3OW2Y

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Y00
3CCQ1 3I56Z 3G71Z 1K9M1 1KD11 3CCLZ 1M1K2 1VQ61 3CC41 1N8R2 1M902 1VQKZ 2OTJZ 1K732 1Q812 1VQOZ 1YJNZ 1VQN1 1VQ81 1KD12 1VQM1 1YJW1 1Q821 3CMA1 3CD61 3CCSZ 2QEX1 3CPWZ 3G4S1 2QA41 3CCQZ 1Q822 1VQ71 1YIT1 1YHQ1 3G6E1 1YI21 1VQP1 1VQ6Z 1K8A1 3CC4Z 1NJI1 3CCU1 1W2BZ 1W2BY 3CCV1 1VQNZ 1VQ8Z 3CCM1 1YJWZ 3CCE1 3CD6Z 1VQLZ 3CC71 1Q861 1KQSZ 1KQSY 1K8A2 1NJI2 2QEXZ 2OTL1 3CCJ1 2QA4Z 1VQ51 3CXCY 3CCR1 1YIJZ 1VQ7Z 1YHQZ 3G6EZ 1YI2Z 1VQPZ 1YJ91 1Q862 3CCUZ 3CC21 1S721 3CCVZ 1VQ91 3CCMZ 3CCEZ 3CC7Z 1VQMZ 2OTLZ 3CMAZ 1Q7Y1 2OTJ1 3CCRZ 3G4SZ 3CXCZ 3CC2Z 1YITZ 1Q7Y2 1S72Z 1VQ9Z 1JJ2Z 1JJ2Y 1QVGY 3CME1 3I551 1VQ41 1KC81 3I561 3G711 3CCL1 1K9M2 3CCJZ 1VQ5Z 1VQK1 1VQL1 1VQO1 1YJ9Z 1KC82 3CPWY 1YJN1 3CMEZ 3I55Z 1VQ4Z 3OW2Z 3OW2Y 1M1K1 1YIJ1 3CCS1 1N8R1 1M901 1QVGZ 1Q811 1K731 1QVFZ 1QVFY
chains in the Genus database with same CATH superfamily
3I56Z 3G71Z 1M1K2 4A3FI 2I3CA 4TNUA 1N8R2 2G2KA 1Y8CA 3S2HI 1WIIA 4NBGA 4HGZA 3CD61 3PO3I 2QEX1 2JUBA 4BY1I 2P28A 1RO4A 3J80b 4MH4A 2BJOA 5D1OB 3JAMf 1VQ6Z 4E30A 2JA7I 1ZB8A 3S1QI 4A3KI 1VQNZ 1QXFA 1NUIA 1QF8A 4HH4A 3S1NI 4QTTA 1KQSZ 4A3II 4MD7A 3NFZA 5LL6f 2QA4Z 3EEDA 3CCR1 1YIJZ 1TWGI 4RVGA 1Q16A 2WB1A 1YI2Z 2PM9A 3NH5A 2Q51A 5C44I 2QRCB 2V8JA 4RVDA 2JR6A 3CCMZ 2DE7A 3KIHA 2QKDA 4E2WA 2OOXB 1USPA 1X3ZA 3HOYI 2R7ZI 2F4MA 2V45A 2H85A 3J81f 1S72Z 4E2XA 3RZDI 2RT9A 2JIMA 5CM2M 2JIPA 1WW9A 4Y7NI 2AYDA 4A3MI 4MXUA 3I561 3G711 2KPIA 3IF8A 3VMGA 4RVFA 3BG0B 5IT9b 4A93I 1QYPA 2RBLA 5C3EI 2M48A 3NH4A 3CMEZ 4NFRA 1VQ4Z 2GTHA 2M6NA 1LQLA 4MRIA 3VTNA 1QVGZ 1K731 2QREB 2E9HA 1RNIA 2O4HA 1WCMI 4NOZA 4NB9A 1K9M1 2R92I 3HOUI 2R93I 1VQ61 2ZAEB 2V8IA 3GCFA 4NB8A 1K732 2V8KA 5D1PA 2PK7A 4A3EI 1RLYA 1VQN1 2YADA 1USPB 3T4NB 3CMA1 2VPXA 1YUKA 3G4S1 1Y1WI 1ZB9A 2QA41 4EWCA 3CCQZ 1YIT1 1YI21 3GTLI 3ESWA 3HOXI 1W2BY 2QLVB 1I3QI 2NVXI 2VPYA 1VQ8Z 3Q87A 3CCM1 1P9NA 2E7ZA 1NP6A 3S2DI 3G6EZ 3GTMS 1VQPZ 1Z01A 3J80f 3D2LA 1I50I 1S721 4BBSI 3PO2I 5T67A 3S15I 3CCEZ 1JWHC 3HOWI 5IP7I 2W03A 3FKII 3NDIA 1I6HI 3M4OI 3CMAZ 1Q7Y1 3GTOI 