3OW2Y

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ow2Y00
1VQ4Z 1VQ9Z 1N8R1 1VQ51 3CCV1 1K732 1M1K2 1YHQZ 1Q821 1K9M2 1M901 1YIJ1 3CPWY 1Q822 1K9M1 1W2BZ 1M902 1VQ5Z 3OW2Z 1KC81 1S72Z 3CCR1 1VQ7Z 3CXCY 2OTJZ 3CCJ1 1VQL1 1YHQ1 3G4S1 2OTL1 1VQPZ 3CMA1 1QVFY 3CD61 3I55Z 1VQ8Z 3CCSZ 3CCQZ 1YJ9Z 1KC82 3CCU1 1YJWZ 1YJ91 1KD12 2QA4Z 3CCS1 1YITZ 1KD11 3CC4Z 3G4SZ 1VQNZ 3CCJZ 2OTJ1 2QEXZ 3OW2Y 1VQKZ 3G6EZ 1Q861 1W2BY 1YJW1 3CCUZ 3I56Z 1Q862 1VQM1 1VQOZ 1YI21 1VQ61 3CCVZ 1VQ91 1QVFZ 1VQP1 3CCL1 3G71Z 1YI2Z 1VQ6Z 1S721 3CXCZ 1VQO1 3G711 1M1K1 1KQSY 1VQMZ 3CCLZ 3CMEZ 1Q811 3CC71 1YIJZ 3CPWZ 3CCMZ 1VQK1 1Q7Y2 3I561 1NJI1 1VQ41 3G6E1 1QVGY 3CC41 2QEX1 1QVGZ 1VQN1 1K8A2 1JJ2Z 1YJN1 1K8A1 3CCQ1 3CC21 1YIT1 3CCE1 3CCEZ 1K731 1VQ81 3CCM1 1N8R2 3CC2Z 2QA41 3CC7Z 1YJNZ 3CME1 3CMAZ 1KQSZ 1Q7Y1 1JJ2Y 1NJI2 2OTLZ 1VQLZ 3CCRZ 3I551 1VQ71 3CD6Z 1Q812
chains in the Genus database with same CATH superfamily
3EEDA 1VQ4Z 1N8R1 3VB9A 1VQ51 3PO3S 4Y52I 2HF1A 1RO2A 1Q821 4NBFA 1Z02A 2G2KA 1Q822 2R92I 2QR1B 4RVGA 2EGTA 3JAMf 3LUSA 3HOZI 2Q51A 1KC81 2JIPA 1ZB8A 4RS4A 3CXCY 2OTJZ 2BJOA 3G4S1 1VQPZ 2AKLA 3Q87A 4EWCA 5C44I 5FLXf 3CD61 3I55Z 3HOVI 4A3DI 3QWUA 4E32A 2VPYA 2LEXA 1N2FA 3VMGA 4QTTA 2V8IA 3CCS1 1KD11 2F4MA 3MZLB 1WIIA 5T64A 3CCJZ 5C3EI 3G6EZ 2QREB 1YJW1 4X6AI 1Q862 1VQM1 1SFOI 3S16I 3D6WA 1QXFA 1NUIA 1YI21 2OZKA 4MXUA 1VQ61 4MD7A 3CCVZ 4A3GI 1LQLA 3GTQI 2JA6I 3GKQA 3F3PC 3CXCZ 5AN9F 1VQMZ 2V3VA 3CCLZ 1TWCI 3GTMS 4DK1A 5CM2M 1TWFI 3CMEZ 3ESWA 2JA8I 2E9HA 1S7MA 3J7A4 4NBEA 2M6NA 1Y8CA 4A3EI 4CL1A 1K8A2 2YU9I 2NVXI 3U50C 1PFTA 4BY7I 3CCM1 1N8R2 2QA41 2QLVB 1WJ2A 2KI7B 3BG0B 3S1QI 4NBHA 1NJI2 3PO2I 2NAPA 1VQLZ 3NH4A 5FLXb 3J80b 3M4OI 4MD8A 5C4XI 1KRLA 1K732 1YHQZ 2PMZA 3GTPI 1I6HI 1K9M2 4E33A 2JIQA 2YADA 1M902 1W2BZ 1VQ5Z 2RBLA 2V45A 3OW2Z 1S72Z 4NBAA 3CCR1 1ML8A 1VQL1 3NDIA 2LIYA 3D9XA 1DL6A 3I07A 1QVFY 2PK7A 2P28A 3CCU1 2VPXA 1YJWZ 1YJ91 1KD12 4NH1C 1YITZ 3J81b 2M48A 3GCFA 5IP7I 1WW9A 2VF1A 2GTHA 2QEXZ 1Q16A 3GTGI 4NBBA 2OOXB 3I56Z 1SIWA 1USPB 1VQ91 1VQP1 1AA6A 5IT9f 1YI2Z 1VQ6Z 2QRDB 3K7AI 2E2JI 