3OW2Y

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Y00
2OTJZ 1YI21 1VQ5Z 1VQNZ 3CMAZ 3OW2Z 3CCM1 3G711 1VQ7Z 1YIJ1 3CCE1 1VQ91 3CCSZ 1VQ51 3G6E1 1VQOZ 1YJNZ 1W2BY 1VQL1 3CD6Z 1VQ61 1M902 1VQPZ 3CCV1 1KQSY 1VQ81 1VQ4Z 1K9M1 3G6EZ 1VQO1 1K732 3OW2Y 3CCJZ 1K8A2 1NJI1 1M1K2 1YIT1 3I55Z 3CPWZ 1S721 1VQM1 1YHQ1 3CCQZ 1M1K1 2QEX1 1YJ9Z 1NJI2 3CPWY 1JJ2Y 3CME1 1YJW1 2OTL1 3CCUZ 2QEXZ 3CXCZ 1Q822 3I56Z 3CCQ1 1K731 3CCJ1 1VQ71 1VQ9Z 1Q821 1JJ2Z 1YJN1 1W2BZ 3CMA1 3G4SZ 3CCRZ 3CCMZ 1QVFZ 1KD12 1Q811 3CCL1 3CCS1 1K8A1 3CD61 1VQ6Z 1Q812 3I561 1VQP1 1VQKZ 1YITZ 1S72Z 3CCLZ 1VQMZ 1YHQZ 1KQSZ 1VQN1 3CC2Z 1VQK1 2QA41 3CXCY 2OTJ1 1VQLZ 3CC4Z 1N8R1 3CMEZ 3CC21 1KD11 1QVGZ 1Q861 1YIJZ 3CCEZ 1QVFY 1N8R2 3CC41 1Q7Y1 1Q862 1KC81 1Q7Y2 3CCVZ 3G4S1 3CCR1 1VQ8Z 1VQ41 1KC82 3CC7Z 1K9M2 1YI2Z 1YJWZ 2OTLZ 3CCU1 3I551 1M901 3G71Z 3CC71 1QVGY 1YJ91 2QA4Z
chains in the Genus database with same CATH superfamily
3D6WA 3GTGI 1VQ5Z 1WW9A 2RT9A 3T4NB 1ML8A 4BY1I 2AKLA 3CCM1 3NDIA 2LEXA 1VQ7Z 1YIJ1 3GTMI 1KRLA 3S2HI 3CCSZ 2YU9I 1VQOZ 2M48A 1W2BY 2O53A 2B63I 3GTOI 1VQPZ 3J7A4 2JS4A 1VQO1 3HOXI 1K732 3CCJZ 4MD7A 3PO3I 3HOYI 3H3VJ 1NJI1 2Q51A 3CPWZ 2NAPA 3GTKI 1VQM1 1PFTA 4EWCA 2QEX1 1YJ9Z 1NJI2 2JA7I 4E30A 1JJ2Y 3J81b 2PK7A 3TE5B 1YJW1 2E2II 1Q822 4MH4A 3H0GI 2QREB 1VLAA 5FLXf 1FDIA 3CCRZ 4MD8A 4Y52I 1Q811 3MZKB 1K8A1 2V8IA 3CD61 3S17I 2K3RA 1Q812 4A3GI 1Y1VI 2NVTI 4A3FI 4A3II 1Y1WI 1VQKZ 1YHQZ 3I07A 1TWGI 5D1OB 3CQZI 2JIQA 2HF1A 1Z01A 3LUSA 2QA41 4BXXI 3GTQI 4MD9A 2R7ZI 1VQLZ 4E2XA 5IT9f 1WCMI 1QVFY 5T64A 1TWFI 5C3EI 1QYPA 3CC41 2E9HA 3GCFA 4QTTA 1JWHC 1Q7Y2 3G4S1 1ZB9A 1KC82 2OZKA 2LFUA 3PO3S 1Z03A 3S1MI 4MXUA 3CC71 4TNUA 1YJ91 2QEXZ 2JMOA 2NVXI 3OW2Z 4HGYA 2V8JA 1VQ91 2J6AA 5IP7I 1YUAA 4S1TA 1K83I 3CD6Z 1VQ61 1RO4A 1M902 5LL6f 1KQSY 4QTUA 3IFUA 3OW2Y 3NDJA 3TDHB 3NH4A 3FKII 3GTLI 2M6NA 1Q16A 3GKQA 1YIT1 3CCQZ 1M1K1 5C44I 3M4OI 1P9NA 2VUGA 3CPWY 1TWAI 4NB8A 4NBBA 3CCUZ 3ESWA 3I56Z 3BG0B 3I4NI 2RIQA 2F4MA 1VQ71 1VQ9Z 3HOVI 2DE7A 1QF8A 1YJN1 1W2BZ 3J80b 2JIPA 5FLMI 2LIYA 3J80f 1KD12 1QVFZ 3EERA 5D1PA 1SFOI 1RO2A 