3OW2Y

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Y00
1K9M1 1VQKZ 3CC21 3CD6Z 3CMEZ 3CXCY 1KD12 1N8R1 1S72Z 3CCRZ 1K9M2 1YJNZ 1QVFZ 1VQM1 1JJ2Y 1Q7Y1 1VQ71 1NJI2 3CC2Z 3CCS1 1KC82 1VQN1 3CPWZ 1YJN1 3CPWY 3CCL1 3I561 1VQMZ 1YI21 1KD11 1VQ7Z 2OTJZ 3CCSZ 3G4S1 3CXCZ 1VQ41 1Q822 1K8A2 1VQNZ 1Q862 3OW2Y 1NJI1 3CCLZ 3I56Z 1VQ51 1JJ2Z 1YI2Z 1KC81 1VQ61 2OTJ1 3G4SZ 1YJW1 1VQ4Z 1YJ91 3I551 1W2BZ 1W2BY 2QEX1 1QVGZ 3G6E1 1QVGY 1VQ5Z 3G711 3CCU1 1Q821 1K8A1 1VQ6Z 3CCM1 1Q861 1K732 1Q812 1YJWZ 1KQSZ 1YITZ 1KQSY 1YJ9Z 3I55Z 3OW2Z 2QEXZ 1VQL1 3G6EZ 3CCV1 3CCJ1 3G71Z 3CCUZ 3CCE1 3CC41 3CCMZ 1M901 1YHQ1 1YIT1 3CCQ1 2OTL1 1M902 1VQ81 1VQLZ 1K731 1M1K2 3CCVZ 1Q811 3CMA1 3CCJZ 1VQO1 3CCEZ 3CC4Z 2QA41 3CC71 1VQP1 1QVFY 1VQ91 1YHQZ 1YIJ1 3CCQZ 1N8R2 2OTLZ 1VQ8Z 1VQK1 3CD61 3CMAZ 3CME1 1Q7Y2 1VQOZ 1S721 3CCR1 2QA4Z 3CC7Z 1VQPZ 1VQ9Z 1YIJZ 1M1K1
chains in the Genus database with same CATH superfamily
5FLXf 1VQKZ 3CC21 5IP7I 1KD12 1RO0A 4NOZA 1N8R1 1K9M2 3S2DI 2HF1A 4NFRA 3MONA 2JIQA 2QRCB 1N2FA 3VMGA 1P9NA 1Q7Y1 4RVDA 1NJI2 2GU2A 4DK1A 2JUBA 1VQN1 3NH5A 3HOVI 2DE7A 4NBDA 2RHBA 1VQMZ 3FQMA 1Y1WI 4HGYA 2E7ZA 2GTHA 2VPYA 3GTQI 2RT9A 2I3CA 4DGLA 2NVQI 3IFUA 2KPIA 1KC81 5C4XI 2OZKA 4XX2A 1VQ61 2OTJ1 3GTOI 3KIFA 3G4SZ 1X3ZA 1QVGZ 3G6E1 2IZ4A 2DE5A 4NBGA 3H0GI 2GTIA 1YJWZ 1KQSZ 1YITZ 3NH8A 4BY1I 4NBCA 5FLMI 4E31A 2JMOA 3QWUA 1JWHC 3G71Z 3CCUZ 3CCMZ 1M901 4E2XA 2O53A 2PMZA 3S1RI 2K3RA 3S2HI 4BY7I 3VTNA 1K731 1M1K2 3CCVZ 3GCFA 1Y8CA 3CC4Z 2PK7A 3CC71 1VQP1 1YHQZ 2JS4A 4A3KI 3VMIA 4A3BI 1VQ8Z 4NB9A 1VQK1 1USPA 3Q87A 1TWGI 4NB8A 2Q4ZA 5IT9f 3F3FC 5D1OB 3F3PC 5LL6f 2V8JA 2JIMA 3PO3I 1K9M1 2DE6A 1RQFA 3IR7A 1LQLA 3MZKB 3CCRZ 3D6WA 5IP9I 1PFTA 3H3VJ 3K7AI 4NBAA 1VQM1 1Z02A 1Z01A 3BG1B 1QYPA 1S7MA 3GTKI 1X0TA 2NAPA 4HGZA 1YJN1 2QLVB 1Q16A 3CPWY 3NH4A 3I4NI 1VQ7Z 4E30A 3MZLB 3G4S1 3CCSZ 1RNIA 3CXCZ 1I50I 1ZH1A 4AYBA 4TNUA 2P3YA 3OW2Y 2NVTI 1JJ2Z 5A2Qb 4QTTA 1YI2Z 4QTUA 1YUAA 3P5JB 1WCMI 4E32A 2JA6I 4A3CI 4E2WA 3GTLI 3JAMb 3EERA 1YJW1 1VLAA 4MD8A 2M6NA 3J81f 1W2BY 3U50C 4DQYB 4BXXI 3PO2I 3G711 3CCU1 1Q821 4A3II 