1 2;  3G71 1;  2IZ3 A;  2QKD A;  2JIP A;  5IT9 b;  2NVT I;  3M4O I;  1YI2 Z;  1VQN Z;  1P9N A;  1WCM I;  1ZH1 A;  4NBA A;  4MD7 A;  2OTJ 1;  2V45 A;  3NDI A;  4A3K I;  1VQ8 1;  1YUK A;  3GTL I;  2V3V A;  4BBR I;  3HOZ I;  3CME 1;  2E9H A;  3RZO I;  3CC4 1;  3I55 Z;  2DE6 A;  3G6E 1;  2V8J A;  3KIH A;  4HH4 A;  4RVH A;  4MXU A;  2DE7 A;  3PO2 I;  4DQY B;  1JWH C;  5A2Q b;  2OTJ Z;  1YJN Z;  1VQ8 Z;  1Q7Y 2;  2M48 A;  2VPY A;  3MON A;  4RVG A;  2E7Z A;  3HKZ A;  3CCM Z;  2R6M A;  2EGT A;  2JA6 I;  2J6A A;  1NJI 1;  3CCS Z;  2B63 I;  3VMI A;  1M90 2;  2RHB A;  3D2L A;  2ZAE B;  2YU9 I;  1VQ6 1;  3LUS A;  2OOX B;  3HOX I;  4NFR A;  3CCL Z;  1SFO I;  2W04 A;  3FQM A;  4MD8 A;  2IZ4 A;  2QEX Z;  4TNU A;  2R7Z I;  3M3Y I;  2VPX A;  1VQ9 1;  1K9M 2;  4EWC A;  2JA5 I;  1USP B;  1Q81 2;  1QVG Y;  2BJO A;  1L1O C;  3I07 A;  4NBH A;  2JNY A;  5FLX b;  1JJ2 Y;  2JIQ A;  4E2Y A;  1Q82 2;  4RVF A;  5FLM I;  1TWA I;  2LIY A;  1VQL 1;  2VF1 A;  4Y7N I;  3MZL B;  1Y1V I;  3CC2 Z;  3CMA Z;  3IR7 A;  1Z03 A;  4HGZ A;  3GTP I;  4E33 A;  4BY7 I;  4BXX I;  3CCR 1;  1X3Z A;  1YI2 1;  1Y1W I;  3CCL 1;  3CCE Z;  3KIF A;  4NBE A;  3F3F C;  1QF8 A;  1S72 1;  3CCS 1;  4A3D I;  2JA7 I;  2Y0S A;  5C4X I;  2Q4Z A;  3VB9 A;  1Y8C A;  1M90 1;  2VPZ A;  5T67 A;  3CC2 1;  5D1P A;  1LQL A;  2IV2 X;  4DK1 A;  1KC8 2;  3CD6 Z;  4NBF A;  2NVX I;  2GTH A;  2OOY B;  1VQP 1;  2JUB A;  1VQ5 Z;  3S2D I;  1YJW 1;  5T6B A;  3JAM f;  3HOW I;  2GTI A;  1QXF A;  2M6N A;  3BG0 B;  3CCV Z;  1Q86 2;  3S1M I;  3IF8 A;  2R92 I;  3EED A;  3CQZ I;  2AKL A;  1S7M A;  5IP9 I;  1N2F A;  1YHQ Z;  2YAD A;  4A3C I;  4E2X A;  1W2B Z;  1VQ4 1;  3Q87 A;  1VQ5 1;  1N8R 1;  3NH8 A;  4NBG A;  2JIM A;  1Z01 A;  1K83 I;  4MON A;  3PO3 I;  1DL6 A;  2RIQ A;  5IP7 I;  3GTK I;  1Y1V S;  2O53 A;  3D9X A;  1N8R 2;  3I4M I;  1Q82 1;  1NUI A;  1VQ6 Z;  4QTT A;  4MRI A;  3CC7 Z;  2JR6 A;  4X6A I;  2WB1 A;  4NH1 C;  3S15 I;  1YJ9 Z;  1YUA A;  1X0T A;  1KRL A;  2QR1 B;  1RNI A;  2JIR A;  1RO2 A;  3G6E Z;  1YJN 1;  2QA4 Z;  3T4N B;  4AYB A;  4NBB A;  1KQS Z;  1I3Q I;  1RQF A;  1QVF Y;  3NDJ A;  2JIO A;  1FDI A;  3G4S Z;  3PO3 S;  3QWU A;  2QLV B;  3J80 f;  4A3F I;  3U50 C;  4RVD A;  1FDO A;  2VPW A;  3D6W A;  2PM9 A;  2QRC B;  1WJ2 A;  3VTN A;  1VQ9 Z;  4A3I I;  5C44 I;  1K8A 2;  1Z02 A;  3S14 I;  4E2W A;  1K73 2;  3VMG A;  5LL6 f;  3CD6 1;  1R9T I;  2RPR A;  3CCQ Z;  3GTO I;  1WW9 A;  1RO4 A;  2E2I I;  3S1N I;  4A93 I;  4NB9 A;  3GTG I;  