3I55Z

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55Z00
3CCS1 3CCEZ 1VQ9Z 1KQSY 3CC71 1M902 2QEXZ 1YI21 1YHQ1 1VQ71 1QVFZ 1VQP1 2OTL1 1VQLZ 1VQ61 1K8A2 3I55Z 1VQOZ 3CCQ1 3CMA1 1VQ7Z 1VQPZ 1KD12 1YIJ1 3G4S1 3CCJZ 1KD11 1N8R1 3CPWZ 3CCLZ 1VQMZ 1Q7Y1 3CD61 1YJNZ 1Q822 3G4SZ 1W2BZ 3I56Z 3G6E1 3CCSZ 1VQK1 1VQ5Z 1N8R2 1YJ9Z 1JJ2Y 1Q861 1K731 1VQKZ 1YJW1 2QEX1 1VQNZ 1NJI2 1VQ81 1JJ2Z 3CMEZ 2OTLZ 1YJN1 3G711 1YIT1 1QVGZ 3CD6Z 1W2BY 3CMAZ 1VQ8Z 1K8A1 3CCU1 3CPWY 1KQSZ 1NJI1 1YJ91 3CC21 3CCM1 3CC4Z 3CCL1 1VQM1 1YITZ 1VQO1 1Q811 1VQ91 1YHQZ 3OW2Z 1VQ4Z 1M1K2 2QA4Z 3CCJ1 3CCE1 1YJWZ 3CC2Z 3CCMZ 3I551 1K9M1 3CCRZ 1K732 1Q862 2OTJ1 1YI2Z 3OW2Y 1S72Z 3CXCZ 3G6EZ 1KC82 3CCVZ 1KC81 1VQ41 3G71Z 2QA41 1K9M2 3CME1 1QVFY 1YIJZ 3CC41 2OTJZ 1Q7Y2 3CCV1 1M1K1 3CCR1 1VQL1 1VQ6Z 1VQ51 1Q821 1M901 1VQN1 1S721 3I561 3CCQZ 1QVGY 3CCUZ 3CC7Z 1Q812 3CXCY
chains in the Genus database with same CATH superfamily
2JIOA 4A3EI 1YUAA 4HGYA 1KQSY 2V8JA 1M902 2QEXZ 1YI21 3VMHA 1VQ71 5C4JI 4DGLA 4BXXI 3EEDA 1K8A2 2JIQA 2OOYB 3I55Z 2NVTI 2VPYA 1RO4A 1USPA 2E2JI 3TE5B 1ZB8A 4A3II 4NBGA 2R7ZI 3J81f 3PO2I 3S2DI 1KD11 3CCLZ 1Q7Y1 2F4MA 1RNIA 5T6BA 1Q822 2E2HI 4E2XA 2K5RA 3CCSZ 2LFUA 1VQ5Z 2RT9A 2QLVB 2EGTA 2GTHA 3D9XA 3FQQA 1VQKZ 1VQNZ 1L1OC 1JJ2Z 3S2HI 4X6AI 3G711 1USPB 2JIRA 3S1RI 3CD6Z 4MONA 3S1QI 1ZB9A 3FKII 1K8A1 3CCU1 3M4OI 3D2LA 5IT9f 2JA7I 5FLXf 5LL6f 2Y0SA 4Y7NI 1TFIA 1N2FA 1Z02A 4HH4A 1YHQZ 2VPXA 1VQ4Z 3K7AI 4MRIA 4MD8A 1Z03A 3CCE1 1K9M1 1JWHC 3F3FC 2K3RA 3J81b 3CCVZ 1VQ41 3PO3S 2QA41 1WCMI 3CME1 3GTMS 1YIJZ 3S14I 3CC41 2OTJZ 3NDJA 3CCV1 3MONA 1M1K1 1QXFA 2BJOA 2DE5A 3I561 3CC7Z 2NVQI 1DL6A 4RVDA 1WJ2A 2I3CA 2VF1A 1TWAI 1QF8A 3GTKI 2YU9I 3I07A 4A3GI 4RVHA 4MD9A 2OTL1 1VQLZ 1RLYA 3IR7A 4NBHA 2JUBA 4RS4A 3GTLI 5IT9b 1RO2A 3CMA1 1VQ7Z 2W03A 2RIQA 3HOWI 2G2KA 4NBDA 4A3MI 2WB1A 1N8R1 1RO0A 2E2II 3CD61 2R93I 1X3WA 5D1OA 2DE7A 3NDIA 4E33A 1W2BZ 4BY1I 3G6E1 3KIHA 1Q861 4RVFA 1VQ81 3HOZI 1YUKA 4BBSI 3I4MI 5C4XI 4NOZA 4TNUA 3S15I 1W2BY 2JS4A 5D1OB 1VQ8Z 4NB9A 4QTTA 3CPWY 1ML8A 1NJI1 1SIWA 2NAPA 1YJ91 2AYDA 4A3FI 