1K8A1 3GKQA 3CCM1 2W04A 1Q861 2LEXA 1Q812 2OOYB 2OOXB 2KI7B 2JA5I 2QEXZ 3HOWI 2LFUA 4MONA 3CCV1 3RZDI 2VUMI 2JIOA 1TWCI 3CC41 3LUSA 1YUKA 1YHQ1 4A3MI 1VQ81 1VQLZ 2WAQA 2VPXA 1WIIA 1WJ2A 3I07A 4BBSI 4NBHA 1RO4A 3CCQZ 1N8R2 2VPZA 1ZB8A 1Q7Y2 1VQOZ 3S1MI 3HOXI 3CCR1 3PO3S 2QA4Z 3NDIA 1VQ9Z 1YIJZ 4MD7A 3CQZI 2BJOA 3GTMI 2QREB 1Z03A 4A3LI 1S72Z 4RV9A 5T64A 4A3EI 1QVFZ 3J80b 5C4JI 1VQ71 1SFOI 3CCS1 3IF8A 3NDJA 4S1TA 2AKLA 1KC82 3S15I 2W03A 2K5RA 3FQQA 4HH4A 3S14I 3CPWZ 1QF8A 1YI21 1WZNA 1KD11 1RLYA 2VUGA 2OTJZ 1USPB 4RVHA 3TDHB 3GTPI 1TFIA 2IV2X 2NVYI 1NJI1 3CCLZ 2RPRA 3I56Z 1X3WA 2R93I 3S17I 3D2LA 3S1QI 2QR1B 1TWHI 2PM9A 1VQ4Z 2YADA 1W2BZ 4MD9A 2QEX1 5FLXb 1ML8A 1VQ5Z 4A3GI 3BG0B 1K732 2LIYA 1YJ9Z 3I55Z 4RS4A 1VQL1 3HOUI 4MXUA 1NUIA 2JIRA 2R7ZI 1FDIA 1YIT1 3CCQ1 1TWAI 5T67A 3VMHA 3HOYI 1I6HI 2IZ3A 3CCJZ 4A3DI 1VQO1 2O4HA 2VPWA 3CCEZ 2QA41 4RVFA 3D9XA 2RIQA 4EWCA 2JR6A 1VQ91 1YIJ1 1FDOA 2OTLZ 5A2Qf 1ZB9A 3M4OI 3RZOI 4E2ZA 3CMAZ 2QRDB 3JAMf 3VB9A 4E2YA 1S721 4Y52I 3GTMS 4MRIA 3GTGI 1M1K1 3HOZI 5C3EI 2E2II 2M48A 4CL1A 1AA6A 3CD6Z 3CMEZ 3CXCY 1QXFA 4X6AI 1YJNZ 2HU9A 1TWFI 2E2JI 1JJ2Y 2EGTA 4A93I 2P28A 3CC2Z 4NBFA 4A3FI 2B63I 3IX0A 2E2HI 4MH4A 2AYDA 5D1PA 3CCL1 2V45A 3NFZA 3I561 4A3JI 5CM2M 2VF1A 3J7A4 5AN9F 2ZAEB 1VQ41 1Q822 1K8A2 1VQNZ 2H85A 3S16I 1Q862 4Y7NI 3M3YI 1VQ51 1R9TI 2V8IA 2F4OA 2RBLA 3FKII 2Y0SA 2J6AA 4NH1C 5IT9b 1YJ91 3I551 1WW9A 2JA7I 2E9HA 1QVGY 1K83I 2R6MA 1Y1VS 4E33A 1VQ6Z 3TE5B 1NP6A 5D1OA 2F4MA 5T6BA 2G2KA 2JNYA 3ESWA 2V3VA 1KQSY 4NBEA 2JA8I 3J80f 3OW2Z 2QKDA 3KIHA 3G6EZ 2NVXI 3CCJ1 3T4NB 3CCE1 2JIPA 3EEDA 1DL6A 2OTL1 1M902 3GTJI 3I4MI 1Q811 3CMA1 1KRLA 1SIWA 1RO2A 2WB1A 1QVFY 1L1OC 1Y1VI 3HKZA 2Q51A 1I3QI 3CD61 3CME1 2R92I 4NBBA 4RVGA 2V8KA 4BBRI 5C44I 3CC7Z 1VQPZ 2YU9I 3J81b 3S1NI
chains in the Genus database with same CATH topology