1USPB 2VPZA 2IV2X 1YITZ 4A3JI 2PMZA 2G2KA 3K7AI 1X0TA 1WJ2A 3CXCY 2OTJ1 5IP9I 4NBAA 2AYDA 1I6HI 3FQQA 3IF8A 3VMHA 4DGLA 3CC21 2OOXB 1TWHI 1QVGZ 5T67A 4RVFA 1YIJZ 3CCEZ 1Q861 3S1NI 4A3DI 4NBCA 2WAQA 2VPXA 3S2DI 1Q7Y1 5C4XI 1KC81 2JIMA 1VQ8Z 4A3EI 2QKDA 1ZB8A 4A3MI 4A3KI 2KPIA 1K9M2 1TFIA 1YI2Z 5A2Qf 1LQLA 2E7ZA 3EEDA 1YUKA 2OTLZ 2ZAEB 3KIHA 1M901 2JUBA 4E31A 1QVGY 4A3CI 2QLVB 2PM9A 4CL1A 1N2FA 1VQNZ 3CMAZ 3G711 2NVQI 3S1QI 2NVYI 3CCE1 2P28A 3I4MI 3G6E1 3S15I 1VQL1 3BG1B 2RPRA 5T6BA 2QR1B 3CCV1 1VQ4Z 3MZLB 3VTNA 2H85A 1X3WA 2F4OA 1K8A2 2V45A 3FQMA 3PO2I 1M1K2 2JIOA 1YHQ1 4E33A 3GTMS 4BBRI 4HGZA 2QRCB 3F3PC 3CME1 2WB1A 3CXCZ 3CCQ1 3P5JB 1K731 3CCJ1 1WZNA 1Q821 4RVDA 2O4HA 1I3QI 3CCMZ 5FLXb 4AYBA 3J81f 3M3YI 2R6MA 5CM2M 2VPYA 3RZDI 3CCL1 3D2LA 3CCS1 2QRDB 1RLYA 3JAMb 2V8KA 3I561 4NB9A 1VQP1 4BBSI 1S72Z 2DE5A 1I50I 1VQMZ 1KQSZ 2JIRA 3HOUI 3IX0A 4Y7NI 1VQN1 2OOYB 4BY7I 3MONA 3CC2Z 1VQK1 2Y0SA 5IT9b 3HOZI 2P3YA 3IR7A 3S16I 1N8R1 2HU9A 1KD11 4RV9A 2JA6I 3Q87A 2JR6A 1N8R2 3S14I 1RNIA 1Q862 2E2HI 3D9XA 3CCVZ 1DL6A 1VQ41 2W03A 3VMGA 3CC7Z 3NH8A 1ZH1A 4E2WA 4RS4A 3CCU1 4NH1C 3U50C 4NBFA 4RVHA 3G71Z 5AN9F 3GTJI 3QWUA 2Q4ZA 2QA4Z 2YADA 2OTJZ 1YI21 4MRIA 1Y8CA 2EGTA 5D1OA 1X3ZA 1AA6A 2JA5I 1VQ51 4NOZA 1YJNZ 2JA8I 2KI7B 2VUMI 2GTIA 1VQ81 1K9M1 1FDOA 3HKZA 3G6EZ 3HOWI 2JNYA 1NP6A 4E32A 2K5RA 1WIIA 3I55Z 1S721 3F3FC 1SIWA 3RZOI 2W04A 3VMIA 3GTPI 1Z02A 4NBGA 2OTL1 2BJOA 3NFZA 1JJ2Z 4A93I 4DK1A 3CMA1 3G4SZ 4A3BI 4A3LI 3KIFA 1RO0A 4MONA 2GU2A 2V3VA 2RBLA 3S1RI 2IZ4A 2VPWA 4NBHA 1VQ6Z 4NBDA 1TWCI 1USPA 4NFRA 3CCLZ 4HH4A 2VF1A 3VB9A 5A2Qb 1Y1VS 2IZ3A 2E2JI 4XX2A 2DE6A 4RVGA 2GTHA 4X6AI 1S7MA 3NH5A 3CC4Z 3CMEZ 4E2YA 4NBEA 2I3CA 4DQYB 3CCR1 1RQFA 4E2ZA 2RHBA 2R92I 2R93I 1QXFA 1YJWZ 1L1OC 1NUIA 3I551 1R9TI 3JAMf 5C4JI
chains in the Genus database with same CATH topology
