3I55Z

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55Z00
1K9M2 1M902 2OTL1 2QEXZ 1K8A2 1KQSY 1YHQZ 2OTJ1 3CCRZ 1VQL1 1M1K1 1NJI2 3CC21 3CXCY 1VQ8Z 1W2BY 3CD6Z 1YI2Z 1JJ2Y 1VQOZ 1VQ5Z 3CPWY 3CME1 3CCEZ 3CCS1 2QA4Z 3G711 3CCJ1 1QVFY 1YJ91 1S721 3CCQ1 1YIJZ 1VQKZ 1YJWZ 1Q7Y1 3CMA1 1YJN1 1KC82 1VQ91 1KD11 1VQM1 1VQ41 1VQ7Z 3CC7Z 2OTJZ 3CCLZ 1VQN1 1K9M1 1VQPZ 1M901 1YITZ 3I56Z 1K8A1 3CCMZ 3G6EZ 3OW2Y 3CCVZ 3I55Z 3G4SZ 2QEX1 3CCQZ 3CCUZ 1W2BZ 1YHQ1 3CCR1 1VQ6Z 1JJ2Z 1K732 1Q861 1VQ81 3CD61 1YI21 1VQO1 2OTLZ 1VQ51 1N8R2 1Q822 3CCE1 1Q812 1VQLZ 1QVGZ 1KC81 2QA41 3CC2Z 3CC41 1YIJ1 1YJW1 3CMEZ 1NJI1 3CCSZ 1M1K2 1KQSZ 3CCJZ 3G71Z 1YJ9Z 1S72Z 3CXCZ 1VQ71 3CMAZ 1YJNZ 3CC71 3CCL1 1VQ9Z 3CPWZ 1VQMZ 1VQP1 3OW2Z 1YIT1 3I561 1QVFZ 1VQ4Z 3CCM1 1Q7Y2 3G6E1 1K731 3CCV1 1VQNZ 3I551 1KD12 3G4S1 1Q862 3CC4Z 1VQK1 1QVGY 3CCU1 1N8R1 1Q821 1VQ61 1Q811
chains in the Genus database with same CATH superfamily
2KI7B 2O53A 3NH5A 2V3VA 2OTJ1 1W2BY 3CD6Z 4QTUA 3VTNA 5AN9F 1YI2Z 1SFOI 3CCEZ 3CCS1 2R6MA 1SIWA 2IZ4A 1I3QI 1LQLA 2QREB 4DK1A 2GTIA 4A3FI 3TE5B 3MONA 2E2HI 4X6AI 2HF1A 2JUBA 3J81f 1TWCI 1Y8CA 1VQ91 3J81b 2YADA 2EGTA 4E2YA 1FDIA 1Z03A 5C44I 4E31A 2LFUA 4NH1C 1X0TA 1K9M1 1USPA 3GTMI 5IP7I 4TNUA 2LIYA 1X3WA 1I50I 1R9TI 1RNIA 2JR6A 3LUSA 3CCVZ 3H3VJ 4BBSI 1W2BZ 3S16I 3CCR1 2WB1A 1VQ6Z 4MRIA 2VUMI 2JIPA 3NDIA 2R7ZI 2VF1A 1VQ81 2IZ3A 3VMGA 3S1RI 1VQO1 5C3EI 4A3MI 4CL1A 2QA41 4A3DI 2QRCB 2V8KA 1YIJ1 3GCFA 5T6BA 2RHBA 4BXXI 3M4OI 3HKZA 4A3JI 3CCSZ 4A3GI 1VQ71 4A3BI 4Y7NI 5CM2M 1FDOA 3CC71 2P3YA 2JNYA 3CCL1 3S15I 1VQ9Z 1ZB9A 4A3II 2VPXA 3S1QI 3RZDI 3EERA 1YUAA 4EWCA 3I4NI 3G4S1 1Q862 3IX0A 3CC4Z 1QYPA 5D1OB 2RIQA 3CCU1 1N2FA 2DE7A 4E2XA 1K9M2 1TWFI 1Y1VI 4NB8A 2M48A 3D2LA 2OTL1 1KQSY 2M6NA 1ZH1A 3CCRZ 2PM9A 4NFRA 1NJI2 2DE5A 1NUIA 1PFTA 1WW9A 2BJOA 3CC21 5A2Qf 1VQ8Z 3IR7A 1JJ2Y 5A2Qb 1VQOZ 4NBFA 3RZOI 3CPWY 4DQYB 2QA4Z 1QVFY 1YJ91 1YIJZ 1VQKZ 4MXUA 2QLVB 3IFUA 2HU9A 4XX2A 1KD11 4MD7A 2Y0SA 1WIIA 4BY1I 1VQ7Z 4RV9A 5T64A 3CC7Z 1AA6A 3CCLZ 2IV2X 1M901 1YUKA 2JA6I 3HOWI 5C4JI 3OW2Y 2OOYB 2WAQA 3G4SZ 4BY7I 