3OW2Y

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Y00
1QVGY 3CME1 1VQ41 3CCJZ 1K732 1VQOZ 1VQNZ 1VQ91 1YJ9Z 3CC71 2QA4Z 3CCU1 1Q7Y1 3OW2Y 2QEXZ 3CC2Z 1S721 1YHQZ 3CCM1 1VQ71 1VQ8Z 3I551 1KC81 3I56Z 1YITZ 1NJI1 1JJ2Z 3CC41 1VQMZ 3CPWY 1M1K1 3G6E1 3CXCZ 1Q812 1Q822 1K9M1 1KQSZ 3CCJ1 1K8A2 1VQO1 1YI2Z 2OTLZ 1VQN1 1YJ91 3CCV1 2QA41 1YIJZ 2OTJZ 1M901 1YJWZ 3CCEZ 1QVFZ 1W2BY 1Q7Y2 1K731 3CD6Z 1N8R1 3G71Z 1QVGZ 1VQ6Z 1KD12 3CMEZ 1YJNZ 1VQPZ 3G4SZ 1VQLZ 1VQKZ 3I561 3CCR1 1VQ5Z 3CCL1 3CC7Z 1JJ2Y 3OW2Z 1VQM1 1KC82 1Q862 1S72Z 3CCSZ 1NJI2 1M1K2 2OTL1 1K9M2 2OTJ1 2QEX1 3CC21 1YHQ1 3CCE1 1QVFY 3CMAZ 3CPWZ 3CCQZ 3CD61 1YJN1 1VQP1 1VQ4Z 1VQ81 3G4S1 1N8R2 1VQL1 1VQK1 1YIT1 1VQ9Z 1VQ51 3CCVZ 3CCUZ 3CXCY 1KQSY 3CCS1 1W2BZ 1KD11 1YI21 1YIJ1 3CCMZ 1YJW1 1VQ7Z 3I55Z 1Q811 1Q821 1M902 1Q861 1K8A1 3CCRZ 3CMA1 1VQ61 3CC4Z 3G711 3CCQ1 3CCLZ 3G6EZ
chains in the Genus database with same CATH superfamily
3CME1 1USPB 2JMOA 5AN9F 1KRLA 1K732 2NVQI 3Q87A 2JIMA 3FQQA 3FKII 4E2XA 2OOXB 1YJ9Z 1Q7Y1 3OW2Y 3GTJI 5C44I 2PK7A 2H85A 4MONA 2VUMI 1I3QI 3KIFA 3I551 1KC81 1X0TA 4RV9A 2QR1B 3CC41 2W03A 3CXCZ 1KQSZ 4HGYA 2Q51A 5C4JI 2QA41 4NBHA 2IV2X 1M901 1RO0A 3CCEZ 1QVFZ 2YU9I 1Q7Y2 2KPIA 4MXUA 3CD6Z 1Q16A 5T67A 2WB1A 5FLXf 1QVGZ 3HOUI 2RPRA 2JA7I 1TWAI 3CCL1 3CC7Z 1VQM1 1KC82 2JR6A 2E7ZA 4BBSI 2IZ4A 3NDIA 1TWHI 2NVTI 2VPXA 3MZKB 4RVFA 3HKZA 2HU9A 4A3LI 2F4OA 3HOYI 3CPWZ 3P5JB 4NBCA 5FLMI 2DE5A 2NAPA 3G4S1 1VQL1 1VQK1 2P28A 4EWCA 2EGTA 3CXCY 3EEDA 2JIPA 1KQSY 2JNYA 4Y52I 1X3WA 3M4OI 2WAQA 2Q4ZA 2M6NA 5T6BA 1TWFI 3RZDI 2VPZA 3I55Z 1ML8A 4NBBA 3CMA1 3CC4Z 2R6MA 1QVGY 1AA6A 1RLYA 2HF1A 4HH4A 4A3CI 3CC71 2QA4Z 4X6AI 3CCU1 5A2Qf 1QXFA 5LL6f 3J81f 3NH4A 4NBGA 3ESWA 2QLVB 2V8KA 3CCM1 3EERA 3VMIA 3QWUA 1L1OC 1VQMZ 3CPWY 4QTUA 1M1K1 4A3BI 1K9M1 3CCJ1 1K83I 1VQO1 2DE7A 2K3RA 3I4MI 1USPA 2LEXA 4A3DI 2AKLA 2QRCB 3M3YI 3GTGI 3GTMS 4RVDA 5IT9f 3S2HI 4DQYB 1YUKA 1QF8A 1N8R1 2IZ3A 4BY7I 1KD12 3T4NB 3TDHB 4A3MI 2W04A 3G4SZ 1FDOA 2JUBA 4NBEA 1VQLZ 1VQKZ 3I561 5C4XI 1NP6A 4A3JI 3D9XA 4S1TA 3GKQA 4A3FI 1Q862 1S72Z 2QKDA 2BJOA 1M1K2 