3D6WA 3GTGI 1VQ5Z 1WW9A 2RT9A 3T4NB 1ML8A 4BY1I 2AKLA 3CCM1 3NDIA 1VQ7Z 1YIJ1 3GTMI 1KRLA 3S2HI 3CCSZ 2YU9I 1VQOZ 2M48A 1W2BY 2O53A 2B63I 3GTOI 1VQPZ 3J7A4 2JS4A 1VQO1 3HOXI 1K732 3CCJZ 4MD7A 3PO3I 3HOYI 3H3VJ 1NJI1 2Q51A 3CPWZ 3GTKI 1VQM1 1PFTA 4EWCA 2QEX1 1YJ9Z 1NJI2 2JA7I 4E30A 1JJ2Y 3J81b 2PK7A 3TE5B 1YJW1 2E2II 1Q822 4MH4A 3H0GI 2QREB 1VLAA 5FLXf 3CCRZ 4MD8A 4Y52I 1Q811 3MZKB 1K8A1 2V8IA 3CD61 3S17I 2K3RA 1Q812 4A3GI 1Y1VI 2NVTI 4A3FI 4A3II 1Y1WI 1VQKZ 1YHQZ 3I07A 1TWGI 5D1OB 3CQZI 2HF1A 1Z01A 3LUSA 2QA41 4BXXI 3GTQI 4MD9A 2R7ZI 1VQLZ 4E2XA 5IT9f 1WCMI 1QVFY 5T64A 1TWFI 5C3EI 1QYPA 3CC41 2E9HA 3GCFA 4QTTA 1JWHC 1Q7Y2 3G4S1 1ZB9A 1KC82 2OZKA 2LFUA 3PO3S 1Z03A 3S1MI 4MXUA 3CC71 4TNUA 1YJ91 2QEXZ 2JMOA 2NVXI 3OW2Z 4HGYA 2V8JA 1VQ91 2J6AA 5IP7I 1YUAA 4S1TA 1K83I 3CD6Z 1VQ61 1RO4A 1M902 5LL6f 1KQSY 4QTUA 3IFUA 3OW2Y 3NDJA 3TDHB 3NH4A 3FKII 3GTLI 2M6NA 3GKQA 1YIT1 3CCQZ 1M1K1 5C44I 3M4OI 1P9NA 2VUGA 3CPWY 1TWAI 4NB8A 4NBBA 3CCUZ 3ESWA 3I56Z 3BG0B 3I4NI 2RIQA 2F4MA 1VQ71 1VQ9Z 3HOVI 2DE7A 1QF8A 1YJN1 1W2BZ 3J80b 5FLMI 2LIYA 3J80f 1KD12 1QVFZ 3EERA 5D1PA 1SFOI 1RO2A 1USPB 1YITZ 4A3JI 2PMZA 2G2KA 3K7AI 1X0TA 3CXCY 2OTJ1 5IP9I 4NBAA 1I6HI 3FQQA 3IF8A 3VMHA 4DGLA 3CC21 2OOXB 1TWHI 1QVGZ 5T67A 4RVFA 1YIJZ 3CCEZ 1Q861 3S1NI 4A3DI 4NBCA 2WAQA 3S2DI 1Q7Y1 5C4XI 1KC81 1VQ8Z 4A3EI 2QKDA 1ZB8A 4A3MI 4A3KI 2KPIA 1K9M2 1TFIA 1YI2Z 5A2Qf 1LQLA 3EEDA 2OTLZ 1YUKA 2ZAEB 3KIHA 1M901 2JUBA 4E31A 1QVGY 4A3CI 2QLVB 2PM9A 4CL1A 1N2FA 1VQNZ 3CMAZ 3G711 2NVQI 3S1QI 2NVYI 3CCE1 2P28A 3I4MI 3G6E1 3S15I 1VQL1 3BG1B 2RPRA 5T6BA 2QR1B 3CCV1 1VQ4Z 3MZLB 3VTNA 2H85A 1X3WA 2F4OA 1K8A2 3FQMA 3PO2I 1M1K2 1YHQ1 4E33A 3GTMS 4BBRI 4HGZA 2QRCB 3F3PC 3CME1 2WB1A 3CXCZ 3CCQ1 3P5JB 1K731 3CCJ1 1Q821 4RVDA 2O4HA 1I3QI 3CCMZ 5FLXb 4AYBA 3J81f 3M3YI 2R6MA 5CM2M 3RZDI 3CCL1 3CCS1 2QRDB 1RLYA 3JAMb 2V8KA 3I561 4NB9A 1VQP1 4BBSI 1S72Z 2DE5A 1I50I 1VQMZ 1KQSZ 3HOUI 3IX0A 4Y7NI 1VQN1 2OOYB 4BY7I 3MONA 3CC2Z 1VQK1 2Y0SA 5IT9b 3HOZI 2P3YA 3S16I 1N8R1 2HU9A 1KD11 4RV9A 2JA6I 3Q87A 2JR6A 1N8R2 3S14I 1RNIA 1Q862 2E2HI 3D9XA 3CCVZ 1DL6A 1VQ41 2W03A 3VMGA 3CC7Z 3NH8A 1ZH1A 4E2WA 4RS4A 3CCU1 4NH1C 3U50C 4NBFA 4RVHA 3G71Z 5AN9F 3GTJI 3QWUA 2Q4ZA 2QA4Z 2YADA 2OTJZ 1YI21 4MRIA 2EGTA 5D1OA 1X3ZA 2JA5I 1VQ51 4NOZA 1YJNZ 2JA8I 2KI7B 2VUMI 2GTIA 1VQ81 1K9M1 3HKZA 3G6EZ 3HOWI 