1L1OC 3CCUZ 2R92I 5FLMI 1YHQ1 1JJ2Z 2P28A 1Q861 3KIHA 3GTKI 2J6AA 5D1OA 2OTLZ 1VQ51 2GU2A 1S7MA 5D1PA 4DGLA 1QVGZ 4E30A 4HH4A 3CC2Z 3CC41 2QRDB 2OOXB 3IF8A 4RVHA 1NJI1 4A93I 3ESWA 2R93I 1QXFA 4MONA 1YJ9Z 4NOZA 4A3CI 2E2II 2VPZA 3OW2Z 1YIT1 3QWUA 4A3KI 3BG1B 1VLAA 3G6E1 4HGYA 5FLXf 1KD12 2W03A 5FLXb 5T67A 1ZB8A 1VQK1 1QF8A 1N8R1 2NVYI 1M902 3T4NB 3GTPI 3I07A 1YHQZ 1TWGI 3I4MI 3MZKB 3FKII 1P9NA 3CXCY 1Z01A 3FQQA 4E33A 1VQ5Z 3VB9A 3G711 1I6HI 2JIRA 4NBDA 3KIFA 1S721 4RVFA 1WZNA 2ZAEB 3S1NI 1WJ2A 4NBGA 3J7A4 3F3PC 2NAPA 3JAMf 3H0GI 1K83I 1VQN1 3JAMb 4RVDA 3F3FC 3GKQA 3GTQI 1YITZ 3Q87A 1K8A1 3G6EZ 2Q51A 4E32A 2E9HA 2AKLA 3D6WA 2AYDA 3EEDA 1TWAI 3K7AI 2QEX1 3CCQZ 1TWHI 3J80f 1WCMI 3J80b 2RPRA 2V8IA 3GTOI 3NFZA 1Y1WI 2YU9I 3HOVI 4AYBA 2JA5I 5C4XI 1N8R2 2NVTI 1KC81 3TDHB 3FQMA 2O4HA 1YJW1 2JS4A 4BBRI 1Q16A 4NBHA 1RO2A 3VMIA 1RO4A 1KQSZ 3G71Z 1S72Z 3S2DI 2B63I 4HGZA 2E7ZA 4RS4A 3CPWZ 1VQP1 3I561 1QVFZ 4QTTA 3CCM1 2V45A 4Y52I 4MD8A 2JIQA 3MZLB 1K731 1JWHC 1VQNZ 4NBEA 3I551 3M3YI 1Z02A 3GTLI 1ML8A 1Q821 2K3RA 4E2WA 1Q811 2JIOA 3HOUI 2E2JI 3VMHA 2G2KA 3S17I 3P5JB 2GTHA 3NH4A 2QEXZ 2Q4ZA 1K8A2 2JIMA 1VQL1 1M1K1 3NDJA 3PO2I 1RLYA 2KPIA 2QKDA 3CME1 1X3ZA 2F4OA 3CCJ1 4A3EI 4A3LI 3GTGI 3CCQ1 1RO0A 1YJWZ 2NVXI 1Q7Y1 3CMA1 2V8JA 1YJN1 1TFIA 1KC82 3PO3I 4E2ZA 1VQM1 2VUGA 2PK7A 2I3CA 1VQ41 3GTMS 2OTJZ 3S2HI 2JA8I 1VQPZ 1RQFA 5LL6f 3I56Z 4MH4A 2K5RA 3HOXI 3CCMZ 5IP9I 2W04A 4S1TA 3I55Z 3GTJI 3PO3S 2PMZA 3U50C 3S14I 3CQZI 1K732 3CD61 1YI21 3HOZI 2H85A 3BG0B 2NVQI 1Q822 3CCE1 1Q812 1VQLZ 3NH8A 2DE6A 5IT9f 5IT9b 2VPWA 3CMEZ 1M1K2 3CCJZ 1USPB 4NB9A 2RBLA 3CXCZ 3CMAZ 1YJNZ 2RT9A 1VQMZ 3S1MI 3D9XA 2VPYA 3HOYI 1VQ4Z 2JMOA 4NBAA 4RVGA 1Q7Y2 2JA7I 3CCV1 2F4MA 1KRLA 1DL6A 1NP6A 2OZKA 4NBBA 2LEXA 2QR1B 1QVGY 4MD9A 1VQ61 1Y1VS 4NBCA
chains in the Genus database with same CATH topology