1R9TI 2DE7A 3G711 2I3CA 4A3MI 2JA5I 1Y1VS 1X3WA 3CC71 2E2II 2J6AA 1VQK1 4MRIA 4NOZA 1Q7Y2 3H0GI 1FDIA 2DE5A 2V8JA 4E2ZA 1VQ41 3S1MI 3MONA 2K3RA 1QF8A 1QVGY 3J80f 4BY1I 4HGYA 3BG1B 3JAMb 1QVGZ 1VQN1 2PM9A 3H3VJ 3IF8A 1YJN1 1JWHC 2GU2A 2VPWA 5FLMI 3M3YI 4TNUA 3S15I 3CCEZ 3CC2Z 2JIOA 3GTOI 3VTNA 1WZNA 2O53A 4A3JI 5A2Qf 1VQ71 4A3FI 1Q812 1Z03A 2R7ZI 1VQ9Z 1RLYA 3KIFA 5T6BA 2NVQI 3CQZI 3HOXI 1M1K2 3HKZA 4NBGA 1YIJ1 2RHBA 3CPWY 1RQFA 4NB8A 1QYPA 4AYBA 4NBDA 4E2WA 3FQMA 1TWGI 2JUBA 5D1OA 2OTL1 3IR7A 3RZOI 2W03A 3CMA1 1WCMI 1VQ8Z 2Y0SA 3CCQZ 1YJ9Z 1KC82 2R93I 3S1RI 4E30A 3TE5B 3CC4Z 2IZ3A 4A3KI 5IT9b 2W04A 3VMHA 1VQNZ 3IFUA 1FDOA 3VMIA 1Q861 1W2BY 3HOYI 3EERA 4BBSI 2DE6A 5D1PA 1K83I 1L1OC 1X3ZA 4HH4A 4A93I 3S1NI 3NH5A 3G71Z 2VUGA 1VQO1 2IZ4A 4S1TA 2VPZA 1YIJZ 3CCMZ 2RIQA 4MONA 4XX2A 3I561 2KPIA 1NJI1 5A2Qb 5D1OB 3G6E1 2OOYB 3HOUI 3GTKI 3KIHA 2QEX1 3NH8A 2JA7I 4RVFA 4MH4A 2JIMA 3S17I 1JJ2Z 1I50I 4HGZA 1K8A1 3CCQ1 5T67A 2Q4ZA 1YIT1 1VQ81 3S2HI 4MD9A 3CC7Z 1YJNZ 1TFIA 2JNYA 1JJ2Y 2OTLZ 2AYDA 3S14I 4QTUA 3I551 3GTMI 3CD6Z 4Y7NI 2F4OA 1RO0A 5LL6f 3CCV1 2R6MA 2JR6A 1M901 3D2LA 1VLAA 2VUMI 1K9M1 2NVYI 3RZDI 1Z01A 2WAQA 3FQQA 4E31A 2IV2X 4A3LI 3NFZA 1ZH1A 1VQ7Z 1YUAA 3CCJ1 1YHQ1 2E2HI 4A3II 2E7ZA 5IP9I 2LFUA 1USPA 2GTIA 3P5JB 2QKDA 4BXXI 3CCSZ 3PO3I 2O4HA 3IX0A 4RVDA 2P3YA 1P9NA 2QA4Z 2ZAEB 4NB9A 2HU9A 2K5RA 1TWHI 3NDJA 3FKII 1I3QI 4A3BI 1RO4A 3G4SZ 2OTJ1 3TDHB 4A3CI 3OW2Y 1VQKZ 1X0TA 3HOWI 4RV9A 3CCUZ 1Y1VI 2RT9A 1VQOZ 2NVTI 5C4JI 4DGLA 3GTLI 2JMOA 1QVFZ 3CCL1 3T4NB 2QRCB 1Y1WI 1S721 2JS4A 1M1K1 1KQSY 4DQYB 2H85A 3J81f 1Q811 1ZB9A 4E2XA 3CPWZ 4E2YA 2RPRA 3GTJI 2WB1A 3S2DI 2V8KA 3CC41 4RVHA 4BBRI 1NP6A 1TWAI 3I4MI 4NFRA 2JIRA 3CC21 3CCE1 1K731 3F3FC 3CME1 3CMAZ 3I4NI 1KQSZ 1YUKA 1Q7Y1 2B63I 4NBCA 3CCRZ 3MZKB 1RNIA
chains in the Genus database with same CATH topology