3I4NI 1Y1VS 1ML8A 3G4SZ 3CXCZ 2Q4ZA 3F3FC 4AYBA 3JAMb 1YITZ 2NVQI 1X0TA 2V3VA 1Q7Y2 1JJ2Z 1QVGY 3CME1 2P3YA 1VQ41 2JA6I 3PO3S 4DK1A 1YUAA 1SIWA 4A3LI 4E31A 2JA5I 5FLXf 3S1MI 4A3JI 1VQL1 4NBEA 3HOVI 3I55Z 3OW2Z 1Z03A 4E32A 5T6BA 1TWCI 2F4OA 2OOYB 1QVFZ 2Y0SA 2NVTI 3CCQ1 5IP9I 4Y52I 2E2HI 3CCLZ 2VUGA 3NDJA 2LEXA 1TFIA 4A3BI 2GTIA 4CL1A 1VQOZ 2JIQA 2K3RA 4NBBA 1RO0A 2IV2X 1YJNZ 1VQ81 1VQM1 5IT9f 3GTQI 3VMIA 2B63I 3CPWZ 1N2FA 1FDIA 3U50C 2DE5A 4DQYB 1TWHI 3G6E1 1VQP1 2W04A 2E2JI 2EGTA 1K8A1 3CC4Z 2JA8I 3LUSA 1YJWZ 1WJ2A 3MZKB 3CCE1 1VQLZ 2VUMI 2LFUA 1KQSY 1K8A2 2OZKA 4BXXI 4HGYA 1VQ51 5A2Qf 3CXCY 1VQ7Z 1YHQZ 1PFTA 1S7MA 1YJ91 1KRLA 2VPZA 3HKZA 4QTUA 2DE6A 2RHBA 1K83I 3CCUZ 3CCVZ 3MONA 3TE5B 5C4JI 3CC7Z 2K5RA 3GTMI 3FQQA 2AKLA 1VQMZ 2OTLZ 4X6AI 2OTJ1 1L1OC 2JS4A 3CQZI 3M3YI 4XX2A 3CC2Z 1VQ9Z 4A3GI 3IFUA 4RV9A 3I551 2VF1A 1Y1VI 4MONA 4RS4A 2GU2A 5FLMI 2YU9I 2QR1B 4NBCA 3CCL1 1FDOA 3VMHA 4NH1C 1VQ5Z 1X3WA 2QRDB 1VQO1 1TWFI 1YJ9Z 3S1RI 3CPWY 1YJN1 2IZ3A 3IX0A 4BBRI 1M901 2JIRA 1Q811 2NAPA 2O53A 3GTKI 1KD11 2NVYI 3S16I 4RVHA 3CC41 1M902 1VQKZ 2OTJZ 1Q812 3S14I 3NH8A 5C4XI 1KD12 1R9TI 3VB9A 1YJW1 1Q821 3HOZI 3CCSZ 4MD9A 4A3DI 3QWUA 4NBAA 1AA6A 1Q822 1VQ71 4A3CI 1YHQ1 3RZOI 3I4MI 1VLAA 4NBHA 1NJI1 3CCU1 3BG1B 1W2BZ 3CCV1 5FLXb 4BY7I 3CD6Z 3CC71 1Q861 1NJI2 2QEXZ 4E2ZA 3GTJI 3EERA 4MD8A 2OTL1 3CCJ1 1TWAI 1WZNA 3J81b 1SFOI 1Q862 3S17I 3CC21 2R6MA 5AN9F 3KIFA 3H3VJ 1VQ91 3H0GI 4NBFA 2LIYA 3D6WA 2HU9A 3CCRZ 4NBDA 3K7AI 2RIQA 5D1OA 3GTGI 2JNYA 2PMZA 2IZ4A 4E2YA 1RQFA 4S1TA 1JJ2Y 3GKQA 1ZH1A 3IR7A 3J7A4 2E2II 2JIOA 3F3PC 1KC81 1DL6A 2JMOA 2WAQA 1RO2A 1K9M2 3CCJZ 3I07A 5A2Qb 1VQK1 3P5JB 2VPWA 2KI7B 3TDHB 3FQMA 2J6AA 1KC82 4DGLA 5T64A 1M1K1 4E33A 3OW2Y 1YIJ1 2HF1A 3CCS1 3D9XA 1N8R1 3GTPI 2RPRA 1Z02A 1QVFY 3MZLB
chains in the Genus database with same CATH topology