3GTMI 2OOYB 1K9M2 3HOXI 1N2FA 3MONA 4A93I 1WIIA 2JIRA 4NBFA 3CMAZ 4E2WA 4XX2A 3S17I 2V3VA 3NH8A 4RS4A 1VQP1 1VLAA 2QREB 1PFTA 1N8R2 5D1OB 3IX0A 2OZKA 1Z02A 2J6AA 2JIQA 3CCUZ 2R92I 3S15I 5T64A 4CL1A 2E2HI 2JIOA 2PMZA 3HOZI 1TWGI 2GU2A 5D1PA 3J80b 3CCMZ 1Q811 1Q821 2O53A 1M902 1K8A1 2LFUA 1I50I 3J81b 4NB8A 1SIWA 4NOZA 4DGLA 1WZNA 3CCJZ 4NBDA 3NFZA 1VQOZ 4E2ZA 5IP9I 3H3VJ 1VQ91 4MD7A 3RZOI 4E32A 2QEXZ 3CC2Z 2RT9A 1S721 3IFUA 3PO3I 3LUSA 3VMGA 3S16I 2NVXI 2RIQA 1VQ71 1VQ8Z 4MD8A 1JWHC 3I56Z 1YITZ 1S7MA 5IT9b 2VF1A 3G6E1 1Q812 1Q822 1Y1WI 1K8A2 4BBRI 1VQN1 3BG0B 1YIJZ 4A3GI 2VPYA 1YJWZ 3GTQI 3CQZI 1K731 3FQMA 3S1RI 1I6HI 4NFRA 1VQPZ 3F3FC 1Z01A 2E2II 3H0GI 1JJ2Y 3HOVI 2VPWA 3VTNA 5FLXb 1RO2A 4MRIA 2OTL1 3GTOI 2OTJ1 2R93I 2QEX1 3CC21 3S2DI 4E31A 3I4NI 1Y1VI 4E2YA 2F4MA 3HOWI 3PO2I 5CM2M 1YJN1 2K5RA 1SFOI 1VQ81 1YIT1 1VQ9Z 3JAMf 1VQ51 4MD9A 1LQLA 3CCVZ 4A3II 2YADA 3CCS1 4A3KI 1W2BZ 2GTHA 4BY1I 1YIJ1 4BXXI 2JA6I 2O4HA 1YJW1 1VQ7Z 4NH1C 2P3YA 4TNUA 3CCRZ 3CCQ1 3G6EZ 1ZH1A 4Y7NI 1VQ41 1VQNZ 4HGZA 2DE6A 3S1NI 4RVGA 2GTIA 4E30A 1ZB9A 5D1OA 1YUAA 1YHQZ 1X3ZA 3PO3S 5C3EI 1WJ2A 5A2Qb 2KI7B 1NJI1 2E2JI 1JJ2Z 2V8IA 1TFIA 2V45A 2AYDA 1P9NA 2VUGA 2RBLA 4A3EI 1YI2Z 2OTLZ 1WCMI 1TWCI 1YJ91 4E33A 2LIYA 2RHBA 3CCV1 2OTJZ 3S1MI 5IP7I 3IF8A 1W2BY 3S14I 1FDIA 3U50C 3G71Z 1VQ6Z 3CMEZ 1YJNZ 2I3CA 4AYBA 3IR7A 1WW9A 3CCR1 3BG1B 2E9HA 1VQ5Z 3K7AI 2V8JA 1RQFA 3OW2Z 3I07A 3GCFA 4MH4A 3J7A4 3MZLB 3NH5A 3CCSZ 1NJI2 1RO4A 3GTKI 3D2LA 2B63I 2M48A 1Z03A 4QTTA 4DK1A 3JAMb 1R9TI 1YHQ1 1Y8CA 3VMHA 3CCE1 1QVFY 3NDJA 1Y1VS 2R7ZI 3KIHA 2QRDB 3CCQZ 2NVYI 3CD61 1VQ4Z 3F3PC 3VB9A 3GTPI 3D6WA 3J80f 2JA8I 2PM9A 4NB9A 1ZB8A 2Y0SA 1KD11 1YI21 2JS4A 1DL6A 1QYPA 4NBAA 2G2KA 1RNIA 3TE5B 3GTLI 1Q861 1NUIA 2JA5I 2ZAEB 3G711 3S1QI 3CCLZ 1VQ61 4RVHA
chains in the Genus database with same CATH topology