3EEDA 1VQ4Z 1N8R1 3VB9A 1VQ51 3PO3S 4Y52I 2HF1A 1RO2A 1Q821 4NBFA 1Z02A 2G2KA 1Q822 2R92I 2QR1B 4RVGA 2EGTA 3JAMf 3LUSA 3HOZI 2Q51A 1KC81 1ZB8A 4RS4A 3CXCY 2OTJZ 2BJOA 3G4S1 1VQPZ 2AKLA 3Q87A 4EWCA 5C44I 5FLXf 3CD61 3I55Z 3HOVI 4A3DI 3QWUA 4E32A 1N2FA 3VMGA 4QTTA 2V8IA 3CCS1 1KD11 2F4MA 3MZLB 1WIIA 5T64A 3CCJZ 5C3EI 3G6EZ 2QREB 1YJW1 4X6AI 1Q862 1VQM1 1SFOI 3S16I 1YI21 3D6WA 1NUIA 1VQ61 2OZKA 4MXUA 4MD7A 3CCVZ 4A3GI 1LQLA 3GTQI 2JA6I 3GKQA 3F3PC 3CXCZ 5AN9F 1VQMZ 3CCLZ 3GTMS 1TWCI 4DK1A 5CM2M 1TWFI 3CMEZ 3ESWA 2JA8I 2E9HA 1S7MA 3J7A4 4NBEA 2M6NA 4A3EI 4CL1A 1K8A2 2YU9I 2NVXI 3U50C 1PFTA 4BY7I 3CCM1 1N8R2 2QA41 2QLVB 2KI7B 3BG0B 3S1QI 4NBHA 1NJI2 3PO2I 1VQLZ 3NH4A 5FLXb 3J80b 3M4OI 4MD8A 5C4XI 1KRLA 1K732 1YHQZ 2PMZA 3GTPI 1I6HI 1K9M2 4E33A 2YADA 1M902 1W2BZ 1VQ5Z 2RBLA 3OW2Z 1S72Z 4NBAA 3CCR1 1ML8A 1VQL1 3NDIA 2LIYA 3D9XA 1DL6A 3I07A 1QVFY 2PK7A 2P28A 3CCU1 1YJWZ 1YJ91 1KD12 4NH1C 1YITZ 3J81b 2M48A 3GCFA 5IP7I 1WW9A 2VF1A 2GTHA 2QEXZ 3GTGI 4NBBA 2OOXB 3I56Z 1USPB 1VQ91 1VQP1 5IT9f 1YI2Z 1VQ6Z 2QRDB 3K7AI 2E2JI 1R9TI 2DE7A 3G711 2I3CA 4A3MI 2JA5I 1Y1VS 1X3WA 3CC71 2E2II 2J6AA 1VQK1 4MRIA 4NOZA 1Q7Y2 3H0GI 4E2ZA 2DE5A 2V8JA 1VQ41 3S1MI 3MONA 2K3RA 1QF8A 1QVGY 3J80f 4BY1I 4HGYA 3BG1B 3JAMb 1QVGZ 1VQN1 2PM9A 3H3VJ 3IF8A 1YJN1 1JWHC 2GU2A 3M3YI 5FLMI 3S15I 4TNUA 3CCEZ 3CC2Z 3GTOI 3VTNA 2O53A 4A3JI 5A2Qf 1VQ71 4A3FI 1Q812 1Z03A 2R7ZI 1VQ9Z 1RLYA 3KIFA 5T6BA 2NVQI 3CQZI 3HOXI 1M1K2 3HKZA 4NBGA 1YIJ1 2RHBA 3CPWY 1RQFA 4NB8A 1QYPA 4AYBA 4NBDA 4E2WA 3FQMA 1TWGI 2JUBA 5D1OA 2OTL1 3RZOI 2W03A 3CMA1 1WCMI 1VQ8Z 2Y0SA 3CCQZ 1YJ9Z 1KC82 2R93I 3S1RI 4E30A 3TE5B 3CC4Z 2IZ3A 4A3KI 5IT9b 2W04A 3VMHA 1VQNZ 3IFUA 3VMIA 1Q861 1W2BY 3HOYI 3EERA 4BBSI 2DE6A 5D1PA 1K83I 1L1OC 1X3ZA 4HH4A 4A93I 3S1NI 3NH5A 3G71Z 2VUGA 1VQO1 2IZ4A 4S1TA 1YIJZ 3CCMZ 2RIQA 4MONA 4XX2A 3I561 2KPIA 1NJI1 5A2Qb 5D1OB 3G6E1 2OOYB 3HOUI 3GTKI 3KIHA 2QEX1 3NH8A 2JA7I 4RVFA 4MH4A 3S17I 1JJ2Z 1I50I 4HGZA 1K8A1 3CCQ1 5T67A 2Q4ZA 1YIT1 1VQ81 3S2HI 4MD9A 3CC7Z 1YJNZ 1TFIA 2JNYA 1JJ2Y 2OTLZ 3S14I 4QTUA 3I551 3GTMI 3CD6Z 4Y7NI 2F4OA 1RO0A 5LL6f 3CCV1 2R6MA 2JR6A 1M901 1VLAA 2VUMI 1K9M1 2NVYI 3RZDI 1Z01A 2WAQA 3FQQA 4E31A 4A3LI 3NFZA 1ZH1A 1VQ7Z 1YUAA 3CCJ1 1YHQ1 2E2HI 4A3II 5IP9I 2LFUA 1USPA 2GTIA 3P5JB 2QKDA 4BXXI 3CCSZ 3PO3I 2O4HA 3IX0A 4RVDA 2P3YA 1P9NA 2QA4Z 2ZAEB 