3I56Z 3G71Z 1M1K2 4A3FI 2I3CA 4TNUA 1N8R2 2G2KA 3S2HI 1WIIA 4NBGA 4HGZA 3CD61 3PO3I 2QEX1 2JUBA 4BY1I 2P28A 1RO4A 3J80b 4MH4A 2BJOA 5D1OB 3JAMf 1VQ6Z 4E30A 2JA7I 1ZB8A 3S1QI 4A3KI 1VQNZ 1NUIA 1QF8A 4HH4A 3S1NI 4QTTA 1KQSZ 4A3II 4MD7A 3NFZA 5LL6f 2QA4Z 3EEDA 3CCR1 1YIJZ 1TWGI 4RVGA 2WB1A 1YI2Z 2PM9A 3NH5A 2Q51A 5C44I 2QRCB 2V8JA 4RVDA 2JR6A 3CCMZ 2DE7A 3KIHA 2QKDA 4E2WA 2OOXB 1USPA 1X3ZA 3HOYI 2R7ZI 2F4MA 2H85A 3J81f 1S72Z 4E2XA 3RZDI 2RT9A 5CM2M 1WW9A 4Y7NI 4A3MI 4MXUA 3I561 3G711 2KPIA 3IF8A 3VMGA 4RVFA 3BG0B 5IT9b 4A93I 1QYPA 2RBLA 5C3EI 2M48A 3NH4A 3CMEZ 4NFRA 1VQ4Z 2GTHA 2M6NA 1LQLA 4MRIA 3VTNA 1QVGZ 1K731 2QREB 2E9HA 1RNIA 2O4HA 1WCMI 4NOZA 4NB9A 1K9M1 2R92I 3HOUI 2R93I 1VQ61 2ZAEB 2V8IA 3GCFA 4NB8A 1K732 2V8KA 5D1PA 2PK7A 4A3EI 1RLYA 1VQN1 2YADA 1USPB 3T4NB 3CMA1 1YUKA 3G4S1 1Y1WI 1ZB9A 2QA41 4EWCA 3CCQZ 1YIT1 1YI21 3GTLI 3ESWA 3HOXI 1W2BY 2QLVB 1I3QI 2NVXI 1VQ8Z 3Q87A 3CCM1 1P9NA 1NP6A 3S2DI 3G6EZ 3GTMS 1VQPZ 1Z01A 3J80f 1I50I 1S721 4BBSI 3PO2I 5T67A 3S15I 3CCEZ 1JWHC 3HOWI 5IP7I 2W03A 3FKII 3NDIA 1I6HI 3M4OI 3CMAZ 1Q7Y1 3GTOI 3I4NI 1Y1VS 1ML8A 3G4SZ 3CXCZ 2Q4ZA 3F3FC 4AYBA 3JAMb 1YITZ 2NVQI 1X0TA 1Q7Y2 1JJ2Z 1QVGY 3CME1 2P3YA 1VQ41 2JA6I 3PO3S 4DK1A 1YUAA 4A3LI 4E31A 2JA5I 5FLXf 3S1MI 4A3JI 1VQL1 4NBEA 3HOVI 3I55Z 3OW2Z 1Z03A 4E32A 5T6BA 1TWCI 2F4OA 2OOYB 1QVFZ 2Y0SA 2NVTI 3CCQ1 5IP9I 4Y52I 2E2HI 3CCLZ 2VUGA 3NDJA 1TFIA 4A3BI 2GTIA 4CL1A 1VQOZ 2K3RA 4NBBA 1RO0A 1YJNZ 1VQ81 1VQM1 5IT9f 3GTQI 3VMIA 2B63I 3CPWZ 1N2FA 3U50C 4DQYB 2DE5A 1TWHI 3G6E1 1VQP1 2W04A 2E2JI 2EGTA 1K8A1 3CC4Z 2JA8I 3LUSA 1YJWZ 3MZKB 3CCE1 1VQLZ 2VUMI 2LFUA 1KQSY 1K8A2 2OZKA 4BXXI 4HGYA 1VQ51 5A2Qf 3CXCY 1VQ7Z 1YHQZ 1PFTA 1S7MA 1YJ91 1KRLA 3HKZA 4QTUA 2DE6A 2RHBA 1K83I 3CCUZ 3CCVZ 3MONA 3TE5B 5C4JI 3CC7Z 2K5RA 3GTMI 3FQQA 2AKLA 1VQMZ 2OTLZ 4X6AI 2OTJ1 1L1OC 2JS4A 3CQZI 3M3YI 4XX2A 3CC2Z 1VQ9Z 4A3GI 3IFUA 4RV9A 3I551 2VF1A 1Y1VI 4MONA 4RS4A 2GU2A 5FLMI 2YU9I 2QR1B 4NBCA 3CCL1 3VMHA 4NH1C 1VQ5Z 1X3WA 2QRDB 1VQO1 1TWFI 1YJ9Z 3S1RI 3CPWY 1YJN1 2IZ3A 3IX0A 4BBRI 1M901 1Q811 2O53A 3GTKI 1KD11 2NVYI 3S16I 4RVHA 3CC41 1M902 1VQKZ 2OTJZ 1Q812 3S14I 3NH8A 5C4XI 1KD12 1R9TI 3VB9A 1YJW1 1Q821 3HOZI 3CCSZ 4MD9A 4A3DI 3QWUA 4NBAA 1Q822 1VQ71 4A3CI 1YHQ1 3RZOI 3I4MI 1VLAA 4NBHA 1NJI1 3CCU1 3BG1B 1W2BZ 3CCV1 5FLXb 4BY7I 3CD6Z 3CC71 1Q861 1NJI2 2QEXZ 