3CME1 1USPB 2JMOA 5AN9F 1KRLA 1K732 2NVQI 3Q87A 3FQQA 3FKII 4E2XA 2OOXB 1YJ9Z 1Q7Y1 3OW2Y 3GTJI 5C44I 2PK7A 2H85A 4MONA 2VUMI 1I3QI 3KIFA 3I551 1KC81 1X0TA 4RV9A 2QR1B 3CC41 2W03A 3CXCZ 1KQSZ 4HGYA 2Q51A 5C4JI 2QA41 4NBHA 1M901 1RO0A 3CCEZ 1QVFZ 2YU9I 1Q7Y2 2KPIA 4MXUA 3CD6Z 5T67A 2WB1A 5FLXf 1QVGZ 3HOUI 2RPRA 2JA7I 1TWAI 3CCL1 3CC7Z 1VQM1 1KC82 2JR6A 4BBSI 2IZ4A 3NDIA 1TWHI 2NVTI 3MZKB 4RVFA 3HKZA 2HU9A 4A3LI 2F4OA 3HOYI 3CPWZ 3P5JB 4NBCA 5FLMI 2DE5A 3G4S1 1VQL1 1VQK1 2P28A 4EWCA 2EGTA 3CXCY 3EEDA 1KQSY 2JNYA 4Y52I 1X3WA 3M4OI 2WAQA 2Q4ZA 2M6NA 5T6BA 1TWFI 3RZDI 3I55Z 1ML8A 4NBBA 3CMA1 3CC4Z 2R6MA 1QVGY 1RLYA 2HF1A 4HH4A 4A3CI 3CC71 2QA4Z 4X6AI 3CCU1 5A2Qf 5LL6f 3J81f 3NH4A 4NBGA 3ESWA 2QLVB 2V8KA 3CCM1 3EERA 3VMIA 3QWUA 1L1OC 1VQMZ 3CPWY 4QTUA 1M1K1 4A3BI 1K9M1 3CCJ1 1K83I 1VQO1 2DE7A 2K3RA 3I4MI 1USPA 4A3DI 2AKLA 2QRCB 3M3YI 3GTGI 3GTMS 4RVDA 5IT9f 3S2HI 4DQYB 1YUKA 1QF8A 1N8R1 2IZ3A 4BY7I 1KD12 3T4NB 3TDHB 4A3MI 2W04A 3G4SZ 2JUBA 4NBEA 1VQLZ 1VQKZ 3I561 5C4XI 1NP6A 4A3JI 3D9XA 4S1TA 3GKQA 4A3FI 1Q862 1S72Z 2QKDA 2BJOA 1M1K2 3GTMI 2OOYB 1K9M2 3HOXI 1N2FA 3MONA 4A93I 1WIIA 4NBFA 3CMAZ 4E2WA 4XX2A 3S17I 3NH8A 4RS4A 1VQP1 1VLAA 2QREB 1PFTA 1N8R2 5D1OB 3IX0A 2OZKA 1Z02A 2J6AA 3CCUZ 2R92I 3S15I 5T64A 4CL1A 2E2HI 2PMZA 3HOZI 1TWGI 2GU2A 5D1PA 3J80b 3CCMZ 1Q811 1Q821 2O53A 1M902 1K8A1 2LFUA 1I50I 3J81b 4NB8A 4NOZA 4DGLA 3CCJZ 4NBDA 3NFZA 1VQOZ 4E2ZA 5IP9I 3H3VJ 1VQ91 4MD7A 3RZOI 4E32A 2QEXZ 3CC2Z 2RT9A 1S721 3IFUA 3PO3I 3LUSA 3VMGA 3S16I 2NVXI 2RIQA 1VQ71 1VQ8Z 4MD8A 1JWHC 3I56Z 1YITZ 1S7MA 5IT9b 2VF1A 3G6E1 1Q812 1Q822 1Y1WI 1K8A2 4BBRI 1VQN1 3BG0B 1YIJZ 4A3GI 1YJWZ 3GTQI 3CQZI 1K731 3FQMA 3S1RI 1I6HI 4NFRA 1VQPZ 3F3FC 1Z01A 2E2II 3H0GI 1JJ2Y 3HOVI 3VTNA 5FLXb 1RO2A 4MRIA 2OTL1 3GTOI 2OTJ1 2R93I 2QEX1 3CC21 3S2DI 4E31A 3I4NI 1Y1VI 4E2YA 2F4MA 3HOWI 3PO2I 5CM2M 1YJN1 2K5RA 1SFOI 1VQ81 1YIT1 1VQ9Z 3JAMf 1VQ51 4MD9A 1LQLA 3CCVZ 4A3II 2YADA 3CCS1 4A3KI 1W2BZ 2GTHA 4BY1I 1YIJ1 4BXXI 2JA6I 2O4HA 1YJW1 1VQ7Z 4NH1C 2P3YA 4TNUA 3CCRZ 3CCQ1 3G6EZ 1ZH1A 4Y7NI 1VQ41 1VQNZ 4HGZA 2DE6A 3S1NI 4RVGA 2GTIA 4E30A 1ZB9A 5D1OA 1YUAA 1YHQZ 1X3ZA 3PO3S 5C3EI 5A2Qb 2KI7B 1NJI1 2E2JI 1JJ2Z 2V8IA 1TFIA 1P9NA 2VUGA 2RBLA 4A3EI 1YI2Z 2OTLZ 1WCMI 1TWCI 1YJ91 4E33A 2LIYA 2RHBA 3CCV1 2OTJZ 3S1MI 5IP7I 3IF8A 1W2BY 3S14I 3U50C 3G71Z 1VQ6Z 3CMEZ 