3LUSA 3CCM1 4E2WA 1VQM1 3J7A4 3D6WA 2P3YA 1VQ91 2JIPA 1Y8CA 1Y1VS 2R6MA 2QA4Z 3T4NB 2JA6I 4A3KI 1YJWZ 4A3LI 4E2ZA 4E2YA 3GTGI 1Q862 2LIYA 2KI7B 4MH4A 3G71Z 2VPZA 1QYPA 3H0GI 4A93I 2E9HA 1I6HI 3GTJI 1VQL1 2OOXB 2M6NA 1R9TI 3VTNA 3CCUZ 5IP9I 3CCS1 2B63I 3CCEZ 4A3BI 2JA8I 1WZNA 3CC71 4NBEA 1YHQ1 1QVFZ 1VQP1 3RZDI 1VQ61 2VUGA 1VQOZ 3S17I 1I50I 2M48A 1I3QI 3S1NI 1VQPZ 2F4OA 3J80b 1KD12 3CCJZ 3QWUA 1YJNZ 5T67A 3PO3I 4NFRA 5C44I 3F3PC 4Y52I 2LEXA 3I56Z 5T64A 1Z01A 1N8R2 2V3VA 2IZ3A 1YJ9Z 1JJ2Y 2JNYA 2QEX1 3RZOI 5CM2M 1YJN1 2ZAEB 2JA5I 4QTUA 3GTQI 3HOYI 3VB9A 1TWCI 2Q4ZA 3IF8A 2W04A 1P9NA 1S7MA 2WAQA 3CMAZ 4HGZA 1K83I 2E7ZA 2O53A 2PK7A 1KQSZ 3HOVI 4NBAA 3CC21 3CCL1 3I4NI 4XX2A 3JAMb 1ZH1A 2RBLA 3BG1B 2JIMA 3S16I 1SFOI 2VPWA 4E31A 2QRDB 3CC2Z 4NH1C 3CCMZ 3I551 2GTIA 3IFUA 2R92I 1VLAA 1YI2Z 1RQFA 3OW2Y 3G6EZ 2DE6A 2IV2X 2O4HA 3J80f 4S1TA 2NVXI 1KC81 2V8IA 2HF1A 3KIFA 5C3EI 4E32A 1FDIA 1K9M2 1AA6A 3BG0B 4RVGA 1QVFY 1TWFI 2JR6A 2VUMI 4CL1A 3CCR1 1VQ6Z 1VQ51 1M901 1FDOA 1QVGY 3CCQZ 3NH8A 3IX0A 3NH4A 3CXCY 5IP7I 1TWGI 4BBRI 3GTMI 1VQ9Z 3S1MI 1PFTA 4NBBA 3CQZI 3FQMA 5A2Qf 3CCQ1 4AYBA 2V8KA 3VMGA 2OZKA 3H3VJ 2P28A 1YIJ1 4NBCA 3JAMf 5FLMI 3G4S1 4A3JI 1X0TA 4A3DI 2IZ4A 4E30A 2QKDA 3CPWZ 1VQMZ 2RHBA 2NVYI 2Q51A 3TDHB 4A3CI 4NBFA 3GTPI 4RV9A 3G4SZ 2H85A 1LQLA 1VQK1 2GU2A 2KPIA 2QRCB 1KRLA 4DK1A 1K731 1YJW1 2PM9A 5AN9F 3HKZA 2QREB 2HU9A 1NJI2 2RPRA 3CMEZ 2OTLZ 2QR1B 1YIT1 1QVGZ 3U50C 2JMOA 3GCFA 2V45A 3NH5A 4EWCA 1Y1VI 3M3YI 3HOUI 1Q16A 1NUIA 1Y1WI 3CC4Z 1YITZ 1VQO1 1Q811 3GKQA 3OW2Z 1M1K2 3MZKB 4MD7A 3GTOI 3CCJ1 4DQYB 3VMIA 1TWHI 2PMZA 1X3ZA 3CCRZ 2AKLA 1K732 2J6AA 5A2Qb 2OTJ1 1S72Z 1NP6A 3CXCZ 3EERA 3NFZA 1KC82 3MZLB 3Q87A 1WIIA 1Q7Y2 4BY7I 4NB8A 3P5JB 5FLXb 1Q821 3ESWA 1VQN1 4MXUA 1S721 2YADA 1WW9A 5D1PA 1Q812 3HOXI
chains in the Genus database with same CATH topology