3CPW Z;  3F3P C;  1SIW A;  3MZK B;  3TDH B;  4A3M I;  1VQK 1;  2HF1 A;  3CXC Y;  3G4S 1;  4NBC A;  5CM2 M;  1YIJ Z;  5AN9 F;  2R93 I;  3P5J B;  1JJ2 Z;  3RZD I;  2KPI A;  2Q51 A;  1YIT Z;  2OTL Z;  4MD9 A;  1YIT 1;  3I56 1;  1VQP Z;  4QTU A;  3HOU I;  2JA8 I;  4NB8 A;  1ML8 A;  1VQN 1;  2K5R A;  3I4N I;  3CCU Z;  4NOZ A;  1VQM Z;  4S1T A;  4E31 A;  2VUG A;  3CC7 1;  1VQK Z;  3GTM I;  2O4H A;  2WAQ A;  4HGY A;  1KQS Y;  3FQQ A;  1QVG Z;  4A3G I;  1TWF I;  3J81 f;  2RT9 A;  3NFZ A;  3CCU 1;  2NAP A;  3CCM 1;  3GTJ I;  2LFU A;  1I6H I;  1TWG I;  2P28 A;  3NH4 A;  3EER A;  4RV9 A;  3CCR Z;  1VQL Z;  2LEX A;  3CMA 1;  3H3V J;  3J7A 4;  1Q16 A;  4DGL A;  3K7A I;  3CME Z; 
#chains in the Genus database with same CATH homology
 1Q7Y 1;  2NVY I;  1ZB9 A;  3FKI I;  2PK7 A;  2E2H I;  1K9M 1;  1ZB8 A;  3I55 1;  2GU2 A;  5D1O A;  3S17 I;  2KI7 B;  1YIJ 1;  2DE5 A;  4CL1 A;  1I50 I;  1NJI 2;  2OZK A;  1TWH I;  2F4O A;  4NBD A;  2PMZ A;  3H0G I;  2QRE B;  1VQ7 Z;  4BY1 I;  3CCJ Z;  4BBS I;  3GTQ I;  1VQM 1;  3JAM b;  2K3R A;  3G71 Z;  3J81 b;  4RS4 A;  2V8K A;  4A3E I;  1VLA A;  3J80 b;  5T64 A;  3ESW A;  1M1K 2;  3CPW Y;  5A2Q f;  2QA4 1;  1USP A;  1X3W A;  4XX2 A;  3S2H I;  3I56 Z;  1PFT A;  3HOV I;  2JS4 A;  2JMO A;  4A3L I;  3CXC Z;  2QEX 1;  1YJW Z;  4E30 A;  3S1R I;  2RBL A;  2F4M A;  3IX0 A;  3CCQ 1;  3S16 I;  5IT9 f;  2P3Y A;  4A3B I;  3VMH A;  3GCF A;  3CCE 1;  2W03 A;  3GKQ A;  2E2J I;  3OW2 Y;  1M1K 1;  1TFI A;  2NVQ I;  1QYP A;  5C4J I;  1VQ7 1;  5D1O B;  5FLX f;  2G2K A;  1S72 Z;  4E32 A;  1Q81 1;  3S1Q I;  1KC8 1;  2QRD B;  2V8I A;  1NP6 A;  3NH5 A;  3TE5 B;  5C3E I;  2H85 A;  1VQ4 Z;  1TWC I;  1VQO 1;  4A3J I;  1RO0 A;  2OTL 1;  1QVF Z;  3CC4 Z;  2VUM I;  3OW2 Z;  4MH4 A;  3HOY I;  3GTM S;  3BG1 B;  1KD1 1;  4Y52 I;  1Q86 1;  1YHQ 1;  1K73 1;  1VQO Z;  4E2Z A;  3CCV 1;  1YJ9 1;  2I3C A;  3IFU A;  1K8A 1;  1RLY A;  3CCJ 1;  1W2B Y;  1WII A;  2HU9 A;  1KD1 2;  3G71 1;  2IZ3 A;  2QKD A;  5IT9 b;  2NVT I;  3M4O I;  1YI2 Z;  1VQN Z;  1P9N A;  1WCM I;  1ZH1 A;  4NBA A;  4MD7 A;  2OTJ 1;  3NDI A;  4A3K I;  1VQ8 1;  1YUK A;  3GTL I;  4BBR I;  3HOZ I;  3CME 1;  2E9H A;  3RZO I;  3CC4 1;  3I55 Z;  2DE6 A;  3G6E 1;  2V8J A;  3KIH A;  4HH4 A;  4RVH A;  4MXU A;  2DE7 A;  3PO2 I;  4DQY B;  1JWH C;  5A2Q b;  2OTJ Z;  1YJN Z;  1VQ8 Z;  1Q7Y 2;  2M48 A;  3MON A;  4RVG A;  3HKZ A;  3CCM Z;  2R6M A;  2EGT A;  2JA6 I;  2J6A A;  1NJI 1;  3CCS Z;  2B63 I;  3VMI A;  1M90 2;  