4NB9A 2HU9A 2K5RA 1TWHI 3NDJA 3FKII 1I3QI 4A3BI 1RO4A 3G4SZ 2OTJ1 3TDHB 4A3CI 3OW2Y 1VQKZ 1X0TA 3HOWI 4RV9A 3CCUZ 1Y1VI 2RT9A 1VQOZ 2NVTI 5C4JI 4DGLA 3GTLI 2JMOA 1QVFZ 3CCL1 3T4NB 2QRCB 1Y1WI 1S721 2JS4A 1M1K1 1KQSY 4DQYB 2H85A 3J81f 1Q811 1ZB9A 4E2XA 3CPWZ 4E2YA 2RPRA 3GTJI 2WB1A 3S2DI 2V8KA 3CC41 4RVHA 4BBRI 1NP6A 1TWAI 3I4MI 4NFRA 3CC21 3CCE1 1K731 3F3FC 3CME1 3CMAZ 3I4NI 1KQSZ 1YUKA 1Q7Y1 2B63I 4NBCA 3CCRZ 3MZKB 1RNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 Z;  1VQ9 Z;  1N8R 1;  1VQ5 1;  3CCV 1;  1K73 2;  1M1K 2;  1YHQ Z;  1Q82 1;  1K9M 2;  1M90 1;  1YIJ 1;  3CPW Y;  1Q82 2;  1K9M 1;  1W2B Z;  1M90 2;  1VQ5 Z;  3OW2 Z;  1KC8 1;  1S72 Z;  3CCR 1;  1VQ7 Z;  3CXC Y;  2OTJ Z;  3CCJ 1;  1VQL 1;  1YHQ 1;  3G4S 1;  2OTL 1;  1VQP Z;  3CMA 1;  1QVF Y;  3CD6 1;  3I55 Z;  1VQ8 Z;  3CCS Z;  3CCQ Z;  1YJ9 Z;  1KC8 2;  3CCU 1;  1YJW Z;  1YJ9 1;  1KD1 2;  2QA4 Z;  3CCS 1;  1YIT Z;  1KD1 1;  3CC4 Z;  3G4S Z;  1VQN Z;  3CCJ Z;  2OTJ 1;  2QEX Z;  3OW2 Y;  1VQK Z;  3G6E Z;  1Q86 1;  1W2B Y;  1YJW 1;  3CCU Z;  3I56 Z;  1Q86 2;  1VQM 1;  1VQO Z;  1YI2 1;  1VQ6 1;  3CCV Z;  1VQ9 1;  1QVF Z;  1VQP 1;  3CCL 1;  3G71 Z;  1YI2 Z;  1VQ6 Z;  1S72 1;  3CXC Z;  1VQO 1;  3G71 1;  1M1K 1;  1KQS Y;  1VQM Z;  3CCL Z;  3CME Z;  1Q81 1;  3CC7 1;  1YIJ Z;  3CPW Z;  3CCM Z;  1VQK 1;  1Q7Y 2;  3I56 1;  1NJI 1;  1VQ4 1;  3G6E 1;  1QVG Y;  3CC4 1;  2QEX 1;  1QVG Z;  1VQN 1;  1K8A 2;  1JJ2 Z;  1YJN 1;  1K8A 1;  3CCQ 1;  3CC2 1;  1YIT 1;  3CCE 1;  3CCE Z;  1K73 1;  1VQ8 1;  3CCM 1;  1N8R 2;  3CC2 Z;  2QA4 1;  3CC7 Z;  1YJN Z;  3CME 1;  3CMA Z;  1KQS Z;  1Q7Y 1;  1JJ2 Y;  1NJI 2;  2OTL Z;  1VQL Z;  3CCR Z;  3I55 1;  1VQ7 1;  3CD6 Z;  1Q81 2; 
#chains in the Genus database with same CATH topology
 3EED A;  1VQ4 Z;  1N8R 1;  3VB9 A;  1VQ5 1;  3PO3 S;  4Y52 I;  2HF1 A;  1RO2 A;  1Q82 1;  4NBF A;  1Z02 A;  2G2K A;  1Q82 2;  2R92 I;  2QR1 B;  4RVG A;  2EGT A;  3JAM f;  3LUS A;  3HOZ I;  2Q51 A;  1KC8 1;  2JIP A;  1ZB8 A;  4RS4 A;  3CXC Y;  2OTJ Z;  2BJO A;  3G4S 1;  1VQP Z;  2AKL A;  3Q87 A;  4EWC A;  5C44 I;  