5FLXf 1VQKZ 3CC21 5IP7I 1KD12 1RO0A 4NOZA 1N8R1 1K9M2 3S2DI 2HF1A 4NFRA 3MONA 2QRCB 1N2FA 3VMGA 1P9NA 1Q7Y1 4RVDA 1NJI2 2GU2A 4DK1A 2JUBA 1VQN1 3NH5A 3HOVI 2DE7A 4NBDA 2RHBA 1VQMZ 3FQMA 1Y1WI 4HGYA 2GTHA 3GTQI 2RT9A 2I3CA 4DGLA 2NVQI 3IFUA 2KPIA 1KC81 5C4XI 2OZKA 4XX2A 1VQ61 2OTJ1 3GTOI 3KIFA 3G4SZ 1X3ZA 1QVGZ 3G6E1 2IZ4A 2DE5A 4NBGA 3H0GI 2GTIA 1YJWZ 1KQSZ 1YITZ 3NH8A 4BY1I 4NBCA 5FLMI 4E31A 2JMOA 3QWUA 1JWHC 3G71Z 3CCUZ 3CCMZ 1M901 4E2XA 2O53A 2PMZA 3S1RI 2K3RA 3S2HI 4BY7I 3VTNA 1K731 1M1K2 3CCVZ 3GCFA 3CC4Z 1VQP1 2PK7A 3CC71 1YHQZ 2JS4A 4A3KI 3VMIA 4A3BI 1VQ8Z 4NB9A 1VQK1 1USPA 3Q87A 1TWGI 4NB8A 2Q4ZA 5IT9f 3F3FC 5D1OB 3F3PC 5LL6f 2V8JA 3PO3I 1K9M1 2DE6A 1RQFA 1LQLA 3MZKB 3CCRZ 3D6WA 5IP9I 1PFTA 3H3VJ 3K7AI 4NBAA 1VQM1 1Z02A 1Z01A 3BG1B 1QYPA 1S7MA 3GTKI 1X0TA 4HGZA 1YJN1 2QLVB 3CPWY 3NH4A 3I4NI 1VQ7Z 4E30A 3MZLB 3G4S1 3CCSZ 1RNIA 3CXCZ 1I50I 1ZH1A 4AYBA 4TNUA 2P3YA 3OW2Y 2NVTI 1JJ2Z 5A2Qb 4QTTA 1YI2Z 4QTUA 1YUAA 3P5JB 1WCMI 4E32A 2JA6I 4A3CI 4E2WA 3GTLI 3JAMb 3EERA 1YJW1 1VLAA 4MD8A 2M6NA 3J81f 1W2BY 3U50C 4DQYB 4BXXI 3PO2I 3G711 3CCU1 1Q821 4A3II 1K8A1 3GKQA 3CCM1 2W04A 1Q861 1Q812 2OOYB 2OOXB 2KI7B 2JA5I 2QEXZ 3HOWI 2LFUA 4MONA 3CCV1 3RZDI 2VUMI 1TWCI 3CC41 3LUSA 1YUKA 1YHQ1 4A3MI 1VQ81 1VQLZ 2WAQA 1WIIA 3I07A 4BBSI 4NBHA 1RO4A 3CCQZ 1N8R2 1ZB8A 1Q7Y2 1VQOZ 3S1MI 3HOXI 3CCR1 3PO3S 2QA4Z 3NDIA 1VQ9Z 1YIJZ 4MD7A 3CQZI 2BJOA 3GTMI 2QREB 1Z03A 4A3LI 1S72Z 4RV9A 5T64A 4A3EI 1QVFZ 3J80b 5C4JI 1VQ71 1SFOI 3CCS1 3IF8A 3NDJA 4S1TA 2AKLA 1KC82 3S15I 2W03A 2K5RA 3FQQA 4HH4A 3S14I 3CPWZ 1QF8A 1YI21 1KD11 1RLYA 2VUGA 2OTJZ 1USPB 4RVHA 3TDHB 3GTPI 1TFIA 2NVYI 1NJI1 3CCLZ 2RPRA 3I56Z 1X3WA 2R93I 3S17I 3S1QI 2QR1B 1TWHI 2PM9A 1VQ4Z 2YADA 1W2BZ 4MD9A 2QEX1 5FLXb 1ML8A 1VQ5Z 4A3GI 3BG0B 1K732 2LIYA 1YJ9Z 3I55Z 4RS4A 1VQL1 3HOUI 4MXUA 1NUIA 2R7ZI 1YIT1 3CCQ1 1TWAI 5T67A 3VMHA 3HOYI 1I6HI 2IZ3A 3CCJZ 4A3DI 1VQO1 2O4HA 3CCEZ 2QA41 4RVFA 3D9XA 2RIQA 4EWCA 2JR6A 1VQ91 1YIJ1 2OTLZ 5A2Qf 1ZB9A 3M4OI 3RZOI 4E2ZA 3CMAZ 2QRDB 3JAMf 3VB9A 4E2YA 1S721 4Y52I 3GTMS 4MRIA 3GTGI 1M1K1 3HOZI 5C3EI 2E2II 2M48A 4CL1A 3CD6Z 3CMEZ 3CXCY 4X6AI 1YJNZ 2HU9A 1TWFI 2E2JI 1JJ2Y 2EGTA 4A93I 2P28A 3CC2Z 4NBFA 4A3FI 2B63I 3IX0A 2E2HI 4MH4A 5D1PA 3CCL1 3NFZA 3I561 4A3JI 5CM2M 2VF1A 3J7A4 5AN9F 2ZAEB 1VQ41 1Q822 1K8A2 1VQNZ 2H85A 3S16I 1Q862 4Y7NI 3M3YI 