2JNYA 1NP6A 4E32A 2K5RA 1WIIA 3I55Z 1S721 3F3FC 3RZOI 2W04A 3VMIA 3GTPI 1Z02A 4NBGA 2OTL1 2BJOA 3NFZA 1JJ2Z 4A93I 4DK1A 3CMA1 3G4SZ 4A3BI 4A3LI 3KIFA 1RO0A 4MONA 2GU2A 2RBLA 3S1RI 2IZ4A 4NBHA 1VQ6Z 4NBDA 1TWCI 1USPA 4NFRA 3CCLZ 4HH4A 2VF1A 3VB9A 5A2Qb 1Y1VS 2IZ3A 2E2JI 4XX2A 2DE6A 4RVGA 2GTHA 4X6AI 1S7MA 3NH5A 3CC4Z 3CMEZ 4E2YA 4NBEA 2I3CA 4DQYB 3CCR1 1RQFA 4E2ZA 2RHBA 2R92I 2R93I 1YJWZ 1L1OC 1NUIA 3I551 1R9TI 3JAMf 5C4JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ Z;  1YI2 1;  1VQ5 Z;  1VQN Z;  3CMA Z;  3OW2 Z;  3CCM 1;  3G71 1;  1VQ7 Z;  1YIJ 1;  3CCE 1;  1VQ9 1;  3CCS Z;  1VQ5 1;  3G6E 1;  1VQO Z;  1YJN Z;  1W2B Y;  1VQL 1;  3CD6 Z;  1VQ6 1;  1M90 2;  1VQP Z;  3CCV 1;  1KQS Y;  1VQ8 1;  1VQ4 Z;  1K9M 1;  3G6E Z;  1VQO 1;  1K73 2;  3OW2 Y;  3CCJ Z;  1K8A 2;  1NJI 1;  1M1K 2;  1YIT 1;  3I55 Z;  3CPW Z;  1S72 1;  1VQM 1;  1YHQ 1;  3CCQ Z;  1M1K 1;  2QEX 1;  1YJ9 Z;  1NJI 2;  3CPW Y;  1JJ2 Y;  3CME 1;  1YJW 1;  2OTL 1;  3CCU Z;  2QEX Z;  3CXC Z;  1Q82 2;  3I56 Z;  3CCQ 1;  1K73 1;  3CCJ 1;  1VQ7 1;  1VQ9 Z;  1Q82 1;  1JJ2 Z;  1YJN 1;  1W2B Z;  3CMA 1;  3G4S Z;  3CCR Z;  3CCM Z;  1QVF Z;  1KD1 2;  1Q81 1;  3CCL 1;  3CCS 1;  1K8A 1;  3CD6 1;  1VQ6 Z;  1Q81 2;  3I56 1;  1VQP 1;  1VQK Z;  1YIT Z;  1S72 Z;  3CCL Z;  1VQM Z;  1YHQ Z;  1KQS Z;  1VQN 1;  3CC2 Z;  1VQK 1;  2QA4 1;  3CXC Y;  2OTJ 1;  1VQL Z;  3CC4 Z;  1N8R 1;  3CME Z;  3CC2 1;  1KD1 1;  1QVG Z;  1Q86 1;  1YIJ Z;  3CCE Z;  1QVF Y;  1N8R 2;  3CC4 1;  1Q7Y 1;  1Q86 2;  1KC8 1;  1Q7Y 2;  3CCV Z;  3G4S 1;  3CCR 1;  1VQ8 Z;  1VQ4 1;  1KC8 2;  3CC7 Z;  1K9M 2;  1YI2 Z;  1YJW Z;  2OTL Z;  3CCU 1;  3I55 1;  1M90 1;  3G71 Z;  3CC7 1;  1QVG Y;  1YJ9 1;  2QA4 Z; 
#chains in the Genus database with same CATH topology
 3D6W A;  3GTG I;  1VQ5 Z;  1WW9 A;  2RT9 A;  3T4N B;  1ML8 A;  4BY1 I;  2AKL A;  3CCM 1;  3NDI A;  2LEX A;  1VQ7 Z;  1YIJ 1;  3GTM I;  1KRL A;  3S2H I;  3CCS Z;  2YU9 I;  1VQO Z;  2M48 A;  1W2B Y;  2O53 A;  2B63 I;  3GTO I;  1VQP Z;  3J7A 4;  2JS4 A;  1VQO 1;  3HOX I;  1K73 2;  3CCJ Z;  4MD7 A;  3PO3 I;  3HOY I;  3H3V