5FLX f;  3CD6 1;  3I55 Z;  3HOV I;  4A3D I;  3QWU A;  4E32 A;  2VPY A;  2LEX A;  1N2F A;  3VMG A;  4QTT A;  2V8I A;  3CCS 1;  1KD1 1;  2F4M A;  3MZL B;  1WII A;  5T64 A;  3CCJ Z;  5C3E I;  3G6E Z;  2QRE B;  1YJW 1;  4X6A I;  1Q86 2;  1VQM 1;  1SFO I;  3S16 I;  3D6W A;  1QXF A;  1NUI A;  1YI2 1;  2OZK A;  4MXU A;  1VQ6 1;  4MD7 A;  3CCV Z;  4A3G I;  1LQL A;  3GTQ I;  2JA6 I;  3GKQ A;  3F3P C;  3CXC Z;  5AN9 F;  1VQM Z;  2V3V A;  3CCL Z;  1TWC I;  3GTM S;  4DK1 A;  5CM2 M;  1TWF I;  3CME Z;  3ESW A;  2JA8 I;  2E9H A;  1S7M A;  3J7A 4;  4NBE A;  2M6N A;  1Y8C A;  4A3E I;  4CL1 A;  1K8A 2;  2YU9 I;  2NVX I;  3U50 C;  1PFT A;  4BY7 I;  3CCM 1;  1N8R 2;  2QA4 1;  2QLV B;  1WJ2 A;  2KI7 B;  3BG0 B;  3S1Q I;  4NBH A;  1NJI 2;  3PO2 I;  2NAP A;  1VQL Z;  3NH4 A;  5FLX b;  3J80 b;  3M4O I;  4MD8 A;  5C4X I;  1KRL A;  1K73 2;  1YHQ Z;  2PMZ A;  3GTP I;  1I6H I;  1K9M 2;  4E33 A;  2JIQ A;  2YAD A;  1M90 2;  1W2B Z;  1VQ5 Z;  2RBL A;  2V45 A;  3OW2 Z;  1S72 Z;  4NBA A;  3CCR 1;  1ML8 A;  1VQL 1;  3NDI A;  2LIY A;  3D9X A;  1DL6 A;  3I07 A;  1QVF Y;  2PK7 A;  2P28 A;  3CCU 1;  2VPX A;  1YJW Z;  1YJ9 1;  1KD1 2;  4NH1 C;  1YIT Z;  3J81 b;  2M48 A;  3GCF A;  5IP7 I;  1WW9 A;  2VF1 A;  2GTH A;  2QEX Z;  1Q16 A;  3GTG I;  4NBB A;  2OOX B;  3I56 Z;  1SIW A;  1USP B;  1VQ9 1;  1VQP 1;  1AA6 A;  5IT9 f;  1YI2 Z;  1VQ6 Z;  2QRD B;  3K7A I;  2E2J I;  1R9T I;  2DE7 A;  3G71 1;  2I3C A;  4A3M I;  2JA5 I;  1Y1V S;  1X3W A;  3CC7 1;  2E2I I;  2J6A A;  1VQK 1;  4MRI A;  4NOZ A;  1Q7Y 2;  3H0G I;  1FDI A;  2DE5 A;  2V8J A;  4E2Z A;  1VQ4 1;  3S1M I;  3MON A;  2K3R A;  1QF8 A;  1QVG Y;  3J80 f;  4BY1 I;  4HGY A;  3BG1 B;  3JAM b;  1QVG Z;  1VQN 1;  2PM9 A;  3H3V J;  3IF8 A;  1YJN 1;  1JWH C;  2GU2 A;  2VPW A;  5FLM I;  3M3Y I;  4TNU A;  3S15 I;  3CCE Z;  3CC2 Z;  2JIO A;  3GTO I;  3VTN A;  1WZN A;  2O53 A;  4A3J I;  5A2Q f;  1VQ7 1;  4A3F I;  1Q81 2;  1Z03 A;  2R7Z I;  1VQ9 Z;  1RLY A;  3KIF A;  5T6B A;  2NVQ I;  3CQZ I;  3HOX I;  1M1K 2;  3HKZ A;  4NBG A;  1YIJ 1;  2RHB A;  3CPW Y;  1RQF A;  4NB8 A;  1QYP A;  