1YJNZ 2I3CA 4AYBA 1WW9A 3CCR1 3BG1B 2E9HA 1VQ5Z 3K7AI 2V8JA 1RQFA 3OW2Z 3I07A 3GCFA 4MH4A 3J7A4 3MZLB 3NH5A 3CCSZ 1NJI2 1RO4A 3GTKI 2B63I 2M48A 1Z03A 4QTTA 4DK1A 3JAMb 1R9TI 1YHQ1 3VMHA 3CCE1 1QVFY 3NDJA 1Y1VS 2R7ZI 3KIHA 2QRDB 3CCQZ 2NVYI 3CD61 1VQ4Z 3F3PC 3VB9A 3GTPI 3D6WA 3J80f 2JA8I 2PM9A 4NB9A 1ZB8A 2Y0SA 1KD11 1YI21 2JS4A 1DL6A 1QYPA 4NBAA 2G2KA 1RNIA 3TE5B 3GTLI 1Q861 1NUIA 2JA5I 2ZAEB 3G711 3S1QI 3CCLZ 1VQ61 4RVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG Y;  3CME 1;  1VQ4 1;  3CCJ Z;  1K73 2;  1VQO Z;  1VQN Z;  1VQ9 1;  1YJ9 Z;  3CC7 1;  2QA4 Z;  3CCU 1;  1Q7Y 1;  3OW2 Y;  2QEX Z;  3CC2 Z;  1S72 1;  1YHQ Z;  3CCM 1;  1VQ7 1;  1VQ8 Z;  3I55 1;  1KC8 1;  3I56 Z;  1YIT Z;  1NJI 1;  1JJ2 Z;  3CC4 1;  1VQM Z;  3CPW Y;  1M1K 1;  3G6E 1;  3CXC Z;  1Q81 2;  1Q82 2;  1K9M 1;  1KQS Z;  3CCJ 1;  1K8A 2;  1VQO 1;  1YI2 Z;  2OTL Z;  1VQN 1;  1YJ9 1;  3CCV 1;  2QA4 1;  1YIJ Z;  2OTJ Z;  1M90 1;  1YJW Z;  3CCE Z;  1QVF Z;  1W2B Y;  1Q7Y 2;  1K73 1;  3CD6 Z;  1N8R 1;  3G71 Z;  1QVG Z;  1VQ6 Z;  1KD1 2;  3CME Z;  1YJN Z;  1VQP Z;  3G4S Z;  1VQL Z;  1VQK Z;  3I56 1;  3CCR 1;  1VQ5 Z;  3CCL 1;  3CC7 Z;  1JJ2 Y;  3OW2 Z;  1VQM 1;  1KC8 2;  1Q86 2;  1S72 Z;  3CCS Z;  1NJI 2;  1M1K 2;  2OTL 1;  1K9M 2;  2OTJ 1;  2QEX 1;  3CC2 1;  1YHQ 1;  3CCE 1;  1QVF Y;  3CMA Z;  3CPW Z;  3CCQ Z;  3CD6 1;  1YJN 1;  1VQP 1;  1VQ4 Z;  1VQ8 1;  3G4S 1;  1N8R 2;  1VQL 1;  1VQK 1;  1YIT 1;  1VQ9 Z;  1VQ5 1;  3CCV Z;  3CCU Z;  3CXC Y;  1KQS Y;  3CCS 1;  1W2B Z;  1KD1 1;  1YI2 1;  1YIJ 1;  3CCM Z;  1YJW 1;  1VQ7 Z;  3I55 Z;  1Q81 1;  1Q82 1;  1M90 2;  1Q86 1;  1K8A 1;  3CCR Z;  3CMA 1;  1VQ6 1;  3CC4 Z;  3G71 1;  3CCQ 1;  3CCL Z;  3G6E Z; 
#chains in the Genus database with same CATH topology
 3CME 1;  1USP B;  2JMO A;  5AN9 F;  1KRL A;  1K73 2;  2NVQ I;  3Q87 A;  2JIM A;  3FQQ A;  3FKI I;  4E2X A;  2OOX B;  1YJ9 Z;  1Q7Y 1;  3OW2 Y;  3GTJ I;  5C44 I;  2PK7 A;  2H85 A;  4MON A;  2VUM I;  1I3Q I;  3KIF A;  3I55 1;  1KC8 1;  1X0T A;  4RV9 A;  2QR1 B;  3CC4 1;  2W03 A;  3CXC Z;  1KQS Z;  4HGY A;  2Q51 A;  5C4J