4E2ZA 3GTJI 3EERA 4MD8A 2OTL1 3CCJ1 1TWAI 3J81b 1SFOI 1Q862 3S17I 3CC21 2R6MA 5AN9F 3KIFA 3H3VJ 1VQ91 3H0GI 4NBFA 2LIYA 3D6WA 2HU9A 3CCRZ 4NBDA 3K7AI 2RIQA 5D1OA 3GTGI 2JNYA 2PMZA 2IZ4A 4E2YA 1RQFA 4S1TA 1JJ2Y 3GKQA 1ZH1A 3J7A4 2E2II 3F3PC 1KC81 1DL6A 2JMOA 2WAQA 1RO2A 1K9M2 3CCJZ 3I07A 5A2Qb 1VQK1 3P5JB 2KI7B 3TDHB 3FQMA 2J6AA 1KC82 4DGLA 5T64A 1M1K1 4E33A 3OW2Y 1YIJ1 2HF1A 3CCS1 3D9XA 1N8R1 3GTPI 2RPRA 1Z02A 1QVFY 3MZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ 1;  3I56 Z;  3G71 Z;  1K9M 1;  1KD1 1;  3CCL Z;  1M1K 2;  1VQ6 1;  3CC4 1;  1N8R 2;  1M90 2;  1VQK Z;  2OTJ Z;  1K73 2;  1Q81 2;  1VQO Z;  1YJN Z;  1VQN 1;  1VQ8 1;  1KD1 2;  1VQM 1;  1YJW 1;  1Q82 1;  3CMA 1;  3CD6 1;  3CCS Z;  2QEX 1;  3CPW Z;  3G4S 1;  2QA4 1;  3CCQ Z;  1Q82 2;  1VQ7 1;  1YIT 1;  1YHQ 1;  3G6E 1;  1YI2 1;  1VQP 1;  1VQ6 Z;  1K8A 1;  3CC4 Z;  1NJI 1;  3CCU 1;  1W2B Z;  1W2B Y;  3CCV 1;  1VQN Z;  1VQ8 Z;  3CCM 1;  1YJW Z;  3CCE 1;  3CD6 Z;  1VQL Z;  3CC7 1;  1Q86 1;  1KQS Z;  1KQS Y;  1K8A 2;  1NJI 2;  2QEX Z;  2OTL 1;  3CCJ 1;  2QA4 Z;  1VQ5 1;  3CXC Y;  3CCR 1;  1YIJ Z;  1VQ7 Z;  1YHQ Z;  3G6E Z;  1YI2 Z;  1VQP Z;  1YJ9 1;  1Q86 2;  3CCU Z;  3CC2 1;  1S72 1;  3CCV Z;  1VQ9 1;  3CCM Z;  3CCE Z;  3CC7 Z;  1VQM Z;  2OTL Z;  3CMA Z;  1Q7Y 1;  2OTJ 1;  3CCR Z;  3G4S Z;  3CXC Z;  3CC2 Z;  1YIT Z;  1Q7Y 2;  1S72 Z;  1VQ9 Z;  1JJ2 Z;  1JJ2 Y;  1QVG Y;  3CME 1;  3I55 1;  1VQ4 1;  1KC8 1;  3I56 1;  3G71 1;  3CCL 1;  1K9M 2;  3CCJ Z;  1VQ5 Z;  1VQK 1;  1VQL 1;  1VQO 1;  1YJ9 Z;  1KC8 2;  3CPW Y;  1YJN 1;  3CME Z;  3I55 Z;  1VQ4 Z;  3OW2 Z;  3OW2 Y;  1M1K 1;  1YIJ 1;  3CCS 1;  1N8R 1;  1M90 1;  1QVG Z;  1Q81 1;  1K73 1;  1QVF Z;  1QVF Y; 
#chains in the Genus database with same CATH topology
 3I56 Z;  3G71 Z;  1M1K 2;  4A3F I;  2I3C A;  4TNU A;  1N8R 2;  2G2K A;  1Y8C A;  3S2H I;  1WII A;  4NBG A;  4HGZ A;  3CD6 1;  3PO3 I;  2QEX 1;  2JUB A;  4BY1 I;  2P28 A;  1RO4 A;  3J80 b;  4MH4 A;  2BJO A;  5D1O B;  3JAM f;  1VQ6 Z;  4E30 A;  2JA7 I;  1ZB8 A;  3S1Q I;  4A3K I;  1VQN Z;  1QXF A;  1NUI A;  1QF8 A;  4HH4 