4AYB A;  4NBD A;  4E2W A;  3FQM A;  1TWG I;  2JUB A;  5D1O A;  2OTL 1;  3IR7 A;  3RZO I;  2W03 A;  3CMA 1;  1WCM I;  1VQ8 Z;  2Y0S A;  3CCQ Z;  1YJ9 Z;  1KC8 2;  2R93 I;  3S1R I;  4E30 A;  3TE5 B;  3CC4 Z;  2IZ3 A;  4A3K I;  5IT9 b;  2W04 A;  3VMH A;  1VQN Z;  3IFU A;  1FDO A;  3VMI A;  1Q86 1;  1W2B Y;  3HOY I;  3EER A;  4BBS I;  2DE6 A;  5D1P A;  1K83 I;  1L1O C;  1X3Z A;  4HH4 A;  4A93 I;  3S1N I;  3NH5 A;  3G71 Z;  2VUG A;  1VQO 1;  2IZ4 A;  4S1T A;  2VPZ A;  1YIJ Z;  3CCM Z;  2RIQ A;  4MON A;  4XX2 A;  3I56 1;  2KPI A;  1NJI 1;  5A2Q b;  5D1O B;  3G6E 1;  2OOY B;  3HOU I;  3GTK I;  3KIH A;  2QEX 1;  3NH8 A;  2JA7 I;  4RVF A;  4MH4 A;  2JIM A;  3S17 I;  1JJ2 Z;  1I50 I;  4HGZ A;  1K8A 1;  3CCQ 1;  5T67 A;  2Q4Z A;  1YIT 1;  1VQ8 1;  3S2H I;  4MD9 A;  3CC7 Z;  1YJN Z;  1TFI A;  2JNY A;  1JJ2 Y;  2OTL Z;  2AYD A;  3S14 I;  4QTU A;  3I55 1;  3GTM I;  3CD6 Z;  4Y7N I;  2F4O A;  1RO0 A;  5LL6 f;  3CCV 1;  2R6M A;  2JR6 A;  1M90 1;  3D2L A;  1VLA A;  2VUM I;  1K9M 1;  2NVY I;  3RZD I;  1Z01 A;  2WAQ A;  3FQQ A;  4E31 A;  2IV2 X;  4A3L I;  3NFZ A;  1ZH1 A;  1VQ7 Z;  1YUA A;  3CCJ 1;  1YHQ 1;  2E2H I;  4A3I I;  2E7Z A;  5IP9 I;  2LFU A;  1USP A;  2GTI A;  3P5J B;  2QKD A;  4BXX I;  3CCS Z;  3PO3 I;  2O4H A;  3IX0 A;  4RVD A;  2P3Y A;  1P9N A;  2QA4 Z;  2ZAE B;  4NB9 A;  2HU9 A;  2K5R A;  1TWH I;  3NDJ A;  3FKI I;  1I3Q I;  4A3B I;  1RO4 A;  3G4S Z;  2OTJ 1;  3TDH B;  4A3C I;  3OW2 Y;  1VQK Z;  1X0T A;  3HOW I;  4RV9 A;  3CCU Z;  1Y1V I;  2RT9 A;  1VQO Z;  2NVT I;  5C4J I;  4DGL A;  3GTL I;  2JMO A;  1QVF Z;  3CCL 1;  3T4N B;  2QRC B;  1Y1W I;  1S72 1;  2JS4 A;  1M1K 1;  1KQS Y;  4DQY B;  2H85 A;  3J81 f;  1Q81 1;  1ZB9 A;  4E2X A;  3CPW Z;  4E2Y A;  2RPR A;  3GTJ I;  2WB1 A;  3S2D I;  2V8K A;  3CC4 1;  4RVH A;  4BBR I;  1NP6 A;  1TWA I;  3I4M I;  4NFR A;  2JIR A;  3CC2 1;  3CCE 1;  1K73 1;  3F3F C;  3CME 1;  3CMA Z;  3I4N I;  1KQS Z;  1YUK A;  1Q7Y 1;  2B63 I;  4NBC A;  3CCR Z;  3MZK B;  1RNI A; 
#chains in the Genus database with same CATH homology