I;  2QA4 1;  4NBH A;  2IV2 X;  1M90 1;  1RO0 A;  3CCE Z;  1QVF Z;  2YU9 I;  1Q7Y 2;  2KPI A;  4MXU A;  3CD6 Z;  1Q16 A;  5T67 A;  2WB1 A;  5FLX f;  1QVG Z;  3HOU I;  2RPR A;  2JA7 I;  1TWA I;  3CCL 1;  3CC7 Z;  1VQM 1;  1KC8 2;  2JR6 A;  2E7Z A;  4BBS I;  2IZ4 A;  3NDI A;  1TWH I;  2NVT I;  2VPX A;  3MZK B;  4RVF A;  3HKZ A;  2HU9 A;  4A3L I;  2F4O A;  3HOY I;  3CPW Z;  3P5J B;  4NBC A;  5FLM I;  2DE5 A;  2NAP A;  3G4S 1;  1VQL 1;  1VQK 1;  2P28 A;  4EWC A;  2EGT A;  3CXC Y;  3EED A;  2JIP A;  1KQS Y;  2JNY A;  4Y52 I;  1X3W A;  3M4O I;  2WAQ A;  2Q4Z A;  2M6N A;  5T6B A;  1TWF I;  3RZD I;  2VPZ A;  3I55 Z;  1ML8 A;  4NBB A;  3CMA 1;  3CC4 Z;  2R6M A;  1QVG Y;  1AA6 A;  1RLY A;  2HF1 A;  4HH4 A;  4A3C I;  3CC7 1;  2QA4 Z;  4X6A I;  3CCU 1;  5A2Q f;  1QXF A;  5LL6 f;  3J81 f;  3NH4 A;  4NBG A;  3ESW A;  2QLV B;  2V8K A;  3CCM 1;  3EER A;  3VMI A;  3QWU A;  1L1O C;  1VQM Z;  3CPW Y;  4QTU A;  1M1K 1;  4A3B I;  1K9M 1;  3CCJ 1;  1K83 I;  1VQO 1;  2DE7 A;  2K3R A;  3I4M I;  1USP A;  2LEX A;  4A3D I;  2AKL A;  2QRC B;  3M3Y I;  3GTG I;  3GTM S;  4RVD A;  5IT9 f;  3S2H I;  4DQY B;  1YUK A;  1QF8 A;  1N8R 1;  2IZ3 A;  4BY7 I;  1KD1 2;  3T4N B;  3TDH B;  4A3M I;  2W04 A;  3G4S Z;  1FDO A;  2JUB A;  4NBE A;  1VQL Z;  1VQK Z;  3I56 1;  5C4X I;  1NP6 A;  4A3J I;  3D9X A;  4S1T A;  3GKQ A;  4A3F I;  1Q86 2;  1S72 Z;  2QKD A;  2BJO A;  1M1K 2;  3GTM I;  2OOY B;  1K9M 2;  3HOX I;  1N2F A;  3MON A;  4A93 I;  1WII A;  2JIR A;  4NBF A;  3CMA Z;  4E2W A;  4XX2 A;  3S17 I;  2V3V A;  3NH8 A;  4RS4 A;  1VQP 1;  1VLA A;  2QRE B;  1PFT A;  1N8R 2;  5D1O B;  3IX0 A;  2OZK A;  1Z02 A;  2J6A A;  2JIQ A;  3CCU Z;  2R92 I;  3S15 I;  5T64 A;  4CL1 A;  2E2H I;  2JIO A;  2PMZ A;  3HOZ I;  1TWG I;  2GU2 A;  5D1P A;  3J80 b;  3CCM Z;  1Q81 1;  1Q82 1;  2O53 A;  1M90 2;  1K8A 1;  2LFU A;  1I50 I;  3J81 b;  4NB8 A;  1SIW A;  4NOZ A;  4DGL A;  1WZN A;  3CCJ Z;  4NBD A;  3NFZ A;  1VQO Z;  4E2Z A;  5IP9 I;  3H3V J;  1VQ9 1;  4MD7 A;  3RZO I;  4E32 A;  2QEX Z;  3CC2 Z;  2RT9 A;  1S72 1;  3IFU A;  3PO3 I;  3LUS A;  