2KI7B 2O53A 3NH5A 2OTJ1 1W2BY 3CD6Z 4QTUA 3VTNA 5AN9F 1YI2Z 1SFOI 3CCEZ 3CCS1 2R6MA 2IZ4A 1I3QI 1LQLA 2QREB 4DK1A 2GTIA 4A3FI 3TE5B 3MONA 2E2HI 4X6AI 2HF1A 2JUBA 3J81f 1TWCI 1VQ91 3J81b 2YADA 2EGTA 4E2YA 1Z03A 5C44I 4E31A 2LFUA 4NH1C 1X0TA 1K9M1 1USPA 3GTMI 5IP7I 4TNUA 2LIYA 1X3WA 1I50I 1R9TI 1RNIA 2JR6A 3LUSA 3CCVZ 3H3VJ 4BBSI 1W2BZ 3S16I 3CCR1 2WB1A 1VQ6Z 4MRIA 2VUMI 3NDIA 2R7ZI 2VF1A 1VQ81 2IZ3A 3VMGA 3S1RI 1VQO1 5C3EI 4A3MI 4CL1A 2QA41 4A3DI 2QRCB 2V8KA 1YIJ1 3GCFA 5T6BA 2RHBA 4BXXI 3M4OI 3HKZA 4A3JI 3CCSZ 4A3GI 1VQ71 4A3BI 4Y7NI 5CM2M 3CC71 2P3YA 2JNYA 3CCL1 3S15I 1VQ9Z 1ZB9A 4A3II 3S1QI 3RZDI 3EERA 1YUAA 4EWCA 3I4NI 3G4S1 1Q862 3IX0A 3CC4Z 1QYPA 5D1OB 2RIQA 3CCU1 1N2FA 2DE7A 4E2XA 1K9M2 1TWFI 1Y1VI 4NB8A 2M48A 2OTL1 1KQSY 2M6NA 1ZH1A 3CCRZ 2PM9A 4NFRA 1NJI2 2DE5A 1NUIA 1PFTA 1WW9A 2BJOA 3CC21 5A2Qf 1VQ8Z 1JJ2Y 5A2Qb 1VQOZ 4NBFA 3RZOI 3CPWY 4DQYB 2QA4Z 1QVFY 1YJ91 1YIJZ 1VQKZ 4MXUA 2QLVB 3IFUA 2HU9A 4XX2A 1KD11 4MD7A 2Y0SA 1WIIA 4BY1I 1VQ7Z 4RV9A 5T64A 3CC7Z 3CCLZ 1M901 1YUKA 2JA6I 3HOWI 5C4JI 3OW2Y 2OOYB 2WAQA 3G4SZ 4BY7I 1L1OC 3CCUZ 2R92I 5FLMI 1YHQ1 1JJ2Z 2P28A 1Q861 3KIHA 3GTKI 2J6AA 5D1OA 2OTLZ 1VQ51 2GU2A 1S7MA 5D1PA 4DGLA 1QVGZ 4E30A 4HH4A 3CC2Z 3CC41 2QRDB 2OOXB 3IF8A 4RVHA 1NJI1 4A93I 3ESWA 2R93I 4MONA 1YJ9Z 4NOZA 4A3CI 2E2II 3OW2Z 1YIT1 3QWUA 4A3KI 3BG1B 1VLAA 3G6E1 4HGYA 5FLXf 1KD12 2W03A 5FLXb 5T67A 1ZB8A 1VQK1 1QF8A 1N8R1 2NVYI 1M902 3T4NB 3GTPI 3I07A 1YHQZ 1TWGI 3I4MI 3MZKB 3FKII 1P9NA 3CXCY 1Z01A 3FQQA 4E33A 1VQ5Z 3VB9A 3G711 1I6HI 4NBDA 3KIFA 1S721 4RVFA 2ZAEB 3S1NI 4NBGA 3J7A4 3F3PC 3JAMf 3H0GI 1K83I 1VQN1 3JAMb 4RVDA 3F3FC 3GKQA 3GTQI 1YITZ 3Q87A 1K8A1 3G6EZ 2Q51A 4E32A 2E9HA 2AKLA 3D6WA 3EEDA 1TWAI 3K7AI 2QEX1 3CCQZ 1TWHI 3J80f 1WCMI 3J80b 2RPRA 2V8IA 3GTOI 3NFZA 1Y1WI 2YU9I 3HOVI 4AYBA 2JA5I 5C4XI 1N8R2 2NVTI 1KC81 3TDHB 3FQMA 2O4HA 1YJW1 2JS4A 4BBRI 4NBHA 1RO2A 3VMIA 1RO4A 1KQSZ 3G71Z 1S72Z 3S2DI 2B63I 4HGZA 4RS4A 3CPWZ 1VQP1 3I561 1QVFZ 4QTTA 3CCM1 4Y52I 4MD8A 3MZLB 1K731 1JWHC 1VQNZ 4NBEA 3I551 3M3YI 1Z02A 3GTLI 1ML8A 1Q821 2K3RA 4E2WA 1Q811 3HOUI 2E2JI 3VMHA 2G2KA 3S17I 3P5JB 2GTHA 3NH4A 2QEXZ 2Q4ZA 1K8A2 1VQL1 1M1K1 3NDJA 3PO2I 1RLYA 2KPIA 2QKDA 3CME1 1X3ZA 2F4OA 3CCJ1 4A3EI 4A3LI 3GTGI 3CCQ1 1RO0A 1YJWZ 2NVXI 1Q7Y1 3CMA1 2V8JA 1YJN1 1TFIA 1KC82 3PO3I 4E2ZA 1VQM1 2VUGA 2PK7A 2I3CA 