 3EED A;  1VQ4 Z;  1N8R 1;  3VB9 A;  1VQ5 1;  3PO3 S;  4Y52 I;  2HF1 A;  1RO2 A;  1Q82 1;  4NBF A;  1Z02 A;  2G2K A;  1Q82 2;  2R92 I;  2QR1 B;  4RVG A;  2EGT A;  3JAM f;  3LUS A;  3HOZ I;  2Q51 A;  1KC8 1;  1ZB8 A;  4RS4 A;  3CXC Y;  2OTJ Z;  2BJO A;  3G4S 1;  1VQP Z;  2AKL A;  3Q87 A;  4EWC A;  5C44 I;  5FLX f;  3CD6 1;  3I55 Z;  3HOV I;  4A3D I;  3QWU A;  4E32 A;  1N2F A;  3VMG A;  4QTT A;  2V8I A;  3CCS 1;  1KD1 1;  2F4M A;  3MZL B;  1WII A;  5T64 A;  3CCJ Z;  5C3E I;  3G6E Z;  2QRE B;  1YJW 1;  4X6A I;  1Q86 2;  1VQM 1;  1SFO I;  3S16 I;  1YI2 1;  3D6W A;  1NUI A;  1VQ6 1;  2OZK A;  4MXU A;  4MD7 A;  3CCV Z;  4A3G I;  1LQL A;  3GTQ I;  2JA6 I;  3GKQ A;  3F3P C;  3CXC Z;  5AN9 F;  1VQM Z;  3CCL Z;  3GTM S;  1TWC I;  4DK1 A;  5CM2 M;  1TWF I;  3CME Z;  3ESW A;  2JA8 I;  2E9H A;  1S7M A;  3J7A 4;  4NBE A;  2M6N A;  4A3E I;  4CL1 A;  1K8A 2;  2YU9 I;  2NVX I;  3U50 C;  1PFT A;  4BY7 I;  3CCM 1;  1N8R 2;  2QA4 1;  2QLV B;  2KI7 B;  3BG0 B;  3S1Q I;  4NBH A;  1NJI 2;  3PO2 I;  1VQL Z;  3NH4 A;  5FLX b;  3J80 b;  3M4O I;  4MD8 A;  5C4X I;  1KRL A;  1K73 2;  1YHQ Z;  2PMZ A;  3GTP I;  1I6H I;  1K9M 2;  4E33 A;  2YAD A;  1M90 2;  1W2B Z;  1VQ5 Z;  2RBL A;  3OW2 Z;  1S72 Z;  4NBA A;  3CCR 1;  1ML8 A;  1VQL 1;  3NDI A;  2LIY A;  3D9X A;  1DL6 A;  3I07 A;  1QVF Y;  2PK7 A;  2P28 A;  3CCU 1;  1YJW Z;  1YJ9 1;  1KD1 2;  4NH1 C;  1YIT Z;  3J81 b;  2M48 A;  3GCF A;  5IP7 I;  1WW9 A;  2VF1 A;  2GTH A;  2QEX Z;  3GTG I;  4NBB A;  2OOX B;  3I56 Z;  1USP B;  1VQ9 1;  1VQP 1;  5IT9 f;  1YI2 Z;  1VQ6 Z;  2QRD B;  3K7A I;  2E2J I;  1R9T I;  2DE7 A;  3G71 1;  2I3C A;  4A3M I;  2JA5 I;  1Y1V S;  1X3W A;  3CC7 1;  2E2I I;  2J6A A;  1VQK 1;  4MRI A;  4NOZ A;  1Q7Y 2;  3H0G I;  4E2Z A;  2DE5 A;  2V8J A;  1VQ4 1;  3S1M I;  3MON A;  2K3R A;  1QF8 A;  1QVG Y;  3J80 f;  4BY1 I;  4HGY A;  3BG1 B;  3JAM b;  1QVG Z;  1VQN 1;  2PM9 A;  3H3V J;  3IF8 A;  1YJN 1;  1JWH C;  2GU2 A;  3M3Y I;  5FLM I;  3S15 I;  4TNU A;  3CCE Z;  3CC2 Z;  3GTO I;  3VTN A;  2O53 A;  4A3J I;  5A2Q f;  1VQ7 1;  4A3F I;  1Q81 2;  1Z03 A;  2R7Z I;  1VQ9 Z;  1RLY A;  3KIF