3VMG A;  3S16 I;  2NVX I;  2RIQ A;  1VQ7 1;  1VQ8 Z;  4MD8 A;  1JWH C;  3I56 Z;  1YIT Z;  1S7M A;  5IT9 b;  2VF1 A;  3G6E 1;  1Q81 2;  1Q82 2;  1Y1W I;  1K8A 2;  4BBR I;  1VQN 1;  3BG0 B;  1YIJ Z;  4A3G I;  2VPY A;  1YJW Z;  3GTQ I;  3CQZ I;  1K73 1;  3FQM A;  3S1R I;  1I6H I;  4NFR A;  1VQP Z;  3F3F C;  1Z01 A;  2E2I I;  3H0G I;  1JJ2 Y;  3HOV I;  2VPW A;  3VTN A;  5FLX b;  1RO2 A;  4MRI A;  2OTL 1;  3GTO I;  2OTJ 1;  2R93 I;  2QEX 1;  3CC2 1;  3S2D I;  4E31 A;  3I4N I;  1Y1V I;  4E2Y A;  2F4M A;  3HOW I;  3PO2 I;  5CM2 M;  1YJN 1;  2K5R A;  1SFO I;  1VQ8 1;  1YIT 1;  1VQ9 Z;  3JAM f;  1VQ5 1;  4MD9 A;  1LQL A;  3CCV Z;  4A3I I;  2YAD A;  3CCS 1;  4A3K I;  1W2B Z;  2GTH A;  4BY1 I;  1YIJ 1;  4BXX I;  2JA6 I;  2O4H A;  1YJW 1;  1VQ7 Z;  4NH1 C;  2P3Y A;  4TNU A;  3CCR Z;  3CCQ 1;  3G6E Z;  1ZH1 A;  4Y7N I;  1VQ4 1;  1VQN Z;  4HGZ A;  2DE6 A;  3S1N I;  4RVG A;  2GTI A;  4E30 A;  1ZB9 A;  5D1O A;  1YUA A;  1YHQ Z;  1X3Z A;  3PO3 S;  5C3E I;  1WJ2 A;  5A2Q b;  2KI7 B;  1NJI 1;  2E2J I;  1JJ2 Z;  2V8I A;  1TFI A;  2V45 A;  2AYD A;  1P9N A;  2VUG A;  2RBL A;  4A3E I;  1YI2 Z;  2OTL Z;  1WCM I;  1TWC I;  1YJ9 1;  4E33 A;  2LIY A;  2RHB A;  3CCV 1;  2OTJ Z;  3S1M I;  5IP7 I;  3IF8 A;  1W2B Y;  3S14 I;  1FDI A;  3U50 C;  3G71 Z;  1VQ6 Z;  3CME Z;  1YJN Z;  2I3C A;  4AYB A;  3IR7 A;  1WW9 A;  3CCR 1;  3BG1 B;  2E9H A;  1VQ5 Z;  3K7A I;  2V8J A;  1RQF A;  3OW2 Z;  3I07 A;  3GCF A;  4MH4 A;  3J7A 4;  3MZL B;  3NH5 A;  3CCS Z;  1NJI 2;  1RO4 A;  3GTK I;  3D2L A;  2B63 I;  2M48 A;  1Z03 A;  4QTT A;  4DK1 A;  3JAM b;  1R9T I;  1YHQ 1;  1Y8C A;  3VMH A;  3CCE 1;  1QVF Y;  3NDJ A;  1Y1V S;  2R7Z I;  3KIH A;  2QRD B;  3CCQ Z;  2NVY I;  3CD6 1;  1VQ4 Z;  3F3P C;  3VB9 A;  3GTP I;  3D6W A;  3J80 f;  2JA8 I;  2PM9 A;  4NB9 A;  1ZB8 A;  2Y0S A;  1KD1 1;  1YI2 1;  2JS4 A;  1DL6 A;  1QYP A;  4NBA A;  2G2K A;  1RNI A;  3TE5 B;  3GTL I;  1Q86 1;  1NUI A;  2JA5 I;  2ZAE B;  3G71 1;  3S1Q I;  3CCL Z;  1VQ6 1;  4RVH A; 
#chains in the Genus database with same CATH homology