4A3EI 1YUAA 4HGYA 1KQSY 2V8JA 1M902 2QEXZ 1YI21 3VMHA 1VQ71 5C4JI 4DGLA 4BXXI 3EEDA 1K8A2 2OOYB 3I55Z 2NVTI 1RO4A 1USPA 2E2JI 3TE5B 1ZB8A 4A3II 4NBGA 2R7ZI 3J81f 3PO2I 3S2DI 1KD11 3CCLZ 1Q7Y1 2F4MA 1RNIA 5T6BA 1Q822 2E2HI 4E2XA 2K5RA 3CCSZ 2LFUA 1VQ5Z 2RT9A 2QLVB 2EGTA 2GTHA 3D9XA 3FQQA 1VQKZ 1VQNZ 1L1OC 1JJ2Z 3S2HI 4X6AI 3G711 1USPB 3S1RI 3CD6Z 4MONA 3S1QI 1ZB9A 3FKII 1K8A1 3CCU1 3M4OI 5IT9f 2JA7I 5FLXf 5LL6f 2Y0SA 4Y7NI 1TFIA 1N2FA 1Z02A 4HH4A 1YHQZ 1VQ4Z 3K7AI 4MRIA 4MD8A 1Z03A 3CCE1 1K9M1 1JWHC 3F3FC 2K3RA 3J81b 3CCVZ 1VQ41 3PO3S 2QA41 1WCMI 3CME1 3GTMS 1YIJZ 3S14I 3CC41 2OTJZ 3NDJA 3CCV1 3MONA 1M1K1 2BJOA 2DE5A 3I561 3CC7Z 2NVQI 1DL6A 4RVDA 2I3CA 2VF1A 1TWAI 1QF8A 3GTKI 2YU9I 3I07A 4A3GI 4RVHA 4MD9A 2OTL1 1VQLZ 1RLYA 4NBHA 2JUBA 4RS4A 3GTLI 5IT9b 1RO2A 3CMA1 1VQ7Z 2W03A 2RIQA 3HOWI 2G2KA 4NBDA 4A3MI 2WB1A 1N8R1 1RO0A 2E2II 3CD61 2R93I 1X3WA 5D1OA 2DE7A 3NDIA 1W2BZ 4E33A 4BY1I 3G6E1 3KIHA 1Q861 4RVFA 1VQ81 3HOZI 1YUKA 4BBSI 3I4MI 5C4XI 4NOZA 4TNUA 3S15I 1W2BY 2JS4A 5D1OB 1VQ8Z 4NB9A 4QTTA 3CPWY 1ML8A 1NJI1 1YJ91 4A3FI 3LUSA 3CCM1 4E2WA 1VQM1 3J7A4 3D6WA 2P3YA 1VQ91 1Y1VS 2R6MA 2QA4Z 3T4NB 2JA6I 4A3KI 1YJWZ 4A3LI 4E2ZA 4E2YA 3GTGI 1Q862 2LIYA 2KI7B 4MH4A 3G71Z 1QYPA 3H0GI 4A93I 2E9HA 1I6HI 3GTJI 1VQL1 2OOXB 2M6NA 1R9TI 3VTNA 3CCUZ 5IP9I 3CCS1 2B63I 3CCEZ 4A3BI 2JA8I 3CC71 4NBEA 1YHQ1 1QVFZ 1VQP1 3RZDI 1VQ61 2VUGA 1VQOZ 3S17I 1I50I 2M48A 1I3QI 3S1NI 1VQPZ 2F4OA 3J80b 1KD12 3CCJZ 3QWUA 1YJNZ 5T67A 3PO3I 4NFRA 5C44I 3F3PC 4Y52I 3I56Z 5T64A 1Z01A 1N8R2 2IZ3A 1YJ9Z 1JJ2Y 2JNYA 2QEX1 3RZOI 5CM2M 1YJN1 2ZAEB 2JA5I 4QTUA 3GTQI 3HOYI 1TWCI 2Q4ZA 3IF8A 3VB9A 2W04A 1P9NA 1S7MA 2WAQA 3CMAZ 4HGZA 1K83I 2O53A 2PK7A 1KQSZ 3HOVI 4NBAA 3CC21 3CCL1 3I4NI 4XX2A 3JAMb 1ZH1A 2RBLA 3BG1B 3S16I 1SFOI 4E31A 2QRDB 3CC2Z 4NH1C 3CCMZ 3I551 2GTIA 3IFUA 2R92I 1VLAA 1YI2Z 1RQFA 3OW2Y 3G6EZ 2DE6A 2O4HA 3J80f 4S1TA 2NVXI 1KC81 2V8IA 2HF1A 3KIFA 5C3EI 4E32A 1K9M2 3BG0B 4RVGA 1QVFY 1TWFI 2JR6A 2VUMI 4CL1A 3CCR1 1VQ6Z 1VQ51 1M901 1QVGY 3CCQZ 3NH8A 3IX0A 3NH4A 3CXCY 5IP7I 1TWGI 4BBRI 3GTMI 1VQ9Z 3S1MI 1PFTA 4NBBA 3CQZI 3FQMA 5A2Qf 3CCQ1 4AYBA 2V8KA 3VMGA 2OZKA 3H3VJ 2P28A 1YIJ1 4NBCA 3JAMf 5FLMI 3G4S1 4A3JI 1X0TA 4A3DI 2IZ4A 4E30A 2QKDA 3CPWZ 1VQMZ 2RHBA 2NVYI 2Q51A 3TDHB 4A3CI 4NBFA 3GTPI 4RV9A 3G4SZ 2H85A 1LQLA 1VQK1 2GU2A 2KPIA 2QRCB 1KRLA 