J;  1NJI 1;  2Q51 A;  3CPW Z;  2NAP A;  3GTK I;  1VQM 1;  1PFT A;  4EWC A;  2QEX 1;  1YJ9 Z;  1NJI 2;  2JA7 I;  4E30 A;  1JJ2 Y;  3J81 b;  2PK7 A;  3TE5 B;  1YJW 1;  2E2I I;  1Q82 2;  4MH4 A;  3H0G I;  2QRE B;  1VLA A;  5FLX f;  1FDI A;  3CCR Z;  4MD8 A;  4Y52 I;  1Q81 1;  3MZK B;  1K8A 1;  2V8I A;  3CD6 1;  3S17 I;  2K3R A;  1Q81 2;  4A3G I;  1Y1V I;  2NVT I;  4A3F I;  4A3I I;  1Y1W I;  1VQK Z;  1YHQ Z;  3I07 A;  1TWG I;  5D1O B;  3CQZ I;  2JIQ A;  2HF1 A;  1Z01 A;  3LUS A;  2QA4 1;  4BXX I;  3GTQ I;  4MD9 A;  2R7Z I;  1VQL Z;  4E2X A;  5IT9 f;  1WCM I;  1QVF Y;  5T64 A;  1TWF I;  5C3E I;  1QYP A;  3CC4 1;  2E9H A;  3GCF A;  4QTT A;  1JWH C;  1Q7Y 2;  3G4S 1;  1ZB9 A;  1KC8 2;  2OZK A;  2LFU A;  3PO3 S;  1Z03 A;  3S1M I;  4MXU A;  3CC7 1;  4TNU A;  1YJ9 1;  2QEX Z;  2JMO A;  2NVX I;  3OW2 Z;  4HGY A;  2V8J A;  1VQ9 1;  2J6A A;  5IP7 I;  1YUA A;  4S1T A;  1K83 I;  3CD6 Z;  1VQ6 1;  1RO4 A;  1M90 2;  5LL6 f;  1KQS Y;  4QTU A;  3IFU A;  3OW2 Y;  3NDJ A;  3TDH B;  3NH4 A;  3FKI I;  3GTL I;  2M6N A;  1Q16 A;  3GKQ A;  1YIT 1;  3CCQ Z;  1M1K 1;  5C44 I;  3M4O I;  1P9N A;  2VUG A;  3CPW Y;  1TWA I;  4NB8 A;  4NBB A;  3CCU Z;  3ESW A;  3I56 Z;  3BG0 B;  3I4N I;  2RIQ A;  2F4M A;  1VQ7 1;  1VQ9 Z;  3HOV I;  2DE7 A;  1QF8 A;  1YJN 1;  1W2B Z;  3J80 b;  2JIP A;  5FLM I;  2LIY A;  3J80 f;  1KD1 2;  1QVF Z;  3EER A;  5D1P A;  1SFO I;  1RO2 A;  1USP B;  2VPZ A;  2IV2 X;  1YIT Z;  4A3J I;  2PMZ A;  2G2K A;  3K7A I;  1X0T A;  1WJ2 A;  3CXC Y;  2OTJ 1;  5IP9 I;  4NBA A;  2AYD A;  1I6H I;  3FQQ A;  3IF8 A;  3VMH A;  4DGL A;  3CC2 1;  2OOX B;  1TWH I;  1QVG Z;  5T67 A;  4RVF A;  1YIJ Z;  3CCE Z;  1Q86 1;  3S1N I;  4A3D I;  4NBC A;  2WAQ A;  2VPX A;  3S2D I;  1Q7Y 1;  5C4X I;  1KC8 1;  2JIM A;  1VQ8 Z;  4A3E I;  2QKD A;  1ZB8 A;  4A3M I;  4A3K I;  2KPI A;  1K9M 2;  1TFI A;  1YI2 Z;  5A2Q f;  1LQL A;  2E7Z A;  3EED A;  1YUK A;  2OTL Z;  2ZAE B;  3KIH A;  1M90 1;  2JUB A;  4E31 A;  1QVG Y;  4A3C I;  2QLV B;  2PM9 A;  4CL1 A;  1N2F A;  1VQN Z;  3CMA Z;  3G71 1;  2NVQ I;  3S1Q I;  2NVY I;  3CCE 1;  