A;  3S1N I;  4QTT A;  1KQS Z;  4A3I I;  4MD7 A;  3NFZ A;  5LL6 f;  2QA4 Z;  3EED A;  3CCR 1;  1YIJ Z;  1TWG I;  4RVG A;  1Q16 A;  2WB1 A;  1YI2 Z;  2PM9 A;  3NH5 A;  2Q51 A;  5C44 I;  2QRC B;  2V8J A;  4RVD A;  2JR6 A;  3CCM Z;  2DE7 A;  3KIH A;  2QKD A;  4E2W A;  2OOX B;  1USP A;  1X3Z A;  3HOY I;  2R7Z I;  2F4M A;  2V45 A;  2H85 A;  3J81 f;  1S72 Z;  4E2X A;  3RZD I;  2RT9 A;  2JIM A;  5CM2 M;  2JIP A;  1WW9 A;  4Y7N I;  2AYD A;  4A3M I;  4MXU A;  3I56 1;  3G71 1;  2KPI A;  3IF8 A;  3VMG A;  4RVF A;  3BG0 B;  5IT9 b;  4A93 I;  1QYP A;  2RBL A;  5C3E I;  2M48 A;  3NH4 A;  3CME Z;  4NFR A;  1VQ4 Z;  2GTH A;  2M6N A;  1LQL A;  4MRI A;  3VTN A;  1QVG Z;  1K73 1;  2QRE B;  2E9H A;  1RNI A;  2O4H A;  1WCM I;  4NOZ A;  4NB9 A;  1K9M 1;  2R92 I;  3HOU I;  2R93 I;  1VQ6 1;  2ZAE B;  2V8I A;  3GCF A;  4NB8 A;  1K73 2;  2V8K A;  5D1P A;  2PK7 A;  4A3E I;  1RLY A;  1VQN 1;  2YAD A;  1USP B;  3T4N B;  3CMA 1;  2VPX A;  1YUK A;  3G4S 1;  1Y1W I;  1ZB9 A;  2QA4 1;  4EWC A;  3CCQ Z;  1YIT 1;  1YI2 1;  3GTL I;  3ESW A;  3HOX I;  1W2B Y;  2QLV B;  1I3Q I;  2NVX I;  2VPY A;  1VQ8 Z;  3Q87 A;  3CCM 1;  1P9N A;  2E7Z A;  1NP6 A;  3S2D I;  3G6E Z;  3GTM S;  1VQP Z;  1Z01 A;  3J80 f;  3D2L A;  1I50 I;  1S72 1;  4BBS I;  3PO2 I;  5T67 A;  3S15 I;  3CCE Z;  1JWH C;  3HOW I;  5IP7 I;  2W03 A;  3FKI I;  3NDI A;  1I6H I;  3M4O I;  3CMA Z;  1Q7Y 1;  3GTO I;  3I4N I;  1Y1V S;  1ML8 A;  3G4S Z;  3CXC Z;  2Q4Z A;  3F3F C;  4AYB A;  3JAM b;  1YIT Z;  2NVQ I;  1X0T A;  2V3V A;  1Q7Y 2;  1JJ2 Z;  1QVG Y;  3CME 1;  2P3Y A;  1VQ4 1;  2JA6 I;  3PO3 S;  4DK1 A;  1YUA A;  1SIW A;  4A3L I;  4E31 A;  2JA5 I;  5FLX f;  3S1M I;  4A3J I;  1VQL 1;  4NBE A;  3HOV I;  3I55 Z;  3OW2 Z;  1Z03 A;  4E32 A;  5T6B A;  1TWC I;  2F4O A;  2OOY B;  1QVF Z;  2Y0S A;  2NVT I;  3CCQ 1;  5IP9 I;  4Y52 I;  2E2H I;  3CCL Z;  2VUG A;  3NDJ A;  2LEX A;  1TFI A;  4A3B I;  2GTI A;  4CL1 A;  1VQO Z;  2JIQ A;  2K3R A;  4NBB A;  1RO0 A;  2IV2 X;  1YJN Z;  1VQ8 1;  1VQM 1;  5IT9 f;  3GTQ I;  3VMI A;  2B63 I;  3CPW Z;  1N2F A;  1FDI A;  3U50 C;  