4DK1A 1K731 1YJW1 2PM9A 5AN9F 3HKZA 2QREB 2HU9A 1NJI2 2RPRA 3CMEZ 2OTLZ 2QR1B 1YIT1 1QVGZ 3U50C 2JMOA 3GCFA 3NH5A 4EWCA 1Y1VI 3M3YI 3HOUI 1NUIA 1Y1WI 3CC4Z 1YITZ 1VQO1 1Q811 3GKQA 3OW2Z 1M1K2 3MZKB 4MD7A 3GTOI 3CCJ1 4DQYB 3VMIA 1TWHI 2PMZA 1X3ZA 3CCRZ 2AKLA 1K732 2J6AA 5A2Qb 2OTJ1 1S72Z 1NP6A 3CXCZ 3EERA 3NFZA 1KC82 3MZLB 3Q87A 1WIIA 1Q7Y2 4BY7I 4NB8A 3P5JB 5FLXb 1Q821 3ESWA 1VQN1 4MXUA 1S721 2YADA 1WW9A 5D1PA 1Q812 3HOXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS 1;  3CCE Z;  1VQ9 Z;  1KQS Y;  3CC7 1;  1M90 2;  2QEX Z;  1YI2 1;  1YHQ 1;  1VQ7 1;  1QVF Z;  1VQP 1;  2OTL 1;  1VQL Z;  1VQ6 1;  1K8A 2;  3I55 Z;  1VQO Z;  3CCQ 1;  3CMA 1;  1VQ7 Z;  1VQP Z;  1KD1 2;  1YIJ 1;  3G4S 1;  3CCJ Z;  1KD1 1;  1N8R 1;  3CPW Z;  3CCL Z;  1VQM Z;  1Q7Y 1;  3CD6 1;  1YJN Z;  1Q82 2;  3G4S Z;  1W2B Z;  3I56 Z;  3G6E 1;  3CCS Z;  1VQK 1;  1VQ5 Z;  1N8R 2;  1YJ9 Z;  1JJ2 Y;  1Q86 1;  1K73 1;  1VQK Z;  1YJW 1;  2QEX 1;  1VQN Z;  1NJI 2;  1VQ8 1;  1JJ2 Z;  3CME Z;  2OTL Z;  1YJN 1;  3G71 1;  1YIT 1;  1QVG Z;  3CD6 Z;  1W2B Y;  3CMA Z;  1VQ8 Z;  1K8A 1;  3CCU 1;  3CPW Y;  1KQS Z;  1NJI 1;  1YJ9 1;  3CC2 1;  3CCM 1;  3CC4 Z;  3CCL 1;  1VQM 1;  1YIT Z;  1VQO 1;  1Q81 1;  1VQ9 1;  1YHQ Z;  3OW2 Z;  1VQ4 Z;  1M1K 2;  2QA4 Z;  3CCJ 1;  3CCE 1;  1YJW Z;  3CC2 Z;  3CCM Z;  3I55 1;  1K9M 1;  3CCR Z;  1K73 2;  1Q86 2;  2OTJ 1;  1YI2 Z;  3OW2 Y;  1S72 Z;  3CXC Z;  3G6E Z;  1KC8 2;  3CCV Z;  1KC8 1;  1VQ4 1;  3G71 Z;  2QA4 1;  1K9M 2;  3CME 1;  1QVF Y;  1YIJ Z;  3CC4 1;  2OTJ Z;  1Q7Y 2;  3CCV 1;  1M1K 1;  3CCR 1;  1VQL 1;  1VQ6 Z;  1VQ5 1;  1Q82 1;  1M90 1;  1VQN 1;  1S72 1;  3I56 1;  3CCQ Z;  1QVG Y;  3CCU Z;  3CC7 Z;  1Q81 2;  3CXC Y; 
#chains in the Genus database with same CATH topology
 2JIO A;  4A3E I;  1YUA A;  4HGY A;  1KQS Y;  2V8J A;  1M90 2;  2QEX Z;  1YI2 1;  3VMH A;  1VQ7 1;  5C4J I;  4DGL A;  4BXX I;  3EED A;  1K8A 2;  2JIQ A;  2OOY B;  3I55 Z;  2NVT I;  2VPY A;  1RO4 A;  1USP A;  2E2J I;  3TE5 B;  1ZB8 A;  4A3I I;  4NBG A;  2R7Z I;  3J81 f;  3PO2 I;  3S2D I;  1KD1 1;  3CCL Z;  1Q7Y 1;  