1VQ51 1R9TI 2V8IA 2F4OA 2RBLA 3FKII 2Y0SA 2J6AA 4NH1C 5IT9b 1YJ91 3I551 1WW9A 2JA7I 2E9HA 1QVGY 1K83I 2R6MA 1Y1VS 4E33A 1VQ6Z 3TE5B 1NP6A 5D1OA 2F4MA 5T6BA 2G2KA 2JNYA 3ESWA 1KQSY 4NBEA 2JA8I 3J80f 3OW2Z 2QKDA 3KIHA 3G6EZ 2NVXI 3CCJ1 3T4NB 3CCE1 3EEDA 1DL6A 2OTL1 1M902 3GTJI 3I4MI 1Q811 3CMA1 1KRLA 1RO2A 2WB1A 1QVFY 1L1OC 1Y1VI 3HKZA 2Q51A 1I3QI 3CD61 3CME1 2R92I 4NBBA 4RVGA 2V8KA 4BBRI 5C44I 3CC7Z 1VQPZ 2YU9I 3J81b 3S1NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 1;  1VQK Z;  3CC2 1;  3CD6 Z;  3CME Z;  3CXC Y;  1KD1 2;  1N8R 1;  1S72 Z;  3CCR Z;  1K9M 2;  1YJN Z;  1QVF Z;  1VQM 1;  1JJ2 Y;  1Q7Y 1;  1VQ7 1;  1NJI 2;  3CC2 Z;  3CCS 1;  1KC8 2;  1VQN 1;  3CPW Z;  1YJN 1;  3CPW Y;  3CCL 1;  3I56 1;  1VQM Z;  1YI2 1;  1KD1 1;  1VQ7 Z;  2OTJ Z;  3CCS Z;  3G4S 1;  3CXC Z;  1VQ4 1;  1Q82 2;  1K8A 2;  1VQN Z;  1Q86 2;  3OW2 Y;  1NJI 1;  3CCL Z;  3I56 Z;  1VQ5 1;  1JJ2 Z;  1YI2 Z;  1KC8 1;  1VQ6 1;  2OTJ 1;  3G4S Z;  1YJW 1;  1VQ4 Z;  1YJ9 1;  3I55 1;  1W2B Z;  1W2B Y;  2QEX 1;  1QVG Z;  3G6E 1;  1QVG Y;  1VQ5 Z;  3G71 1;  3CCU 1;  1Q82 1;  1K8A 1;  1VQ6 Z;  3CCM 1;  1Q86 1;  1K73 2;  1Q81 2;  1YJW Z;  1KQS Z;  1YIT Z;  1KQS Y;  1YJ9 Z;  3I55 Z;  3OW2 Z;  2QEX Z;  1VQL 1;  3G6E Z;  3CCV 1;  3CCJ 1;  3G71 Z;  3CCU Z;  3CCE 1;  3CC4 1;  3CCM Z;  1M90 1;  1YHQ 1;  1YIT 1;  3CCQ 1;  2OTL 1;  1M90 2;  1VQ8 1;  1VQL Z;  1K73 1;  1M1K 2;  3CCV Z;  1Q81 1;  3CMA 1;  3CCJ Z;  1VQO 1;  3CCE Z;  3CC4 Z;  2QA4 1;  3CC7 1;  1VQP 1;  1QVF Y;  1VQ9 1;  1YHQ Z;  1YIJ 1;  3CCQ Z;  1N8R 2;  2OTL Z;  1VQ8 Z;  1VQK 1;  3CD6 1;  3CMA Z;  3CME 1;  1Q7Y 2;  1VQO Z;  1S72 1;  3CCR 1;  2QA4 Z;  3CC7 Z;  1VQP Z;  1VQ9 Z;  1YIJ Z;  1M1K 1; 
#chains in the Genus database with same CATH topology
 5FLX f;  1VQK Z;  3CC2 1;  5IP7 I;  1KD1 2;  1RO0 A;  4NOZ A;  1N8R 1;  1K9M 2;  3S2D I;  2HF1 A;  4NFR A;  3MON A;  2JIQ A;  2QRC B;  1N2F A;  3VMG A;  1P9N A;  1Q7Y 1;  4RVD A;  1NJI 2;  2GU2 A;  4DK1 A;  2JUB A;  1VQN 1;  3NH5 A;  3HOV I;  2DE7 A;  4NBD A;  2RHB A;  1VQM Z;  3FQM A;  1Y1W I;  4HGY A;  2E7Z A;  2GTH