1VQ41 3GTMS 2OTJZ 3S2HI 2JA8I 1VQPZ 1RQFA 5LL6f 3I56Z 4MH4A 2K5RA 3HOXI 3CCMZ 5IP9I 2W04A 4S1TA 3I55Z 3GTJI 3PO3S 2PMZA 3U50C 3S14I 3CQZI 1K732 3CD61 1YI21 3HOZI 2H85A 3BG0B 2NVQI 1Q822 3CCE1 1Q812 1VQLZ 3NH8A 2DE6A 5IT9f 5IT9b 3CMEZ 1M1K2 3CCJZ 1USPB 4NB9A 2RBLA 3CXCZ 3CMAZ 1YJNZ 2RT9A 1VQMZ 3S1MI 3D9XA 3HOYI 1VQ4Z 2JMOA 4NBAA 4RVGA 1Q7Y2 2JA7I 3CCV1 2F4MA 1KRLA 1DL6A 1NP6A 2OZKA 4NBBA 1QVGY 2QR1B 4MD9A 1VQ61 1Y1VS 4NBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 2;  1M90 2;  2OTL 1;  2QEX Z;  1K8A 2;  1KQS Y;  1YHQ Z;  2OTJ 1;  3CCR Z;  1VQL 1;  1M1K 1;  1NJI 2;  3CC2 1;  3CXC Y;  1VQ8 Z;  1W2B Y;  3CD6 Z;  1YI2 Z;  1JJ2 Y;  1VQO Z;  1VQ5 Z;  3CPW Y;  3CME 1;  3CCE Z;  3CCS 1;  2QA4 Z;  3G71 1;  3CCJ 1;  1QVF Y;  1YJ9 1;  1S72 1;  3CCQ 1;  1YIJ Z;  1VQK Z;  1YJW Z;  1Q7Y 1;  3CMA 1;  1YJN 1;  1KC8 2;  1VQ9 1;  1KD1 1;  1VQM 1;  1VQ4 1;  1VQ7 Z;  3CC7 Z;  2OTJ Z;  3CCL Z;  1VQN 1;  1K9M 1;  1VQP Z;  1M90 1;  1YIT Z;  3I56 Z;  1K8A 1;  3CCM Z;  3G6E Z;  3OW2 Y;  3CCV Z;  3I55 Z;  3G4S Z;  2QEX 1;  3CCQ Z;  3CCU Z;  1W2B Z;  1YHQ 1;  3CCR 1;  1VQ6 Z;  1JJ2 Z;  1K73 2;  1Q86 1;  1VQ8 1;  3CD6 1;  1YI2 1;  1VQO 1;  2OTL Z;  1VQ5 1;  1N8R 2;  1Q82 2;  3CCE 1;  1Q81 2;  1VQL Z;  1QVG Z;  1KC8 1;  2QA4 1;  3CC2 Z;  3CC4 1;  1YIJ 1;  1YJW 1;  3CME Z;  1NJI 1;  3CCS Z;  1M1K 2;  1KQS Z;  3CCJ Z;  3G71 Z;  1YJ9 Z;  1S72 Z;  3CXC Z;  1VQ7 1;  3CMA Z;  1YJN Z;  3CC7 1;  3CCL 1;  1VQ9 Z;  3CPW Z;  1VQM Z;  1VQP 1;  3OW2 Z;  1YIT 1;  3I56 1;  1QVF Z;  1VQ4 Z;  3CCM 1;  1Q7Y 2;  3G6E 1;  1K73 1;  3CCV 1;  1VQN Z;  3I55 1;  1KD1 2;  3G4S 1;  1Q86 2;  3CC4 Z;  1VQK 1;  1QVG Y;  3CCU 1;  1N8R 1;  1Q82 1;  1VQ6 1;  1Q81 1; 
#chains in the Genus database with same CATH topology
 2KI7 B;  2O53 A;  3NH5 A;  2V3V A;  2OTJ 1;  1W2B Y;  3CD6 Z;  4QTU A;  3VTN A;  5AN9 F;  1YI2 Z;  1SFO I;  3CCE Z;  3CCS 1;  2R6M A;  1SIW A;  2IZ4 A;  1I3Q I;  1LQL A;  2QRE B;  4DK1 A;  2GTI A;  4A3F I;  3TE5 B;  3MON A;  2E2H I;  4X6A I;  2HF1 A;  2JUB A;  3J81 f;  1TWC I;  1Y8C A;  1VQ9 1;  3J81 b;  2YAD A;  2EGT