2P28 A;  3I4M I;  3G6E 1;  3S15 I;  1VQL 1;  3BG1 B;  2RPR A;  5T6B A;  2QR1 B;  3CCV 1;  1VQ4 Z;  3MZL B;  3VTN A;  2H85 A;  1X3W A;  2F4O A;  1K8A 2;  2V45 A;  3FQM A;  3PO2 I;  1M1K 2;  2JIO A;  1YHQ 1;  4E33 A;  3GTM S;  4BBR I;  4HGZ A;  2QRC B;  3F3P C;  3CME 1;  2WB1 A;  3CXC Z;  3CCQ 1;  3P5J B;  1K73 1;  3CCJ 1;  1WZN A;  1Q82 1;  4RVD A;  2O4H A;  1I3Q I;  3CCM Z;  5FLX b;  4AYB A;  3J81 f;  3M3Y I;  2R6M A;  5CM2 M;  2VPY A;  3RZD I;  3CCL 1;  3D2L A;  3CCS 1;  2QRD B;  1RLY A;  3JAM b;  2V8K A;  3I56 1;  4NB9 A;  1VQP 1;  4BBS I;  1S72 Z;  2DE5 A;  1I50 I;  1VQM Z;  1KQS Z;  2JIR A;  3HOU I;  3IX0 A;  4Y7N I;  1VQN 1;  2OOY B;  4BY7 I;  3MON A;  3CC2 Z;  1VQK 1;  2Y0S A;  5IT9 b;  3HOZ I;  2P3Y A;  3IR7 A;  3S16 I;  1N8R 1;  2HU9 A;  1KD1 1;  4RV9 A;  2JA6 I;  3Q87 A;  2JR6 A;  1N8R 2;  3S14 I;  1RNI A;  1Q86 2;  2E2H I;  3D9X A;  3CCV Z;  1DL6 A;  1VQ4 1;  2W03 A;  3VMG A;  3CC7 Z;  3NH8 A;  1ZH1 A;  4E2W A;  4RS4 A;  3CCU 1;  4NH1 C;  3U50 C;  4NBF A;  4RVH A;  3G71 Z;  5AN9 F;  3GTJ I;  3QWU A;  2Q4Z A;  2QA4 Z;  2YAD A;  2OTJ Z;  1YI2 1;  4MRI A;  1Y8C A;  2EGT A;  5D1O A;  1X3Z A;  1AA6 A;  2JA5 I;  1VQ5 1;  4NOZ A;  1YJN Z;  2JA8 I;  2KI7 B;  2VUM I;  2GTI A;  1VQ8 1;  1K9M 1;  1FDO A;  3HKZ A;  3G6E Z;  3HOW I;  2JNY A;  1NP6 A;  4E32 A;  2K5R A;  1WII A;  3I55 Z;  1S72 1;  3F3F C;  1SIW A;  3RZO I;  2W04 A;  3VMI A;  3GTP I;  1Z02 A;  4NBG A;  2OTL 1;  2BJO A;  3NFZ A;  1JJ2 Z;  4A93 I;  4DK1 A;  3CMA 1;  3G4S Z;  4A3B I;  4A3L I;  3KIF A;  1RO0 A;  4MON A;  2GU2 A;  2V3V A;  2RBL A;  3S1R I;  2IZ4 A;  2VPW A;  4NBH A;  1VQ6 Z;  4NBD A;  1TWC I;  1USP A;  4NFR A;  3CCL Z;  4HH4 A;  2VF1 A;  3VB9 A;  5A2Q b;  1Y1V S;  2IZ3 A;  2E2J I;  4XX2 A;  2DE6 A;  4RVG A;  2GTH A;  4X6A I;  1S7M A;  3NH5 A;  3CC4 Z;  3CME Z;  4E2Y A;  4NBE A;  2I3C A;  4DQY B;  3CCR 1;  1RQF A;  4E2Z A;  2RHB A;  2R92 I;  2R93 I;  1QXF A;  1YJW Z;  1L1O C;  1NUI A;  3I55 1;  1R9T I;  3JAM f;  5C4J I; 
#chains in the Genus database with same CATH homology