A;  2VPY A;  3GTQ I;  2RT9 A;  2I3C A;  4DGL A;  2NVQ I;  3IFU A;  2KPI A;  1KC8 1;  5C4X I;  2OZK A;  4XX2 A;  1VQ6 1;  2OTJ 1;  3GTO I;  3KIF A;  3G4S Z;  1X3Z A;  1QVG Z;  3G6E 1;  2IZ4 A;  2DE5 A;  4NBG A;  3H0G I;  2GTI A;  1YJW Z;  1KQS Z;  1YIT Z;  3NH8 A;  4BY1 I;  4NBC A;  5FLM I;  4E31 A;  2JMO A;  3QWU A;  1JWH C;  3G71 Z;  3CCU Z;  3CCM Z;  1M90 1;  4E2X A;  2O53 A;  2PMZ A;  3S1R I;  2K3R A;  3S2H I;  4BY7 I;  3VTN A;  1K73 1;  1M1K 2;  3CCV Z;  3GCF A;  1Y8C A;  3CC4 Z;  2PK7 A;  3CC7 1;  1VQP 1;  1YHQ Z;  2JS4 A;  4A3K I;  3VMI A;  4A3B I;  1VQ8 Z;  4NB9 A;  1VQK 1;  1USP A;  3Q87 A;  1TWG I;  4NB8 A;  2Q4Z A;  5IT9 f;  3F3F C;  5D1O B;  3F3P C;  5LL6 f;  2V8J A;  2JIM A;  3PO3 I;  1K9M 1;  2DE6 A;  1RQF A;  3IR7 A;  1LQL A;  3MZK B;  3CCR Z;  3D6W A;  5IP9 I;  1PFT A;  3H3V J;  3K7A I;  4NBA A;  1VQM 1;  1Z02 A;  1Z01 A;  3BG1 B;  1QYP A;  1S7M A;  3GTK I;  1X0T A;  2NAP A;  4HGZ A;  1YJN 1;  2QLV B;  1Q16 A;  3CPW Y;  3NH4 A;  3I4N I;  1VQ7 Z;  4E30 A;  3MZL B;  3G4S 1;  3CCS Z;  1RNI A;  3CXC Z;  1I50 I;  1ZH1 A;  4AYB A;  4TNU A;  2P3Y A;  3OW2 Y;  2NVT I;  1JJ2 Z;  5A2Q b;  4QTT A;  1YI2 Z;  4QTU A;  1YUA A;  3P5J B;  1WCM I;  4E32 A;  2JA6 I;  4A3C I;  4E2W A;  3GTL I;  3JAM b;  3EER A;  1YJW 1;  1VLA A;  4MD8 A;  2M6N A;  3J81 f;  1W2B Y;  3U50 C;  4DQY B;  4BXX I;  3PO2 I;  3G71 1;  3CCU 1;  1Q82 1;  4A3I I;  1K8A 1;  3GKQ A;  3CCM 1;  2W04 A;  1Q86 1;  2LEX A;  1Q81 2;  2OOY B;  2OOX B;  2KI7 B;  2JA5 I;  2QEX Z;  3HOW I;  2LFU A;  4MON A;  3CCV 1;  3RZD I;  2VUM I;  2JIO A;  1TWC I;  3CC4 1;  3LUS A;  1YUK A;  1YHQ 1;  4A3M I;  1VQ8 1;  1VQL Z;  2WAQ A;  2VPX A;  1WII A;  1WJ2 A;  3I07 A;  4BBS I;  4NBH A;  1RO4 A;  3CCQ Z;  1N8R 2;  2VPZ A;  1ZB8 A;  1Q7Y 2;  1VQO Z;  3S1M I;  3HOX I;  3CCR 1;  3PO3 S;  2QA4 Z;  3NDI A;  1VQ9 Z;  1YIJ Z;  4MD7 A;  3CQZ I;  2BJO A;  3GTM I;  2QRE B;  1Z03 A;  4A3L I;  1S72 Z;  4RV9 A;  5T64 A;  4A3E I;  1QVF Z;  3J80 b;  5C4J I;  1VQ7 1;  1SFO I;  3CCS 1;  3IF8 A;  3NDJ A;  4S1T A;  2AKL A;  1KC8 2;  3S15 I;  2W03 A;  