A;  5T6B A;  2NVQ I;  3CQZ I;  3HOX I;  1M1K 2;  3HKZ A;  4NBG A;  1YIJ 1;  2RHB A;  3CPW Y;  1RQF A;  4NB8 A;  1QYP A;  4AYB A;  4NBD A;  4E2W A;  3FQM A;  1TWG I;  2JUB A;  5D1O A;  2OTL 1;  3RZO I;  2W03 A;  3CMA 1;  1WCM I;  1VQ8 Z;  2Y0S A;  3CCQ Z;  1YJ9 Z;  1KC8 2;  2R93 I;  3S1R I;  4E30 A;  3TE5 B;  3CC4 Z;  2IZ3 A;  4A3K I;  5IT9 b;  2W04 A;  3VMH A;  1VQN Z;  3IFU A;  3VMI A;  1Q86 1;  1W2B Y;  3HOY I;  3EER A;  4BBS I;  2DE6 A;  5D1P A;  1K83 I;  1L1O C;  1X3Z A;  4HH4 A;  4A93 I;  3S1N I;  3NH5 A;  3G71 Z;  2VUG A;  1VQO 1;  2IZ4 A;  4S1T A;  1YIJ Z;  3CCM Z;  2RIQ A;  4MON A;  4XX2 A;  3I56 1;  2KPI A;  1NJI 1;  5A2Q b;  5D1O B;  3G6E 1;  2OOY B;  3HOU I;  3GTK I;  3KIH A;  2QEX 1;  3NH8 A;  2JA7 I;  4RVF A;  4MH4 A;  3S17 I;  1JJ2 Z;  1I50 I;  4HGZ A;  1K8A 1;  3CCQ 1;  5T67 A;  2Q4Z A;  1YIT 1;  1VQ8 1;  3S2H I;  4MD9 A;  3CC7 Z;  1YJN Z;  1TFI A;  2JNY A;  1JJ2 Y;  2OTL Z;  3S14 I;  4QTU A;  3I55 1;  3GTM I;  3CD6 Z;  4Y7N I;  2F4O A;  1RO0 A;  5LL6 f;  3CCV 1;  2R6M A;  2JR6 A;  1M90 1;  1VLA A;  2VUM I;  1K9M 1;  2NVY I;  3RZD I;  1Z01 A;  2WAQ A;  3FQQ A;  4E31 A;  4A3L I;  3NFZ A;  1ZH1 A;  1VQ7 Z;  1YUA A;  3CCJ 1;  1YHQ 1;  2E2H I;  4A3I I;  5IP9 I;  2LFU A;  1USP A;  2GTI A;  3P5J B;  2QKD A;  4BXX I;  3CCS Z;  3PO3 I;  2O4H A;  3IX0 A;  4RVD A;  2P3Y A;  1P9N A;  2QA4 Z;  2ZAE B;  4NB9 A;  2HU9 A;  2K5R A;  1TWH I;  3NDJ A;  3FKI I;  1I3Q I;  4A3B I;  1RO4 A;  3G4S Z;  2OTJ 1;  3TDH B;  4A3C I;  3OW2 Y;  1VQK Z;  1X0T A;  3HOW I;  4RV9 A;  3CCU Z;  1Y1V I;  2RT9 A;  1VQO Z;  2NVT I;  5C4J I;  4DGL A;  3GTL I;  2JMO A;  1QVF Z;  3CCL 1;  3T4N B;  2QRC B;  1Y1W I;  1S72 1;  2JS4 A;  1M1K 1;  1KQS Y;  4DQY B;  2H85 A;  3J81 f;  1Q81 1;  1ZB9 A;  4E2X A;  3CPW Z;  4E2Y A;  2RPR A;  3GTJ I;  2WB1 A;  3S2D I;  2V8K A;  3CC4 1;  4RVH A;  4BBR I;  1NP6 A;  1TWA I;  3I4M I;  4NFR A;  3CC2 1;  3CCE 1;  1K73 1;  3F3F C;  3CME 1;  3CMA Z;  3I4N I;  1KQS Z;  1YUK A;  1Q7Y 1;  2B63 I;  4NBC A;  3CCR Z;  3MZK B;  1RNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...