2F4M A;  1RNI A;  5T6B A;  1Q82 2;  2E2H I;  4E2X A;  2K5R A;  3CCS Z;  2LFU A;  1VQ5 Z;  2RT9 A;  2QLV B;  2EGT A;  2GTH A;  3D9X A;  3FQQ A;  1VQK Z;  1VQN Z;  1L1O C;  1JJ2 Z;  3S2H I;  4X6A I;  3G71 1;  1USP B;  2JIR A;  3S1R I;  3CD6 Z;  4MON A;  3S1Q I;  1ZB9 A;  3FKI I;  1K8A 1;  3CCU 1;  3M4O I;  3D2L A;  5IT9 f;  2JA7 I;  5FLX f;  5LL6 f;  2Y0S A;  4Y7N I;  1TFI A;  1N2F A;  1Z02 A;  4HH4 A;  1YHQ Z;  2VPX A;  1VQ4 Z;  3K7A I;  4MRI A;  4MD8 A;  1Z03 A;  3CCE 1;  1K9M 1;  1JWH C;  3F3F C;  2K3R A;  3J81 b;  3CCV Z;  1VQ4 1;  3PO3 S;  2QA4 1;  1WCM I;  3CME 1;  3GTM S;  1YIJ Z;  3S14 I;  3CC4 1;  2OTJ Z;  3NDJ A;  3CCV 1;  3MON A;  1M1K 1;  1QXF A;  2BJO A;  2DE5 A;  3I56 1;  3CC7 Z;  2NVQ I;  1DL6 A;  4RVD A;  1WJ2 A;  2I3C A;  2VF1 A;  1TWA I;  1QF8 A;  3GTK I;  2YU9 I;  3I07 A;  4A3G I;  4RVH A;  4MD9 A;  2OTL 1;  1VQL Z;  1RLY A;  3IR7 A;  4NBH A;  2JUB A;  4RS4 A;  3GTL I;  5IT9 b;  1RO2 A;  3CMA 1;  1VQ7 Z;  2W03 A;  2RIQ A;  3HOW I;  2G2K A;  4NBD A;  4A3M I;  2WB1 A;  1N8R 1;  1RO0 A;  2E2I I;  3CD6 1;  2R93 I;  1X3W A;  5D1O A;  2DE7 A;  3NDI A;  4E33 A;  1W2B Z;  4BY1 I;  3G6E 1;  3KIH A;  1Q86 1;  4RVF A;  1VQ8 1;  3HOZ I;  1YUK A;  4BBS I;  3I4M I;  5C4X I;  4NOZ A;  4TNU A;  3S15 I;  1W2B Y;  2JS4 A;  5D1O B;  1VQ8 Z;  4NB9 A;  4QTT A;  3CPW Y;  1ML8 A;  1NJI 1;  1SIW A;  2NAP A;  1YJ9 1;  2AYD A;  4A3F I;  3LUS A;  3CCM 1;  4E2W A;  1VQM 1;  3J7A 4;  3D6W A;  2P3Y A;  1VQ9 1;  2JIP A;  1Y8C A;  1Y1V S;  2R6M A;  2QA4 Z;  3T4N B;  2JA6 I;  4A3K I;  1YJW Z;  4A3L I;  4E2Z A;  4E2Y A;  3GTG I;  1Q86 2;  2LIY A;  2KI7 B;  4MH4 A;  3G71 Z;  2VPZ A;  1QYP A;  3H0G I;  4A93 I;  2E9H A;  1I6H I;  3GTJ I;  1VQL 1;  2OOX B;  2M6N A;  1R9T I;  3VTN A;  3CCU Z;  5IP9 I;  3CCS 1;  2B63 I;  3CCE Z;  4A3B I;  2JA8 I;  1WZN A;  3CC7 1;  4NBE A;  1YHQ 1;  1QVF Z;  1VQP 1;  3RZD I;  1VQ6 1;  2VUG A;  1VQO Z;  3S17 I;  1I50 I;  2M48 A;  1I3Q I;  3S1N I;  1VQP Z;  2F4O A;  3J80 b;  1KD1 2;  3CCJ Z;  3QWU A;  1YJN Z;  5T67 A;  3PO3 I;  4NFR A;  5C44 I;  3F3P C;  4Y52 I;  2LEX A;  