A;  4E2Y A;  1FDI A;  1Z03 A;  5C44 I;  4E31 A;  2LFU A;  4NH1 C;  1X0T A;  1K9M 1;  1USP A;  3GTM I;  5IP7 I;  4TNU A;  2LIY A;  1X3W A;  1I50 I;  1R9T I;  1RNI A;  2JR6 A;  3LUS A;  3CCV Z;  3H3V J;  4BBS I;  1W2B Z;  3S16 I;  3CCR 1;  2WB1 A;  1VQ6 Z;  4MRI A;  2VUM I;  2JIP A;  3NDI A;  2R7Z I;  2VF1 A;  1VQ8 1;  2IZ3 A;  3VMG A;  3S1R I;  1VQO 1;  5C3E I;  4A3M I;  4CL1 A;  2QA4 1;  4A3D I;  2QRC B;  2V8K A;  1YIJ 1;  3GCF A;  5T6B A;  2RHB A;  4BXX I;  3M4O I;  3HKZ A;  4A3J I;  3CCS Z;  4A3G I;  1VQ7 1;  4A3B I;  4Y7N I;  5CM2 M;  1FDO A;  3CC7 1;  2P3Y A;  2JNY A;  3CCL 1;  3S15 I;  1VQ9 Z;  1ZB9 A;  4A3I I;  2VPX A;  3S1Q I;  3RZD I;  3EER A;  1YUA A;  4EWC A;  3I4N I;  3G4S 1;  1Q86 2;  3IX0 A;  3CC4 Z;  1QYP A;  5D1O B;  2RIQ A;  3CCU 1;  1N2F A;  2DE7 A;  4E2X A;  1K9M 2;  1TWF I;  1Y1V I;  4NB8 A;  2M48 A;  3D2L A;  2OTL 1;  1KQS Y;  2M6N A;  1ZH1 A;  3CCR Z;  2PM9 A;  4NFR A;  1NJI 2;  2DE5 A;  1NUI A;  1PFT A;  1WW9 A;  2BJO A;  3CC2 1;  5A2Q f;  1VQ8 Z;  3IR7 A;  1JJ2 Y;  5A2Q b;  1VQO Z;  4NBF A;  3RZO I;  3CPW Y;  4DQY B;  2QA4 Z;  1QVF Y;  1YJ9 1;  1YIJ Z;  1VQK Z;  4MXU A;  2QLV B;  3IFU A;  2HU9 A;  4XX2 A;  1KD1 1;  4MD7 A;  2Y0S A;  1WII A;  4BY1 I;  1VQ7 Z;  4RV9 A;  5T64 A;  3CC7 Z;  1AA6 A;  3CCL Z;  2IV2 X;  1M90 1;  1YUK A;  2JA6 I;  3HOW I;  5C4J I;  3OW2 Y;  2OOY B;  2WAQ A;  3G4S Z;  4BY7 I;  1L1O C;  3CCU Z;  2R92 I;  5FLM I;  1YHQ 1;  1JJ2 Z;  2P28 A;  1Q86 1;  3KIH A;  3GTK I;  2J6A A;  5D1O A;  2OTL Z;  1VQ5 1;  2GU2 A;  1S7M A;  5D1P A;  4DGL A;  1QVG Z;  4E30 A;  4HH4 A;  3CC2 Z;  3CC4 1;  2QRD B;  2OOX B;  3IF8 A;  4RVH A;  1NJI 1;  4A93 I;  3ESW A;  2R93 I;  1QXF A;  4MON A;  1YJ9 Z;  4NOZ A;  4A3C I;  2E2I I;  2VPZ A;  3OW2 Z;  1YIT 1;  3QWU A;  4A3K I;  3BG1 B;  1VLA A;  3G6E 1;  4HGY A;  5FLX f;  1KD1 2;  2W03 A;  5FLX b;  5T67 A;  1ZB8 A;  1VQK 1;  1QF8 A;  1N8R 1;  2NVY I;  1M90 2;  3T4N B;  3GTP I;  3I07 A;  1YHQ Z;  1TWG I;  3I4M I;  3MZK B;  3FKI I;  1P9N A;  3CXC Y;  1Z01 A;  3FQQ A;  4E33 A;  1VQ5 Z;  3VB9 A;  3G71 1;  1I6H I;  