2K5R A;  3FQQ A;  4HH4 A;  3S14 I;  3CPW Z;  1QF8 A;  1YI2 1;  1WZN A;  1KD1 1;  1RLY A;  2VUG A;  2OTJ Z;  1USP B;  4RVH A;  3TDH B;  3GTP I;  1TFI A;  2IV2 X;  2NVY I;  1NJI 1;  3CCL Z;  2RPR A;  3I56 Z;  1X3W A;  2R93 I;  3S17 I;  3D2L A;  3S1Q I;  2QR1 B;  1TWH I;  2PM9 A;  1VQ4 Z;  2YAD A;  1W2B Z;  4MD9 A;  2QEX 1;  5FLX b;  1ML8 A;  1VQ5 Z;  4A3G I;  3BG0 B;  1K73 2;  2LIY A;  1YJ9 Z;  3I55 Z;  4RS4 A;  1VQL 1;  3HOU I;  4MXU A;  1NUI A;  2JIR A;  2R7Z I;  1FDI A;  1YIT 1;  3CCQ 1;  1TWA I;  5T67 A;  3VMH A;  3HOY I;  1I6H I;  2IZ3 A;  3CCJ Z;  4A3D I;  1VQO 1;  2O4H A;  2VPW A;  3CCE Z;  2QA4 1;  4RVF A;  3D9X A;  2RIQ A;  4EWC A;  2JR6 A;  1VQ9 1;  1YIJ 1;  1FDO A;  2OTL Z;  5A2Q f;  1ZB9 A;  3M4O I;  3RZO I;  4E2Z A;  3CMA Z;  2QRD B;  3JAM f;  3VB9 A;  4E2Y A;  1S72 1;  4Y52 I;  3GTM S;  4MRI A;  3GTG I;  1M1K 1;  3HOZ I;  5C3E I;  2E2I I;  2M48 A;  4CL1 A;  1AA6 A;  3CD6 Z;  3CME Z;  3CXC Y;  1QXF A;  4X6A I;  1YJN Z;  2HU9 A;  1TWF I;  2E2J I;  1JJ2 Y;  2EGT A;  4A93 I;  2P28 A;  3CC2 Z;  4NBF A;  4A3F I;  2B63 I;  3IX0 A;  2E2H I;  4MH4 A;  2AYD A;  5D1P A;  3CCL 1;  2V45 A;  3NFZ A;  3I56 1;  4A3J I;  5CM2 M;  2VF1 A;  3J7A 4;  5AN9 F;  2ZAE B;  1VQ4 1;  1Q82 2;  1K8A 2;  1VQN Z;  2H85 A;  3S16 I;  1Q86 2;  4Y7N I;  3M3Y I;  1VQ5 1;  1R9T I;  2V8I A;  2F4O A;  2RBL A;  3FKI I;  2Y0S A;  2J6A A;  4NH1 C;  5IT9 b;  1YJ9 1;  3I55 1;  1WW9 A;  2JA7 I;  2E9H A;  1QVG Y;  1K83 I;  2R6M A;  1Y1V S;  4E33 A;  1VQ6 Z;  3TE5 B;  1NP6 A;  5D1O A;  2F4M A;  5T6B A;  2G2K A;  2JNY A;  3ESW A;  2V3V A;  1KQS Y;  4NBE A;  2JA8 I;  3J80 f;  3OW2 Z;  2QKD A;  3KIH A;  3G6E Z;  2NVX I;  3CCJ 1;  3T4N B;  3CCE 1;  2JIP A;  3EED A;  1DL6 A;  2OTL 1;  1M90 2;  3GTJ I;  3I4M I;  1Q81 1;  3CMA 1;  1KRL A;  1SIW A;  1RO2 A;  2WB1 A;  1QVF Y;  1L1O C;  1Y1V I;  3HKZ A;  2Q51 A;  1I3Q I;  3CD6 1;  3CME 1;  2R92 I;  4NBB A;  4RVG A;  2V8K A;  4BBR I;  5C44 I;  3CC7 Z;  1VQP Z;  2YU9 I;  3J81 b;  3S1N I; 
#chains in the Genus database with same CATH homology