3I56 Z;  5T64 A;  1Z01 A;  1N8R 2;  2V3V A;  2IZ3 A;  1YJ9 Z;  1JJ2 Y;  2JNY A;  2QEX 1;  3RZO I;  5CM2 M;  1YJN 1;  2ZAE B;  2JA5 I;  4QTU A;  3GTQ I;  3HOY I;  3VB9 A;  1TWC I;  2Q4Z A;  3IF8 A;  2W04 A;  1P9N A;  1S7M A;  2WAQ A;  3CMA Z;  4HGZ A;  1K83 I;  2E7Z A;  2O53 A;  2PK7 A;  1KQS Z;  3HOV I;  4NBA A;  3CC2 1;  3CCL 1;  3I4N I;  4XX2 A;  3JAM b;  1ZH1 A;  2RBL A;  3BG1 B;  2JIM A;  3S16 I;  1SFO I;  2VPW A;  4E31 A;  2QRD B;  3CC2 Z;  4NH1 C;  3CCM Z;  3I55 1;  2GTI A;  3IFU A;  2R92 I;  1VLA A;  1YI2 Z;  1RQF A;  3OW2 Y;  3G6E Z;  2DE6 A;  2IV2 X;  2O4H A;  3J80 f;  4S1T A;  2NVX I;  1KC8 1;  2V8I A;  2HF1 A;  3KIF A;  5C3E I;  4E32 A;  1FDI A;  1K9M 2;  1AA6 A;  3BG0 B;  4RVG A;  1QVF Y;  1TWF I;  2JR6 A;  2VUM I;  4CL1 A;  3CCR 1;  1VQ6 Z;  1VQ5 1;  1M90 1;  1FDO A;  1QVG Y;  3CCQ Z;  3NH8 A;  3IX0 A;  3NH4 A;  3CXC Y;  5IP7 I;  1TWG I;  4BBR I;  3GTM I;  1VQ9 Z;  3S1M I;  1PFT A;  4NBB A;  3CQZ I;  3FQM A;  5A2Q f;  3CCQ 1;  4AYB A;  2V8K A;  3VMG A;  2OZK A;  3H3V J;  2P28 A;  1YIJ 1;  4NBC A;  3JAM f;  5FLM I;  3G4S 1;  4A3J I;  1X0T A;  4A3D I;  2IZ4 A;  4E30 A;  2QKD A;  3CPW Z;  1VQM Z;  2RHB A;  2NVY I;  2Q51 A;  3TDH B;  4A3C I;  4NBF A;  3GTP I;  4RV9 A;  3G4S Z;  2H85 A;  1LQL A;  1VQK 1;  2GU2 A;  2KPI A;  2QRC B;  1KRL A;  4DK1 A;  1K73 1;  1YJW 1;  2PM9 A;  5AN9 F;  3HKZ A;  2QRE B;  2HU9 A;  1NJI 2;  2RPR A;  3CME Z;  2OTL Z;  2QR1 B;  1YIT 1;  1QVG Z;  3U50 C;  2JMO A;  3GCF A;  2V45 A;  3NH5 A;  4EWC A;  1Y1V I;  3M3Y I;  3HOU I;  1Q16 A;  1NUI A;  1Y1W I;  3CC4 Z;  1YIT Z;  1VQO 1;  1Q81 1;  3GKQ A;  3OW2 Z;  1M1K 2;  3MZK B;  4MD7 A;  3GTO I;  3CCJ 1;  4DQY B;  3VMI A;  1TWH I;  2PMZ A;  1X3Z A;  3CCR Z;  2AKL A;  1K73 2;  2J6A A;  5A2Q b;  2OTJ 1;  1S72 Z;  1NP6 A;  3CXC Z;  3EER A;  3NFZ A;  1KC8 2;  3MZL B;  3Q87 A;  1WII A;  1Q7Y 2;  4BY7 I;  4NB8 A;  3P5J B;  5FLX b;  1Q82 1;  3ESW A;  1VQN 1;  4MXU A;  1S72 1;  2YAD A;  1WW9 A;  5D1P A;  1Q81 2;  3HOX I; 
#chains in the Genus database with same CATH homology