2JIR A;  4NBD A;  3KIF A;  1S72 1;  4RVF A;  1WZN A;  2ZAE B;  3S1N I;  1WJ2 A;  4NBG A;  3J7A 4;  3F3P C;  2NAP A;  3JAM f;  3H0G I;  1K83 I;  1VQN 1;  3JAM b;  4RVD A;  3F3F C;  3GKQ A;  3GTQ I;  1YIT Z;  3Q87 A;  1K8A 1;  3G6E Z;  2Q51 A;  4E32 A;  2E9H A;  2AKL A;  3D6W A;  2AYD A;  3EED A;  1TWA I;  3K7A I;  2QEX 1;  3CCQ Z;  1TWH I;  3J80 f;  1WCM I;  3J80 b;  2RPR A;  2V8I A;  3GTO I;  3NFZ A;  1Y1W I;  2YU9 I;  3HOV I;  4AYB A;  2JA5 I;  5C4X I;  1N8R 2;  2NVT I;  1KC8 1;  3TDH B;  3FQM A;  2O4H A;  1YJW 1;  2JS4 A;  4BBR I;  1Q16 A;  4NBH A;  1RO2 A;  3VMI A;  1RO4 A;  1KQS Z;  3G71 Z;  1S72 Z;  3S2D I;  2B63 I;  4HGZ A;  2E7Z A;  4RS4 A;  3CPW Z;  1VQP 1;  3I56 1;  1QVF Z;  4QTT A;  3CCM 1;  2V45 A;  4Y52 I;  4MD8 A;  2JIQ A;  3MZL B;  1K73 1;  1JWH C;  1VQN Z;  4NBE A;  3I55 1;  3M3Y I;  1Z02 A;  3GTL I;  1ML8 A;  1Q82 1;  2K3R A;  4E2W A;  1Q81 1;  2JIO A;  3HOU I;  2E2J I;  3VMH A;  2G2K A;  3S17 I;  3P5J B;  2GTH A;  3NH4 A;  2QEX Z;  2Q4Z A;  1K8A 2;  2JIM A;  1VQL 1;  1M1K 1;  3NDJ A;  3PO2 I;  1RLY A;  2KPI A;  2QKD A;  3CME 1;  1X3Z A;  2F4O A;  3CCJ 1;  4A3E I;  4A3L I;  3GTG I;  3CCQ 1;  1RO0 A;  1YJW Z;  2NVX I;  1Q7Y 1;  3CMA 1;  2V8J A;  1YJN 1;  1TFI A;  1KC8 2;  3PO3 I;  4E2Z A;  1VQM 1;  2VUG A;  2PK7 A;  2I3C A;  1VQ4 1;  3GTM S;  2OTJ Z;  3S2H I;  2JA8 I;  1VQP Z;  1RQF A;  5LL6 f;  3I56 Z;  4MH4 A;  2K5R A;  3HOX I;  3CCM Z;  5IP9 I;  2W04 A;  4S1T A;  3I55 Z;  3GTJ I;  3PO3 S;  2PMZ A;  3U50 C;  3S14 I;  3CQZ I;  1K73 2;  3CD6 1;  1YI2 1;  3HOZ I;  2H85 A;  3BG0 B;  2NVQ I;  1Q82 2;  3CCE 1;  1Q81 2;  1VQL Z;  3NH8 A;  2DE6 A;  5IT9 f;  5IT9 b;  2VPW A;  3CME Z;  1M1K 2;  3CCJ Z;  1USP B;  4NB9 A;  2RBL A;  3CXC Z;  3CMA Z;  1YJN Z;  2RT9 A;  1VQM Z;  3S1M I;  3D9X A;  2VPY A;  3HOY I;  1VQ4 Z;  2JMO A;  4NBA A;  4RVG A;  1Q7Y 2;  2JA7 I;  3CCV 1;  2F4M A;  1KRL A;  1DL6 A;  1NP6 A;  2OZK A;  4NBB A;  2LEX A;  2QR1 B;  1QVG Y;  4MD9 A;  1VQ6 1;  1Y1V S;  4NBC A; 
#chains in the Genus database with same CATH homology