 3D6W A;  3GTG I;  1VQ5 Z;  1WW9 A;  2RT9 A;  3T4N B;  1ML8 A;  4BY1 I;  2AKL A;  3CCM 1;  3NDI A;  1VQ7 Z;  1YIJ 1;  3GTM I;  1KRL A;  3S2H I;  3CCS Z;  2YU9 I;  1VQO Z;  2M48 A;  1W2B Y;  2O53 A;  2B63 I;  3GTO I;  1VQP Z;  3J7A 4;  2JS4 A;  1VQO 1;  3HOX I;  1K73 2;  3CCJ Z;  4MD7 A;  3PO3 I;  3HOY I;  3H3V J;  1NJI 1;  2Q51 A;  3CPW Z;  3GTK I;  1VQM 1;  1PFT A;  4EWC A;  2QEX 1;  1YJ9 Z;  1NJI 2;  2JA7 I;  4E30 A;  1JJ2 Y;  3J81 b;  2PK7 A;  3TE5 B;  1YJW 1;  2E2I I;  1Q82 2;  4MH4 A;  3H0G I;  2QRE B;  1VLA A;  5FLX f;  3CCR Z;  4MD8 A;  4Y52 I;  1Q81 1;  3MZK B;  1K8A 1;  2V8I A;  3CD6 1;  3S17 I;  2K3R A;  1Q81 2;  4A3G I;  1Y1V I;  2NVT I;  4A3F I;  4A3I I;  1Y1W I;  1VQK Z;  1YHQ Z;  3I07 A;  1TWG I;  5D1O B;  3CQZ I;  2HF1 A;  1Z01 A;  3LUS A;  2QA4 1;  4BXX I;  3GTQ I;  4MD9 A;  2R7Z I;  1VQL Z;  4E2X A;  5IT9 f;  1WCM I;  1QVF Y;  5T64 A;  1TWF I;  5C3E I;  1QYP A;  3CC4 1;  2E9H A;  3GCF A;  4QTT A;  1JWH C;  1Q7Y 2;  3G4S 1;  1ZB9 A;  1KC8 2;  2OZK A;  2LFU A;  3PO3 S;  1Z03 A;  3S1M I;  4MXU A;  3CC7 1;  4TNU A;  1YJ9 1;  2QEX Z;  2JMO A;  2NVX I;  3OW2 Z;  4HGY A;  2V8J A;  1VQ9 1;  2J6A A;  5IP7 I;  1YUA A;  4S1T A;  1K83 I;  3CD6 Z;  1VQ6 1;  1RO4 A;  1M90 2;  5LL6 f;  1KQS Y;  4QTU A;  3IFU A;  3OW2 Y;  3NDJ A;  3TDH B;  3NH4 A;  3FKI I;  3GTL I;  2M6N A;  3GKQ A;  1YIT 1;  3CCQ Z;  1M1K 1;  5C44 I;  3M4O I;  1P9N A;  2VUG A;  3CPW Y;  1TWA I;  4NB8 A;  4NBB A;  3CCU Z;  3ESW A;  3I56 Z;  3BG0 B;  3I4N I;  2RIQ A;  2F4M A;  1VQ7 1;  1VQ9 Z;  3HOV I;  2DE7 A;  1QF8 A;  1YJN 1;  1W2B Z;  3J80 b;  5FLM I;  2LIY A;  3J80 f;  1KD1 2;  1QVF Z;  3EER A;  5D1P A;  1SFO I;  1RO2 A;  1USP B;  1YIT Z;  4A3J I;  2PMZ A;  2G2K A;  3K7A I;  1X0T A;  3CXC Y;  2OTJ 1;  5IP9 I;  4NBA A;  1I6H I;  3FQQ A;  3IF8 A;  3VMH A;  4DGL A;  3CC2 1;  2OOX B;  1TWH I;  1QVG Z;  5T67 A;  4RVF A;  1YIJ Z;  3CCE Z;  1Q86 1;  3S1N I;  4A3D I;  4NBC A;  2WAQ A;  3S2D I;  1Q7Y 1;  5C4X I;  1KC8 1;  1VQ8 Z;  4A3E I;  2QKD A;  1ZB8 A;  4A3M I;  4A3K I;  2KPI A;  1K9M 2;  1TFI A;  1YI2 Z;  5A2Q f;  1LQL A;  3EED A;  2OTL Z;  1YUK A;  