 5FLX f;  1VQK Z;  3CC2 1;  5IP7 I;  1KD1 2;  1RO0 A;  4NOZ A;  1N8R 1;  1K9M 2;  3S2D I;  2HF1 A;  4NFR A;  3MON A;  2QRC B;  1N2F A;  3VMG A;  1P9N A;  1Q7Y 1;  4RVD A;  1NJI 2;  2GU2 A;  4DK1 A;  2JUB A;  1VQN 1;  3NH5 A;  3HOV I;  2DE7 A;  4NBD A;  2RHB A;  1VQM Z;  3FQM A;  1Y1W I;  4HGY A;  2GTH A;  3GTQ I;  2RT9 A;  2I3C A;  4DGL A;  2NVQ I;  3IFU A;  2KPI A;  1KC8 1;  5C4X I;  2OZK A;  4XX2 A;  1VQ6 1;  2OTJ 1;  3GTO I;  3KIF A;  3G4S Z;  1X3Z A;  1QVG Z;  3G6E 1;  2IZ4 A;  2DE5 A;  4NBG A;  3H0G I;  2GTI A;  1YJW Z;  1KQS Z;  1YIT Z;  3NH8 A;  4BY1 I;  4NBC A;  5FLM I;  4E31 A;  2JMO A;  3QWU A;  1JWH C;  3G71 Z;  3CCU Z;  3CCM Z;  1M90 1;  4E2X A;  2O53 A;  2PMZ A;  3S1R I;  2K3R A;  3S2H I;  4BY7 I;  3VTN A;  1K73 1;  1M1K 2;  3CCV Z;  3GCF A;  3CC4 Z;  1VQP 1;  2PK7 A;  3CC7 1;  1YHQ Z;  2JS4 A;  4A3K I;  3VMI A;  4A3B I;  1VQ8 Z;  4NB9 A;  1VQK 1;  1USP A;  3Q87 A;  1TWG I;  4NB8 A;  2Q4Z A;  5IT9 f;  3F3F C;  5D1O B;  3F3P C;  5LL6 f;  2V8J A;  3PO3 I;  1K9M 1;  2DE6 A;  1RQF A;  1LQL A;  3MZK B;  3CCR Z;  3D6W A;  5IP9 I;  1PFT A;  3H3V J;  3K7A I;  4NBA A;  1VQM 1;  1Z02 A;  1Z01 A;  3BG1 B;  1QYP A;  1S7M A;  3GTK I;  1X0T A;  4HGZ A;  1YJN 1;  2QLV B;  3CPW Y;  3NH4 A;  3I4N I;  1VQ7 Z;  4E30 A;  3MZL B;  3G4S 1;  3CCS Z;  1RNI A;  3CXC Z;  1I50 I;  1ZH1 A;  4AYB A;  4TNU A;  2P3Y A;  3OW2 Y;  2NVT I;  1JJ2 Z;  5A2Q b;  4QTT A;  1YI2 Z;  4QTU A;  1YUA A;  3P5J B;  1WCM I;  4E32 A;  2JA6 I;  4A3C I;  4E2W A;  3GTL I;  3JAM b;  3EER A;  1YJW 1;  1VLA A;  4MD8 A;  2M6N A;  3J81 f;  1W2B Y;  3U50 C;  4DQY B;  4BXX I;  3PO2 I;  3G71 1;  3CCU 1;  1Q82 1;  4A3I I;  1K8A 1;  3GKQ A;  3CCM 1;  2W04 A;  1Q86 1;  1Q81 2;  2OOY B;  2OOX B;  2KI7 B;  2JA5 I;  2QEX Z;  3HOW I;  2LFU A;  4MON A;  3CCV 1;  3RZD I;  2VUM I;  1TWC I;  3CC4 1;  3LUS A;  1YUK A;  1YHQ 1;  4A3M I;  1VQ8 1;  1VQL Z;  2WAQ A;  1WII A;  3I07 A;  4BBS I;  4NBH A;  1RO4 A;  3CCQ Z;  1N8R 2;  1ZB8 A;  1Q7Y 2;  1VQO Z;  3S1M I;  3HOX I;  3CCR 1;  3PO3 S;  2QA4 Z;  3NDI A;  1VQ9 Z;  1YIJ Z;  4MD7 A;  3CQZ I;  2BJO A;  3GTM I;  2QRE B;  1Z03 A;  