2DE5 A;  4DQY B;  1TWH I;  3G6E 1;  1VQP 1;  2W04 A;  2E2J I;  2EGT A;  1K8A 1;  3CC4 Z;  2JA8 I;  3LUS A;  1YJW Z;  1WJ2 A;  3MZK B;  3CCE 1;  1VQL Z;  2VUM I;  2LFU A;  1KQS Y;  1K8A 2;  2OZK A;  4BXX I;  4HGY A;  1VQ5 1;  5A2Q f;  3CXC Y;  1VQ7 Z;  1YHQ Z;  1PFT A;  1S7M A;  1YJ9 1;  1KRL A;  2VPZ A;  3HKZ A;  4QTU A;  2DE6 A;  2RHB A;  1K83 I;  3CCU Z;  3CCV Z;  3MON A;  3TE5 B;  5C4J I;  3CC7 Z;  2K5R A;  3GTM I;  3FQQ A;  2AKL A;  1VQM Z;  2OTL Z;  4X6A I;  2OTJ 1;  1L1O C;  2JS4 A;  3CQZ I;  3M3Y I;  4XX2 A;  3CC2 Z;  1VQ9 Z;  4A3G I;  3IFU A;  4RV9 A;  3I55 1;  2VF1 A;  1Y1V I;  4MON A;  4RS4 A;  2GU2 A;  5FLM I;  2YU9 I;  2QR1 B;  4NBC A;  3CCL 1;  1FDO A;  3VMH A;  4NH1 C;  1VQ5 Z;  1X3W A;  2QRD B;  1VQO 1;  1TWF I;  1YJ9 Z;  3S1R I;  3CPW Y;  1YJN 1;  2IZ3 A;  3IX0 A;  4BBR I;  1M90 1;  2JIR A;  1Q81 1;  2NAP A;  2O53 A;  3GTK I;  1KD1 1;  2NVY I;  3S16 I;  4RVH A;  3CC4 1;  1M90 2;  1VQK Z;  2OTJ Z;  1Q81 2;  3S14 I;  3NH8 A;  5C4X I;  1KD1 2;  1R9T I;  3VB9 A;  1YJW 1;  1Q82 1;  3HOZ I;  3CCS Z;  4MD9 A;  4A3D I;  3QWU A;  4NBA A;  1AA6 A;  1Q82 2;  1VQ7 1;  4A3C I;  1YHQ 1;  3RZO I;  3I4M I;  1VLA A;  4NBH A;  1NJI 1;  3CCU 1;  3BG1 B;  1W2B Z;  3CCV 1;  5FLX b;  4BY7 I;  3CD6 Z;  3CC7 1;  1Q86 1;  1NJI 2;  2QEX Z;  4E2Z A;  3GTJ I;  3EER A;  4MD8 A;  2OTL 1;  3CCJ 1;  1TWA I;  1WZN A;  3J81 b;  1SFO I;  1Q86 2;  3S17 I;  3CC2 1;  2R6M A;  5AN9 F;  3KIF A;  3H3V J;  1VQ9 1;  3H0G I;  4NBF A;  2LIY A;  3D6W A;  2HU9 A;  3CCR Z;  4NBD A;  3K7A I;  2RIQ A;  5D1O A;  3GTG I;  2JNY A;  2PMZ A;  2IZ4 A;  4E2Y A;  1RQF A;  4S1T A;  1JJ2 Y;  3GKQ A;  1ZH1 A;  3IR7 A;  3J7A 4;  2E2I I;  2JIO A;  3F3P C;  1KC8 1;  1DL6 A;  2JMO A;  2WAQ A;  1RO2 A;  1K9M 2;  3CCJ Z;  3I07 A;  5A2Q b;  1VQK 1;  3P5J B;  2VPW A;  2KI7 B;  3TDH B;  3FQM A;  2J6A A;  1KC8 2;  4DGL A;  5T64 A;  1M1K 1;  4E33 A;  3OW2 Y;  1YIJ 1;  2HF1 A;  3CCS 1;  3D9X A;  1N8R 1;  3GTP I;  2RPR A;  1Z02 A;  1QVF Y;  3MZL B; 
#chains in the Genus database with same CATH homology