2ZAE B;  3KIH A;  1M90 1;  2JUB A;  4E31 A;  1QVG Y;  4A3C I;  2QLV B;  2PM9 A;  4CL1 A;  1N2F A;  1VQN Z;  3CMA Z;  3G71 1;  2NVQ I;  3S1Q I;  2NVY I;  3CCE 1;  2P28 A;  3I4M I;  3G6E 1;  3S15 I;  1VQL 1;  3BG1 B;  2RPR A;  5T6B A;  2QR1 B;  3CCV 1;  1VQ4 Z;  3MZL B;  3VTN A;  2H85 A;  1X3W A;  2F4O A;  1K8A 2;  3FQM A;  3PO2 I;  1M1K 2;  1YHQ 1;  4E33 A;  3GTM S;  4BBR I;  4HGZ A;  2QRC B;  3F3P C;  3CME 1;  2WB1 A;  3CXC Z;  3CCQ 1;  3P5J B;  1K73 1;  3CCJ 1;  1Q82 1;  4RVD A;  2O4H A;  1I3Q I;  3CCM Z;  5FLX b;  4AYB A;  3J81 f;  3M3Y I;  2R6M A;  5CM2 M;  3RZD I;  3CCL 1;  3CCS 1;  2QRD B;  1RLY A;  3JAM b;  2V8K A;  3I56 1;  4NB9 A;  1VQP 1;  4BBS I;  1S72 Z;  2DE5 A;  1I50 I;  1VQM Z;  1KQS Z;  3HOU I;  3IX0 A;  4Y7N I;  1VQN 1;  2OOY B;  4BY7 I;  3MON A;  3CC2 Z;  1VQK 1;  2Y0S A;  5IT9 b;  3HOZ I;  2P3Y A;  3S16 I;  1N8R 1;  2HU9 A;  1KD1 1;  4RV9 A;  2JA6 I;  3Q87 A;  2JR6 A;  1N8R 2;  3S14 I;  1RNI A;  1Q86 2;  2E2H I;  3D9X A;  3CCV Z;  1DL6 A;  1VQ4 1;  2W03 A;  3VMG A;  3CC7 Z;  3NH8 A;  1ZH1 A;  4E2W A;  4RS4 A;  3CCU 1;  4NH1 C;  3U50 C;  4NBF A;  4RVH A;  3G71 Z;  5AN9 F;  3GTJ I;  3QWU A;  2Q4Z A;  2QA4 Z;  2YAD A;  2OTJ Z;  1YI2 1;  4MRI A;  2EGT A;  5D1O A;  1X3Z A;  2JA5 I;  1VQ5 1;  4NOZ A;  1YJN Z;  2JA8 I;  2KI7 B;  2VUM I;  2GTI A;  1VQ8 1;  1K9M 1;  3HKZ A;  3G6E Z;  3HOW I;  2JNY A;  1NP6 A;  4E32 A;  2K5R A;  1WII A;  3I55 Z;  1S72 1;  3F3F C;  3RZO I;  2W04 A;  3VMI A;  3GTP I;  1Z02 A;  4NBG A;  2OTL 1;  2BJO A;  3NFZ A;  1JJ2 Z;  4A93 I;  4DK1 A;  3CMA 1;  3G4S Z;  4A3B I;  4A3L I;  3KIF A;  1RO0 A;  4MON A;  2GU2 A;  2RBL A;  3S1R I;  2IZ4 A;  4NBH A;  1VQ6 Z;  4NBD A;  1TWC I;  1USP A;  4NFR A;  3CCL Z;  4HH4 A;  2VF1 A;  3VB9 A;  5A2Q b;  1Y1V S;  2IZ3 A;  2E2J I;  4XX2 A;  2DE6 A;  4RVG A;  2GTH A;  4X6A I;  1S7M A;  3NH5 A;  3CC4 Z;  3CME Z;  4E2Y A;  4NBE A;  2I3C A;  4DQY B;  3CCR 1;  1RQF A;  4E2Z A;  2RHB A;  2R92 I;  2R93 I;  1YJW Z;  1L1O C;  1NUI A;  3I55 1;  1R9T I;  3JAM f;  5C4J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...