 2KI7 B;  2O53 A;  3NH5 A;  2OTJ 1;  1W2B Y;  3CD6 Z;  4QTU A;  3VTN A;  5AN9 F;  1YI2 Z;  1SFO I;  3CCE Z;  3CCS 1;  2R6M A;  2IZ4 A;  1I3Q I;  1LQL A;  2QRE B;  4DK1 A;  2GTI A;  4A3F I;  3TE5 B;  3MON A;  2E2H I;  4X6A I;  2HF1 A;  2JUB A;  3J81 f;  1TWC I;  1VQ9 1;  3J81 b;  2YAD A;  2EGT A;  4E2Y A;  1Z03 A;  5C44 I;  4E31 A;  2LFU A;  4NH1 C;  1X0T A;  1K9M 1;  1USP A;  3GTM I;  5IP7 I;  4TNU A;  2LIY A;  1X3W A;  1I50 I;  1R9T I;  1RNI A;  2JR6 A;  3LUS A;  3CCV Z;  3H3V J;  4BBS I;  1W2B Z;  3S16 I;  3CCR 1;  2WB1 A;  1VQ6 Z;  4MRI A;  2VUM I;  3NDI A;  2R7Z I;  2VF1 A;  1VQ8 1;  2IZ3 A;  3VMG A;  3S1R I;  1VQO 1;  5C3E I;  4A3M I;  4CL1 A;  2QA4 1;  4A3D I;  2QRC B;  2V8K A;  1YIJ 1;  3GCF A;  5T6B A;  2RHB A;  4BXX I;  3M4O I;  3HKZ A;  4A3J I;  3CCS Z;  4A3G I;  1VQ7 1;  4A3B I;  4Y7N I;  5CM2 M;  3CC7 1;  2P3Y A;  2JNY A;  3CCL 1;  3S15 I;  1VQ9 Z;  1ZB9 A;  4A3I I;  3S1Q I;  3RZD I;  3EER A;  1YUA A;  4EWC A;  3I4N I;  3G4S 1;  1Q86 2;  3IX0 A;  3CC4 Z;  1QYP A;  5D1O B;  2RIQ A;  3CCU 1;  1N2F A;  2DE7 A;  4E2X A;  1K9M 2;  1TWF I;  1Y1V I;  4NB8 A;  2M48 A;  2OTL 1;  1KQS Y;  2M6N A;  1ZH1 A;  3CCR Z;  2PM9 A;  4NFR A;  1NJI 2;  2DE5 A;  1NUI A;  1PFT A;  1WW9 A;  2BJO A;  3CC2 1;  5A2Q f;  1VQ8 Z;  1JJ2 Y;  5A2Q b;  1VQO Z;  4NBF A;  3RZO I;  3CPW Y;  4DQY B;  2QA4 Z;  1QVF Y;  1YJ9 1;  1YIJ Z;  1VQK Z;  4MXU A;  2QLV B;  3IFU A;  2HU9 A;  4XX2 A;  1KD1 1;  4MD7 A;  2Y0S A;  1WII A;  4BY1 I;  1VQ7 Z;  4RV9 A;  5T64 A;  3CC7 Z;  3CCL Z;  1M90 1;  1YUK A;  2JA6 I;  3HOW I;  5C4J I;  3OW2 Y;  2OOY B;  2WAQ A;  3G4S Z;  4BY7 I;  1L1O C;  3CCU Z;  2R92 I;  5FLM I;  1YHQ 1;  1JJ2 Z;  2P28 A;  1Q86 1;  3KIH A;  3GTK I;  2J6A A;  5D1O A;  2OTL Z;  1VQ5 1;  2GU2 A;  1S7M A;  5D1P A;  4DGL A;  1QVG Z;  4E30 A;  4HH4 A;  3CC2 Z;  3CC4 1;  2QRD B;  2OOX B;  3IF8 A;  4RVH A;  1NJI 1;  4A93 I;  3ESW A;  2R93 I;  4MON A;  1YJ9 Z;  4NOZ A;  4A3C I;  2E2I I;  3OW2 Z;  1YIT 1;  3QWU A;  4A3K I;  3BG1 B;  1VLA A;  3G6E 1;  4HGY A;  5FLX f;  1KD1 2;  2W03 A;  5FLX b;  5T67 A;  1ZB8 A;  1VQK 1;  1QF8 A;  1N8R 1;  2NVY