 3I56 Z;  3G71 Z;  1M1K 2;  4A3F I;  2I3C A;  4TNU A;  1N8R 2;  2G2K A;  3S2H I;  1WII A;  4NBG A;  4HGZ A;  3CD6 1;  3PO3 I;  2QEX 1;  2JUB A;  4BY1 I;  2P28 A;  1RO4 A;  3J80 b;  4MH4 A;  2BJO A;  5D1O B;  3JAM f;  1VQ6 Z;  4E30 A;  2JA7 I;  1ZB8 A;  3S1Q I;  4A3K I;  1VQN Z;  1NUI A;  1QF8 A;  4HH4 A;  3S1N I;  4QTT A;  1KQS Z;  4A3I I;  4MD7 A;  3NFZ A;  5LL6 f;  2QA4 Z;  3EED A;  3CCR 1;  1YIJ Z;  1TWG I;  4RVG A;  2WB1 A;  1YI2 Z;  2PM9 A;  3NH5 A;  2Q51 A;  5C44 I;  2QRC B;  2V8J A;  4RVD A;  2JR6 A;  3CCM Z;  2DE7 A;  3KIH A;  2QKD A;  4E2W A;  2OOX B;  1USP A;  1X3Z A;  3HOY I;  2R7Z I;  2F4M A;  2H85 A;  3J81 f;  1S72 Z;  4E2X A;  3RZD I;  2RT9 A;  5CM2 M;  1WW9 A;  4Y7N I;  4A3M I;  4MXU A;  3I56 1;  3G71 1;  2KPI A;  3IF8 A;  3VMG A;  4RVF A;  3BG0 B;  5IT9 b;  4A93 I;  1QYP A;  2RBL A;  5C3E I;  2M48 A;  3NH4 A;  3CME Z;  4NFR A;  1VQ4 Z;  2GTH A;  2M6N A;  1LQL A;  4MRI A;  3VTN A;  1QVG Z;  1K73 1;  2QRE B;  2E9H A;  1RNI A;  2O4H A;  1WCM I;  4NOZ A;  4NB9 A;  1K9M 1;  2R92 I;  3HOU I;  2R93 I;  1VQ6 1;  2ZAE B;  2V8I A;  3GCF A;  4NB8 A;  1K73 2;  2V8K A;  5D1P A;  2PK7 A;  4A3E I;  1RLY A;  1VQN 1;  2YAD A;  1USP B;  3T4N B;  3CMA 1;  1YUK A;  3G4S 1;  1Y1W I;  1ZB9 A;  2QA4 1;  4EWC A;  3CCQ Z;  1YIT 1;  1YI2 1;  3GTL I;  3ESW A;  3HOX I;  1W2B Y;  2QLV B;  1I3Q I;  2NVX I;  1VQ8 Z;  3Q87 A;  3CCM 1;  1P9N A;  1NP6 A;  3S2D I;  3G6E Z;  3GTM S;  1VQP Z;  1Z01 A;  3J80 f;  1I50 I;  1S72 1;  4BBS I;  3PO2 I;  5T67 A;  3S15 I;  3CCE Z;  1JWH C;  3HOW I;  5IP7 I;  2W03 A;  3FKI I;  3NDI A;  1I6H I;  3M4O I;  3CMA Z;  1Q7Y 1;  3GTO I;  3I4N I;  1Y1V S;  1ML8 A;  3G4S Z;  3CXC Z;  2Q4Z A;  3F3F C;  4AYB A;  3JAM b;  1YIT Z;  2NVQ I;  1X0T A;  1Q7Y 2;  1JJ2 Z;  1QVG Y;  3CME 1;  2P3Y A;  1VQ4 1;  2JA6 I;  3PO3 S;  4DK1 A;  1YUA A;  4A3L I;  4E31 A;  2JA5 I;  5FLX f;  3S1M I;  4A3J I;  1VQL 1;  4NBE A;  3HOV I;  3I55 Z;  3OW2 Z;  1Z03 A;  4E32 A;  5T6B A;  1TWC I;  2F4O A;  2OOY B;  1QVF Z;  2Y0S A;  2NVT I;  3CCQ 1;  5IP9 I;  4Y52 I;  2E2H I;  3CCL Z;  2VUG A;  3NDJ A;  1TFI A;  4A3B I;  2GTI A;  4CL1 