 4A3E I;  1YUA A;  4HGY A;  1KQS Y;  2V8J A;  1M90 2;  2QEX Z;  1YI2 1;  3VMH A;  1VQ7 1;  5C4J I;  4DGL A;  4BXX I;  3EED A;  1K8A 2;  2OOY B;  3I55 Z;  2NVT I;  1RO4 A;  1USP A;  2E2J I;  3TE5 B;  1ZB8 A;  4A3I I;  4NBG A;  2R7Z I;  3J81 f;  3PO2 I;  3S2D I;  1KD1 1;  3CCL Z;  1Q7Y 1;  2F4M A;  1RNI A;  5T6B A;  1Q82 2;  2E2H I;  4E2X A;  2K5R A;  3CCS Z;  2LFU A;  1VQ5 Z;  2RT9 A;  2QLV B;  2EGT A;  2GTH A;  3D9X A;  3FQQ A;  1VQK Z;  1VQN Z;  1L1O C;  1JJ2 Z;  3S2H I;  4X6A I;  3G71 1;  1USP B;  3S1R I;  3CD6 Z;  4MON A;  3S1Q I;  1ZB9 A;  3FKI I;  1K8A 1;  3CCU 1;  3M4O I;  5IT9 f;  2JA7 I;  5FLX f;  5LL6 f;  2Y0S A;  4Y7N I;  1TFI A;  1N2F A;  1Z02 A;  4HH4 A;  1YHQ Z;  1VQ4 Z;  3K7A I;  4MRI A;  4MD8 A;  1Z03 A;  3CCE 1;  1K9M 1;  1JWH C;  3F3F C;  2K3R A;  3J81 b;  3CCV Z;  1VQ4 1;  3PO3 S;  2QA4 1;  1WCM I;  3CME 1;  3GTM S;  1YIJ Z;  3S14 I;  3CC4 1;  2OTJ Z;  3NDJ A;  3CCV 1;  3MON A;  1M1K 1;  2BJO A;  2DE5 A;  3I56 1;  3CC7 Z;  2NVQ I;  1DL6 A;  4RVD A;  2I3C A;  2VF1 A;  1TWA I;  1QF8 A;  3GTK I;  2YU9 I;  3I07 A;  4A3G I;  4RVH A;  4MD9 A;  2OTL 1;  1VQL Z;  1RLY A;  4NBH A;  2JUB A;  4RS4 A;  3GTL I;  5IT9 b;  1RO2 A;  3CMA 1;  1VQ7 Z;  2W03 A;  2RIQ A;  3HOW I;  2G2K A;  4NBD A;  4A3M I;  2WB1 A;  1N8R 1;  1RO0 A;  2E2I I;  3CD6 1;  2R93 I;  1X3W A;  5D1O A;  2DE7 A;  3NDI A;  1W2B Z;  4E33 A;  4BY1 I;  3G6E 1;  3KIH A;  1Q86 1;  4RVF A;  1VQ8 1;  3HOZ I;  1YUK A;  4BBS I;  3I4M I;  5C4X I;  4NOZ A;  4TNU A;  3S15 I;  1W2B Y;  2JS4 A;  5D1O B;  1VQ8 Z;  4NB9 A;  4QTT A;  3CPW Y;  1ML8 A;  1NJI 1;  1YJ9 1;  4A3F I;  3LUS A;  3CCM 1;  4E2W A;  1VQM 1;  3J7A 4;  3D6W A;  2P3Y A;  1VQ9 1;  1Y1V S;  2R6M A;  2QA4 Z;  3T4N B;  2JA6 I;  4A3K I;  1YJW Z;  4A3L I;  4E2Z A;  4E2Y A;  3GTG I;  1Q86 2;  2LIY A;  2KI7 B;  4MH4 A;  3G71 Z;  1QYP A;  3H0G I;  4A93 I;  2E9H A;  1I6H I;  3GTJ I;  1VQL 1;  2OOX B;  2M6N A;  1R9T I;  3VTN A;  3CCU Z;  5IP9 I;  3CCS 1;  2B63 I;  3CCE Z;  4A3B I;  2JA8 I;  3CC7 1;  4NBE A;  1YHQ 1;  1QVF Z;  1VQP 1;  3RZD I;  1VQ6 1;  2VUG A;  1VQO Z;  3S17 I;  1I50 I;  2M48 A;  1I3Q I;  