2RHB A;  2ZAE B;  2YU9 I;  1VQ6 1;  3LUS A;  2OOX B;  3HOX I;  4NFR A;  3CCL Z;  1SFO I;  2W04 A;  3FQM A;  4MD8 A;  2IZ4 A;  2QEX Z;  4TNU A;  2R7Z I;  3M3Y I;  1VQ9 1;  1K9M 2;  4EWC A;  2JA5 I;  1USP B;  1Q81 2;  1QVG Y;  2BJO A;  1L1O C;  3I07 A;  4NBH A;  2JNY A;  5FLX b;  1JJ2 Y;  4E2Y A;  1Q82 2;  4RVF A;  5FLM I;  1TWA I;  2LIY A;  1VQL 1;  2VF1 A;  4Y7N I;  3MZL B;  1Y1V I;  3CC2 Z;  3CMA Z;  3GTP I;  1Z03 A;  4HGZ A;  4BY7 I;  4E33 A;  4BXX I;  3CCR 1;  1X3Z A;  1YI2 1;  1Y1W I;  3CCL 1;  3CCE Z;  3KIF A;  4NBE A;  3F3F C;  1QF8 A;  1S72 1;  3CCS 1;  4A3D I;  2JA7 I;  2Y0S A;  5C4X I;  2Q4Z A;  3VB9 A;  1M90 1;  5T67 A;  3CC2 1;  5D1P A;  1LQL A;  4DK1 A;  1KC8 2;  3CD6 Z;  4NBF A;  2NVX I;  2GTH A;  2OOY B;  1VQP 1;  2JUB A;  1VQ5 Z;  3S2D I;  1YJW 1;  5T6B A;  3JAM f;  3HOW I;  2GTI A;  2M6N A;  3BG0 B;  3CCV Z;  1Q86 2;  3S1M I;  3IF8 A;  2R92 I;  3EED A;  3CQZ I;  2AKL A;  1S7M A;  5IP9 I;  1N2F A;  1YHQ Z;  2YAD A;  4A3C I;  4E2X A;  1W2B Z;  1VQ4 1;  3Q87 A;  1VQ5 1;  1N8R 1;  3NH8 A;  4NBG A;  1Z01 A;  1K83 I;  4MON A;  3PO3 I;  1DL6 A;  2RIQ A;  5IP7 I;  3GTK I;  1Y1V S;  2O53 A;  3D9X A;  1N8R 2;  3I4M I;  1Q82 1;  1NUI A;  1VQ6 Z;  4QTT A;  4MRI A;  3CC7 Z;  2JR6 A;  4X6A I;  2WB1 A;  4NH1 C;  3S15 I;  1YJ9 Z;  1YUA A;  1X0T A;  1KRL A;  2QR1 B;  1RNI A;  1RO2 A;  3G6E Z;  1YJN 1;  2QA4 Z;  3T4N B;  4AYB A;  4NBB A;  1KQS Z;  1I3Q I;  1RQF A;  1QVF Y;  3NDJ A;  3G4S Z;  3PO3 S;  3QWU A;  2QLV B;  3J80 f;  4A3F I;  3U50 C;  4RVD A;  3D6W A;  2PM9 A;  2QRC B;  3VTN A;  1VQ9 Z;  4A3I I;  5C44 I;  1K8A 2;  1Z02 A;  3S14 I;  4E2W A;  1K73 2;  3VMG A;  5LL6 f;  3CD6 1;  1R9T I;  2RPR A;  3CCQ Z;  3GTO I;  1WW9 A;  1RO4 A;  2E2I I;  3S1N I;  4A93 I;  4NB9 A;  3GTG I;  3CPW Z;  3F3P C;  3MZK B;  3TDH B;  4A3M I;  1VQK 1;  2HF1 A;  3CXC Y;  3G4S 1;  4NBC A;  5CM2 M;  1YIJ Z;  5AN9 F;  2R93 I;  3P5J B;  1JJ2 Z;  3RZD I;  2KPI A;  2Q51 A;  1YIT Z;  2OTL Z;  4MD9 A;  1YIT 1;  3I56 1;  1VQP Z;  4QTU A;  3HOU I;  2JA8 I;  4NB8 A;  1ML8 A;  1VQN 1;  2K5R A;  3I4N I;  3CCU Z;  4NOZ A;  1VQM Z;  4S1T A;  4E31 A;  2VUG A;  3CC7 1;  1VQK Z;  3GTM I;  2O4H A;  2WAQ A;  4HGY A;  1KQS Y;  3FQQ A;  1QVG Z;  4A3G I;  1TWF I;  3J81 f;  2RT9 A;  3NFZ A;  3CCU 1;  3CCM 1;  3GTJ I;  2LFU A;  1I6H I;  1TWG I;  2P28 A;  3NH4 A;  3EER A;  4RV9 A;  3CCR Z;  1VQL Z;  3CMA 1;  3H3V J;  3J7A 4;  4DGL A;  3K7A I;  3CME Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...