 3CME 1;  1USP B;  2JMO A;  5AN9 F;  1KRL A;  1K73 2;  2NVQ I;  3Q87 A;  3FQQ A;  3FKI I;  4E2X A;  2OOX B;  1YJ9 Z;  1Q7Y 1;  3OW2 Y;  3GTJ I;  5C44 I;  2PK7 A;  2H85 A;  4MON A;  2VUM I;  1I3Q I;  3KIF A;  3I55 1;  1KC8 1;  1X0T A;  4RV9 A;  2QR1 B;  3CC4 1;  2W03 A;  3CXC Z;  1KQS Z;  4HGY A;  2Q51 A;  5C4J I;  2QA4 1;  4NBH A;  1M90 1;  1RO0 A;  3CCE Z;  1QVF Z;  2YU9 I;  1Q7Y 2;  2KPI A;  4MXU A;  3CD6 Z;  5T67 A;  2WB1 A;  5FLX f;  1QVG Z;  3HOU I;  2RPR A;  2JA7 I;  1TWA I;  3CCL 1;  3CC7 Z;  1VQM 1;  1KC8 2;  2JR6 A;  4BBS I;  2IZ4 A;  3NDI A;  1TWH I;  2NVT I;  3MZK B;  4RVF A;  3HKZ A;  2HU9 A;  4A3L I;  2F4O A;  3HOY I;  3CPW Z;  3P5J B;  4NBC A;  5FLM I;  2DE5 A;  3G4S 1;  1VQL 1;  1VQK 1;  2P28 A;  4EWC A;  2EGT A;  3CXC Y;  3EED A;  1KQS Y;  2JNY A;  4Y52 I;  1X3W A;  3M4O I;  2WAQ A;  2Q4Z A;  2M6N A;  5T6B A;  1TWF I;  3RZD I;  3I55 Z;  1ML8 A;  4NBB A;  3CMA 1;  3CC4 Z;  2R6M A;  1QVG Y;  1RLY A;  2HF1 A;  4HH4 A;  4A3C I;  3CC7 1;  2QA4 Z;  4X6A I;  3CCU 1;  5A2Q f;  5LL6 f;  3J81 f;  3NH4 A;  4NBG A;  3ESW A;  2QLV B;  2V8K A;  3CCM 1;  3EER A;  3VMI A;  3QWU A;  1L1O C;  1VQM Z;  3CPW Y;  4QTU A;  1M1K 1;  4A3B I;  1K9M 1;  3CCJ 1;  1K83 I;  1VQO 1;  2DE7 A;  2K3R A;  3I4M I;  1USP A;  4A3D I;  2AKL A;  2QRC B;  3M3Y I;  3GTG I;  3GTM S;  4RVD A;  5IT9 f;  3S2H I;  4DQY B;  1YUK A;  1QF8 A;  1N8R 1;  2IZ3 A;  4BY7 I;  1KD1 2;  3T4N B;  3TDH B;  4A3M I;  2W04 A;  3G4S Z;  2JUB A;  4NBE A;  1VQL Z;  1VQK Z;  3I56 1;  5C4X I;  1NP6 A;  4A3J I;  3D9X A;  4S1T A;  3GKQ A;  4A3F I;  1Q86 2;  1S72 Z;  2QKD A;  2BJO A;  1M1K 2;  3GTM I;  2OOY B;  1K9M 2;  3HOX I;  1N2F A;  3MON A;  4A93 I;  1WII A;  4NBF A;  3CMA Z;  4E2W A;  4XX2 A;  3S17 I;  3NH8 A;  4RS4 A;  1VQP 1;  1VLA A;  2QRE B;  1PFT A;  1N8R 2;  5D1O B;  3IX0 A;  2OZK A;  1Z02 A;  2J6A A;  3CCU Z;  2R92 I;  3S15 I;  5T64 A;  4CL1 A;  2E2H I;  2PMZ A;  3HOZ I;  1TWG I;  2GU2 A;  5D1P A;  3J80 b;  3CCM Z;  1Q81 1;  1Q82 1;  2O53 A;  1M90 2;  1K8A 1;  2LFU A;  1I50 I;  3J81 b;  4NB8 A;  4NOZ A;  4DGL A;  3CCJ Z;  4NBD A;  3NFZ A;  1VQO Z;  4E2Z