I;  1M90 2;  3T4N B;  3GTP I;  3I07 A;  1YHQ Z;  1TWG I;  3I4M I;  3MZK B;  3FKI I;  1P9N A;  3CXC Y;  1Z01 A;  3FQQ A;  4E33 A;  1VQ5 Z;  3VB9 A;  3G71 1;  1I6H I;  4NBD A;  3KIF A;  1S72 1;  4RVF A;  2ZAE B;  3S1N I;  4NBG A;  3J7A 4;  3F3P C;  3JAM f;  3H0G I;  1K83 I;  1VQN 1;  3JAM b;  4RVD A;  3F3F C;  3GKQ A;  3GTQ I;  1YIT Z;  3Q87 A;  1K8A 1;  3G6E Z;  2Q51 A;  4E32 A;  2E9H A;  2AKL A;  3D6W A;  3EED A;  1TWA I;  3K7A I;  2QEX 1;  3CCQ Z;  1TWH I;  3J80 f;  1WCM I;  3J80 b;  2RPR A;  2V8I A;  3GTO I;  3NFZ A;  1Y1W I;  2YU9 I;  3HOV I;  4AYB A;  2JA5 I;  5C4X I;  1N8R 2;  2NVT I;  1KC8 1;  3TDH B;  3FQM A;  2O4H A;  1YJW 1;  2JS4 A;  4BBR I;  4NBH A;  1RO2 A;  3VMI A;  1RO4 A;  1KQS Z;  3G71 Z;  1S72 Z;  3S2D I;  2B63 I;  4HGZ A;  4RS4 A;  3CPW Z;  1VQP 1;  3I56 1;  1QVF Z;  4QTT A;  3CCM 1;  4Y52 I;  4MD8 A;  3MZL B;  1K73 1;  1JWH C;  1VQN Z;  4NBE A;  3I55 1;  3M3Y I;  1Z02 A;  3GTL I;  1ML8 A;  1Q82 1;  2K3R A;  4E2W A;  1Q81 1;  3HOU I;  2E2J I;  3VMH A;  2G2K A;  3S17 I;  3P5J B;  2GTH A;  3NH4 A;  2QEX Z;  2Q4Z A;  1K8A 2;  1VQL 1;  1M1K 1;  3NDJ A;  3PO2 I;  1RLY A;  2KPI A;  2QKD A;  3CME 1;  1X3Z A;  2F4O A;  3CCJ 1;  4A3E I;  4A3L I;  3GTG I;  3CCQ 1;  1RO0 A;  1YJW Z;  2NVX I;  1Q7Y 1;  3CMA 1;  2V8J A;  1YJN 1;  1TFI A;  1KC8 2;  3PO3 I;  4E2Z A;  1VQM 1;  2VUG A;  2PK7 A;  2I3C A;  1VQ4 1;  3GTM S;  2OTJ Z;  3S2H I;  2JA8 I;  1VQP Z;  1RQF A;  5LL6 f;  3I56 Z;  4MH4 A;  2K5R A;  3HOX I;  3CCM Z;  5IP9 I;  2W04 A;  4S1T A;  3I55 Z;  3GTJ I;  3PO3 S;  2PMZ A;  3U50 C;  3S14 I;  3CQZ I;  1K73 2;  3CD6 1;  1YI2 1;  3HOZ I;  2H85 A;  3BG0 B;  2NVQ I;  1Q82 2;  3CCE 1;  1Q81 2;  1VQL Z;  3NH8 A;  2DE6 A;  5IT9 f;  5IT9 b;  3CME Z;  1M1K 2;  3CCJ Z;  1USP B;  4NB9 A;  2RBL A;  3CXC Z;  3CMA Z;  1YJN Z;  2RT9 A;  1VQM Z;  3S1M I;  3D9X A;  3HOY I;  1VQ4 Z;  2JMO A;  4NBA A;  4RVG A;  1Q7Y 2;  2JA7 I;  3CCV 1;  2F4M A;  1KRL A;  1DL6 A;  1NP6 A;  2OZK A;  4NBB A;  1QVG Y;  2QR1 B;  4MD9 A;  1VQ6 1;  1Y1V S;  4NBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...