A;  1VQO Z;  2K3R A;  4NBB A;  1RO0 A;  1YJN Z;  1VQ8 1;  1VQM 1;  5IT9 f;  3GTQ I;  3VMI A;  2B63 I;  3CPW Z;  1N2F A;  3U50 C;  4DQY B;  2DE5 A;  1TWH I;  3G6E 1;  1VQP 1;  2W04 A;  2E2J I;  2EGT A;  1K8A 1;  3CC4 Z;  2JA8 I;  3LUS A;  1YJW Z;  3MZK B;  3CCE 1;  1VQL Z;  2VUM I;  2LFU A;  1KQS Y;  1K8A 2;  2OZK A;  4BXX I;  4HGY A;  1VQ5 1;  5A2Q f;  3CXC Y;  1VQ7 Z;  1YHQ Z;  1PFT A;  1S7M A;  1YJ9 1;  1KRL A;  3HKZ A;  4QTU A;  2DE6 A;  2RHB A;  1K83 I;  3CCU Z;  3CCV Z;  3MON A;  3TE5 B;  5C4J I;  3CC7 Z;  2K5R A;  3GTM I;  3FQQ A;  2AKL A;  1VQM Z;  2OTL Z;  4X6A I;  2OTJ 1;  1L1O C;  2JS4 A;  3CQZ I;  3M3Y I;  4XX2 A;  3CC2 Z;  1VQ9 Z;  4A3G I;  3IFU A;  4RV9 A;  3I55 1;  2VF1 A;  1Y1V I;  4MON A;  4RS4 A;  2GU2 A;  5FLM I;  2YU9 I;  2QR1 B;  4NBC A;  3CCL 1;  3VMH A;  4NH1 C;  1VQ5 Z;  1X3W A;  2QRD B;  1VQO 1;  1TWF I;  1YJ9 Z;  3S1R I;  3CPW Y;  1YJN 1;  2IZ3 A;  3IX0 A;  4BBR I;  1M90 1;  1Q81 1;  2O53 A;  3GTK I;  1KD1 1;  2NVY I;  3S16 I;  4RVH A;  3CC4 1;  1M90 2;  1VQK Z;  2OTJ Z;  1Q81 2;  3S14 I;  3NH8 A;  5C4X I;  1KD1 2;  1R9T I;  3VB9 A;  1YJW 1;  1Q82 1;  3HOZ I;  3CCS Z;  4MD9 A;  4A3D I;  3QWU A;  4NBA A;  1Q82 2;  1VQ7 1;  4A3C I;  1YHQ 1;  3RZO I;  3I4M I;  1VLA A;  4NBH A;  1NJI 1;  3CCU 1;  3BG1 B;  1W2B Z;  3CCV 1;  5FLX b;  4BY7 I;  3CD6 Z;  3CC7 1;  1Q86 1;  1NJI 2;  2QEX Z;  4E2Z A;  3GTJ I;  3EER A;  4MD8 A;  2OTL 1;  3CCJ 1;  1TWA I;  3J81 b;  1SFO I;  1Q86 2;  3S17 I;  3CC2 1;  2R6M A;  5AN9 F;  3KIF A;  3H3V J;  1VQ9 1;  3H0G I;  4NBF A;  2LIY A;  3D6W A;  2HU9 A;  3CCR Z;  4NBD A;  3K7A I;  2RIQ A;  5D1O A;  3GTG I;  2JNY A;  2PMZ A;  2IZ4 A;  4E2Y A;  1RQF A;  4S1T A;  1JJ2 Y;  3GKQ A;  1ZH1 A;  3J7A 4;  2E2I I;  3F3P C;  1KC8 1;  1DL6 A;  2JMO A;  2WAQ A;  1RO2 A;  1K9M 2;  3CCJ Z;  3I07 A;  5A2Q b;  1VQK 1;  3P5J B;  2KI7 B;  3TDH B;  3FQM A;  2J6A A;  1KC8 2;  4DGL A;  5T64 A;  1M1K 1;  4E33 A;  3OW2 Y;  1YIJ 1;  2HF1 A;  3CCS 1;  3D9X A;  1N8R 1;  3GTP I;  2RPR A;  1Z02 A;  1QVF Y;  3MZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...