A;  5IP9 I;  3H3V J;  1VQ9 1;  4MD7 A;  3RZO I;  4E32 A;  2QEX Z;  3CC2 Z;  2RT9 A;  1S72 1;  3IFU A;  3PO3 I;  3LUS A;  3VMG A;  3S16 I;  2NVX I;  2RIQ A;  1VQ7 1;  1VQ8 Z;  4MD8 A;  1JWH C;  3I56 Z;  1YIT Z;  1S7M A;  5IT9 b;  2VF1 A;  3G6E 1;  1Q81 2;  1Q82 2;  1Y1W I;  1K8A 2;  4BBR I;  1VQN 1;  3BG0 B;  1YIJ Z;  4A3G I;  1YJW Z;  3GTQ I;  3CQZ I;  1K73 1;  3FQM A;  3S1R I;  1I6H I;  4NFR A;  1VQP Z;  3F3F C;  1Z01 A;  2E2I I;  3H0G I;  1JJ2 Y;  3HOV I;  3VTN A;  5FLX b;  1RO2 A;  4MRI A;  2OTL 1;  3GTO I;  2OTJ 1;  2R93 I;  2QEX 1;  3CC2 1;  3S2D I;  4E31 A;  3I4N I;  1Y1V I;  4E2Y A;  2F4M A;  3HOW I;  3PO2 I;  5CM2 M;  1YJN 1;  2K5R A;  1SFO I;  1VQ8 1;  1YIT 1;  1VQ9 Z;  3JAM f;  1VQ5 1;  4MD9 A;  1LQL A;  3CCV Z;  4A3I I;  2YAD A;  3CCS 1;  4A3K I;  1W2B Z;  2GTH A;  4BY1 I;  1YIJ 1;  4BXX I;  2JA6 I;  2O4H A;  1YJW 1;  1VQ7 Z;  4NH1 C;  2P3Y A;  4TNU A;  3CCR Z;  3CCQ 1;  3G6E Z;  1ZH1 A;  4Y7N I;  1VQ4 1;  1VQN Z;  4HGZ A;  2DE6 A;  3S1N I;  4RVG A;  2GTI A;  4E30 A;  1ZB9 A;  5D1O A;  1YUA A;  1YHQ Z;  1X3Z A;  3PO3 S;  5C3E I;  5A2Q b;  2KI7 B;  1NJI 1;  2E2J I;  1JJ2 Z;  2V8I A;  1TFI A;  1P9N A;  2VUG A;  2RBL A;  4A3E I;  1YI2 Z;  2OTL Z;  1WCM I;  1TWC I;  1YJ9 1;  4E33 A;  2LIY A;  2RHB A;  3CCV 1;  2OTJ Z;  3S1M I;  5IP7 I;  3IF8 A;  1W2B Y;  3S14 I;  3U50 C;  3G71 Z;  1VQ6 Z;  3CME Z;  1YJN Z;  2I3C A;  4AYB A;  1WW9 A;  3CCR 1;  3BG1 B;  2E9H A;  1VQ5 Z;  3K7A I;  2V8J A;  1RQF A;  3OW2 Z;  3I07 A;  3GCF A;  4MH4 A;  3J7A 4;  3MZL B;  3NH5 A;  3CCS Z;  1NJI 2;  1RO4 A;  3GTK I;  2B63 I;  2M48 A;  1Z03 A;  4QTT A;  4DK1 A;  3JAM b;  1R9T I;  1YHQ 1;  3VMH A;  3CCE 1;  1QVF Y;  3NDJ A;  1Y1V S;  2R7Z I;  3KIH A;  2QRD B;  3CCQ Z;  2NVY I;  3CD6 1;  1VQ4 Z;  3F3P C;  3VB9 A;  3GTP I;  3D6W A;  3J80 f;  2JA8 I;  2PM9 A;  4NB9 A;  1ZB8 A;  2Y0S A;  1KD1 1;  1YI2 1;  2JS4 A;  1DL6 A;  1QYP A;  4NBA A;  2G2K A;  1RNI A;  3TE5 B;  3GTL I;  1Q86 1;  1NUI A;  2JA5 I;  2ZAE B;  3G71 1;  3S1Q I;  3CCL Z;  1VQ6 1;  4RVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...