4A3L I;  1S72 Z;  4RV9 A;  5T64 A;  4A3E I;  1QVF Z;  3J80 b;  5C4J I;  1VQ7 1;  1SFO I;  3CCS 1;  3IF8 A;  3NDJ A;  4S1T A;  2AKL A;  1KC8 2;  3S15 I;  2W03 A;  2K5R A;  3FQQ A;  4HH4 A;  3S14 I;  3CPW Z;  1QF8 A;  1YI2 1;  1KD1 1;  1RLY A;  2VUG A;  2OTJ Z;  1USP B;  4RVH A;  3TDH B;  3GTP I;  1TFI A;  2NVY I;  1NJI 1;  3CCL Z;  2RPR A;  3I56 Z;  1X3W A;  2R93 I;  3S17 I;  3S1Q I;  2QR1 B;  1TWH I;  2PM9 A;  1VQ4 Z;  2YAD A;  1W2B Z;  4MD9 A;  2QEX 1;  5FLX b;  1ML8 A;  1VQ5 Z;  4A3G I;  3BG0 B;  1K73 2;  2LIY A;  1YJ9 Z;  3I55 Z;  4RS4 A;  1VQL 1;  3HOU I;  4MXU A;  1NUI A;  2R7Z I;  1YIT 1;  3CCQ 1;  1TWA I;  5T67 A;  3VMH A;  3HOY I;  1I6H I;  2IZ3 A;  3CCJ Z;  4A3D I;  1VQO 1;  2O4H A;  3CCE Z;  2QA4 1;  4RVF A;  3D9X A;  2RIQ A;  4EWC A;  2JR6 A;  1VQ9 1;  1YIJ 1;  2OTL Z;  5A2Q f;  1ZB9 A;  3M4O I;  3RZO I;  4E2Z A;  3CMA Z;  2QRD B;  3JAM f;  3VB9 A;  4E2Y A;  1S72 1;  4Y52 I;  3GTM S;  4MRI A;  3GTG I;  1M1K 1;  3HOZ I;  5C3E I;  2E2I I;  2M48 A;  4CL1 A;  3CD6 Z;  3CME Z;  3CXC Y;  4X6A I;  1YJN Z;  2HU9 A;  1TWF I;  2E2J I;  1JJ2 Y;  2EGT A;  4A93 I;  2P28 A;  3CC2 Z;  4NBF A;  4A3F I;  2B63 I;  3IX0 A;  2E2H I;  4MH4 A;  5D1P A;  3CCL 1;  3NFZ A;  3I56 1;  4A3J I;  5CM2 M;  2VF1 A;  3J7A 4;  5AN9 F;  2ZAE B;  1VQ4 1;  1Q82 2;  1K8A 2;  1VQN Z;  2H85 A;  3S16 I;  1Q86 2;  4Y7N I;  3M3Y I;  1VQ5 1;  1R9T I;  2V8I A;  2F4O A;  2RBL A;  3FKI I;  2Y0S A;  2J6A A;  4NH1 C;  5IT9 b;  1YJ9 1;  3I55 1;  1WW9 A;  2JA7 I;  2E9H A;  1QVG Y;  1K83 I;  2R6M A;  1Y1V S;  4E33 A;  1VQ6 Z;  3TE5 B;  1NP6 A;  5D1O A;  2F4M A;  5T6B A;  2G2K A;  2JNY A;  3ESW A;  1KQS Y;  4NBE A;  2JA8 I;  3J80 f;  3OW2 Z;  2QKD A;  3KIH A;  3G6E Z;  2NVX I;  3CCJ 1;  3T4N B;  3CCE 1;  3EED A;  1DL6 A;  2OTL 1;  1M90 2;  3GTJ I;  3I4M I;  1Q81 1;  3CMA 1;  1KRL A;  1RO2 A;  2WB1 A;  1QVF Y;  1L1O C;  1Y1V I;  3HKZ A;  2Q51 A;  1I3Q I;  3CD6 1;  3CME 1;  2R92 I;  4NBB A;  4RVG A;  2V8K A;  4BBR I;  5C44 I;  3CC7 Z;  1VQP Z;  2YU9 I;  3J81 b;  3S1N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...