3S1N I;  1VQP Z;  2F4O A;  3J80 b;  1KD1 2;  3CCJ Z;  3QWU A;  1YJN Z;  5T67 A;  3PO3 I;  4NFR A;  5C44 I;  3F3P C;  4Y52 I;  3I56 Z;  5T64 A;  1Z01 A;  1N8R 2;  2IZ3 A;  1YJ9 Z;  1JJ2 Y;  2JNY A;  2QEX 1;  3RZO I;  5CM2 M;  1YJN 1;  2ZAE B;  2JA5 I;  4QTU A;  3GTQ I;  3HOY I;  1TWC I;  2Q4Z A;  3IF8 A;  3VB9 A;  2W04 A;  1P9N A;  1S7M A;  2WAQ A;  3CMA Z;  4HGZ A;  1K83 I;  2O53 A;  2PK7 A;  1KQS Z;  3HOV I;  4NBA A;  3CC2 1;  3CCL 1;  3I4N I;  4XX2 A;  3JAM b;  1ZH1 A;  2RBL A;  3BG1 B;  3S16 I;  1SFO I;  4E31 A;  2QRD B;  3CC2 Z;  4NH1 C;  3CCM Z;  3I55 1;  2GTI A;  3IFU A;  2R92 I;  1VLA A;  1YI2 Z;  1RQF A;  3OW2 Y;  3G6E Z;  2DE6 A;  2O4H A;  3J80 f;  4S1T A;  2NVX I;  1KC8 1;  2V8I A;  2HF1 A;  3KIF A;  5C3E I;  4E32 A;  1K9M 2;  3BG0 B;  4RVG A;  1QVF Y;  1TWF I;  2JR6 A;  2VUM I;  4CL1 A;  3CCR 1;  1VQ6 Z;  1VQ5 1;  1M90 1;  1QVG Y;  3CCQ Z;  3NH8 A;  3IX0 A;  3NH4 A;  3CXC Y;  5IP7 I;  1TWG I;  4BBR I;  3GTM I;  1VQ9 Z;  3S1M I;  1PFT A;  4NBB A;  3CQZ I;  3FQM A;  5A2Q f;  3CCQ 1;  4AYB A;  2V8K A;  3VMG A;  2OZK A;  3H3V J;  2P28 A;  1YIJ 1;  4NBC A;  3JAM f;  5FLM I;  3G4S 1;  4A3J I;  1X0T A;  4A3D I;  2IZ4 A;  4E30 A;  2QKD A;  3CPW Z;  1VQM Z;  2RHB A;  2NVY I;  2Q51 A;  3TDH B;  4A3C I;  4NBF A;  3GTP I;  4RV9 A;  3G4S Z;  2H85 A;  1LQL A;  1VQK 1;  2GU2 A;  2KPI A;  2QRC B;  1KRL A;  4DK1 A;  1K73 1;  1YJW 1;  2PM9 A;  5AN9 F;  3HKZ A;  2QRE B;  2HU9 A;  1NJI 2;  2RPR A;  3CME Z;  2OTL Z;  2QR1 B;  1YIT 1;  1QVG Z;  3U50 C;  2JMO A;  3GCF A;  3NH5 A;  4EWC A;  1Y1V I;  3M3Y I;  3HOU I;  1NUI A;  1Y1W I;  3CC4 Z;  1YIT Z;  1VQO 1;  1Q81 1;  3GKQ A;  3OW2 Z;  1M1K 2;  3MZK B;  4MD7 A;  3GTO I;  3CCJ 1;  4DQY B;  3VMI A;  1TWH I;  2PMZ A;  1X3Z A;  3CCR Z;  2AKL A;  1K73 2;  2J6A A;  5A2Q b;  2OTJ 1;  1S72 Z;  1NP6 A;  3CXC Z;  3EER A;  3NFZ A;  1KC8 2;  3MZL B;  3Q87 A;  1WII A;  1Q7Y 2;  4BY7 I;  4NB8 A;  3P5J B;  5FLX b;  1Q82 1;  3ESW A;  1VQN 1;  4MXU A;  1S72 1;  2YAD A;  1WW9 A;  5D1P A;  1Q81 2;  3HOX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...