3I55Z

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55Z00
2QA41 3CC7Z 1YHQ1 3CCRZ 1VQM1 3CC41 3I551 3CCJ1 3CC4Z 1Q811 1K9M1 1VQ61 3CCL1 3CMAZ 1VQPZ 1N8R2 1YJW1 1K8A2 1QVGY 2QEXZ 3CCM1 3CCVZ 1VQ91 3CCEZ 3CCQ1 1W2BZ 1JJ2Z 3CME1 1KQSZ 1VQ9Z 1M1K2 1YITZ 1Q822 3G4S1 3CD6Z 1VQ81 1YJN1 3CC2Z 3G711 1KD11 1Q7Y1 1M902 1YJNZ 2QA4Z 1KC81 1YHQZ 3OW2Y 1YJ91 1VQMZ 3I55Z 3CCJZ 3CCS1 1K731 2OTJ1 1VQ71 1VQL1 3CXCZ 1VQ6Z 3CCLZ 1QVGZ 1VQ7Z 1VQLZ 1S721 1YJWZ 3CPWZ 1Q812 1Q861 1K9M2 3CCU1 1S72Z 1VQK1 1QVFY 3CCUZ 3CCMZ 1VQKZ 3I561 3CCQZ 2OTL1 3CMEZ 3I56Z 1NJI1 1VQN1 3G4SZ 2OTLZ 1VQ8Z 3G71Z 1VQ51 1KD12 1Q7Y2 1YJ9Z 3CCSZ 1KC82 2OTJZ 1VQ41 1YI21 1W2BY 1K732 1KQSY 1YI2Z 3CCR1 1Q862 3G6E1 1VQO1 1N8R1 3G6EZ 1K8A1 3CMA1 1VQP1 1VQOZ 1VQNZ 3CXCY 3OW2Z 1YIJ1 1NJI2 2QEX1 3CCV1 1VQ5Z 3CPWY 1M1K1 3CCE1 1YIJZ 1Q821 1YIT1 3CD61 1JJ2Y 1M901 1VQ4Z 3CC21 1QVFZ 3CC71
chains in the Genus database with same CATH superfamily
4NBHA 2I3CA 2LIYA 3CC41 2DE6A 1K9M1 3CMAZ 3S17I 4BY1I 1I50I 2QREB 5D1OB 2NVTI 4NB8A 2OZKA 3D6WA 1ZB9A 2VPWA 2W03A 3GKQA 3JAMb 2QEXZ 3HOZI 1JJ2Z 1YITZ 2QLVB 2QKDA 3G4S1 3CD6Z 2BJOA 2JR6A 2H85A 4NH1C 1YJN1 3K7AI 1YUAA 5A2Qf 2R7ZI 1KC81 1YJ91 1USPB 4AYBA 3CCS1 1K731 1VQ71 2E2II 1Z03A 2E7ZA 2R93I 3Q87A 3CPWZ 1Q812 1Q861 3S1QI 1RNIA 1S72Z 5AN9F 2VUGA 1Z01A 3S2DI 1Q16A 3J80b 1I3QI 3KIHA 3CCUZ 3CCMZ 2K5RA 3CMEZ 2G2KA 3I56Z 1VQ8Z 3GTKI 3TDHB 1VQ51 1WZNA 1VLAA 3JAMf 1QXFA 1Y1VI 2OTJZ 1VQ41 1YI21 5T6BA 2P3YA 4E2WA 2V3VA 3CCR1 1K83I 3F3PC 4BY7I 1ZH1A 1TFIA 2WB1A 2RIQA 5D1PA 2IZ3A 1VQOZ 2JA8I 1PFTA 2GU2A 5IT9b 4RVGA 2LEXA 3FQQA 1NJI2 3CCV1 1SFOI 2PM9A 4DQYB 3CPWY 1LQLA 2GTIA 3NH8A 2O53A 3J80f 1QVFZ 3CC71 2RT9A 3GTMI 1RQFA 2QA41 1YHQ1 4QTUA 3HKZA 3CCJ1 1TWHI 4NOZA 3CC4Z 5FLMI 3T4NB 1Q811 3CQZI 3F3FC 5C4XI 1VQPZ 1N8R2 1YJW1 1K8A2 1QVGY 4MH4A 3I4NI 3CCEZ 3IF8A 3TE5B 1KQSZ 3VMGA 3S1MI 4NBDA 2KI7B 1Y8CA 2YU9I 3CC2Z 3NFZA 3M4OI 4E30A 3I07A 3HOUI 1M902 1WW9A 5IT9f 1YJNZ 2QRDB 1ZB8A 4MD7A 3P5JB 1AA6A 2HF1A 3VMIA 1VQMZ 4E2ZA 3I55Z 3H3VJ 4BXXI 1TWFI 3HOXI 1VQL1 3CXCZ 1YUKA 1RLYA 3CCLZ 1RO4A 1VQ6Z 4A3DI 1VQ7Z 2RPRA 3IX0A 2WAQA 4MONA 1QVFY 2JA6I 3MONA 4NB9A 3CCQZ 3D9XA 1X0TA 2JUBA 4A3CI 4NFRA 1NJI1 1VQN1 2JA7I 2E2HI 2NAPA 3G71Z 2KPIA 2QR1B 3NDJA 3VB9A 4TNUA 1DL6A 3GTQI 4A3GI 3S2HI 4A93I 4MD8A 2M6NA 1KQSY 3IFUA 1YI2Z 1N2FA 4RVHA 3NH4A 1WCMI 3BG1B 1N8R1 1K8A1 3CMA1 4MD9A 4HGZA 3CXCY 2JIMA 2EGTA 1YIJ1 2QEX1 4NBBA 4NBEA 4DK1A 1NP6A 2VF1A 1YIT1 4A3LI 3CD61 3FQMA 1JJ2Y 1M901 3J81b 2AYDA 3CC7Z 4NBAA 2Q51A 3M3YI 1QYPA 2AKLA 3S1RI 1Z02A 1X3ZA 2DE7A 4A3KI 1P9NA 2V45A 3HOVI 3FKII 5CM2M 1RO2A 2NVQI 3J7A4 2Y0SA 4A3BI 3CCM1 1VQ91 2E2JI 3QWUA 1W2BZ 3PO2I 3GTLI 3CME1 4QTTA 2Q4ZA 4Y7NI 1M1K2 3H0GI 2VPZA 1Q822 1SIWA 1VQ81 4E33A 5D1OA 3RZOI 4E32A 2M48A 2OOYB 2JS4A 2OTJ1 4Y52I 4S1TA 2JMOA 1VQLZ 2JNYA 4X6AI 3S1NI 2O4HA 1VQK1 3J81f 2JIPA 3S15I 4DGLA 5C3EI 3MZKB 1WJ2A 2IV2X 5T64A 2OTL1 5T67A 2IZ4A 3G4SZ 5LL6f 1X3WA 3GCFA 2JIOA 4E2YA 1KD12 1Q7Y2 1YJ9Z 4A3II 4EWCA 3CCSZ 3VTNA 3MZLB 1W2BY 2V8JA 3S14I 4A3JI 1S7MA 3NDIA 3G6E1 1RO0A 4RV9A 1FDOA 1VQP1 1TWCI 1FDIA 1JWHC 1KRLA 2NVXI 1Y1WI 3GTPI 3OW2Z 4XX2A 3PO3I 1VQ5Z 1M1K1 3CCE1 1YIJZ 1Q821 3GTGI 1L1OC 4RVFA 1Y1VS 4MXUA 2YADA 4NBFA 1VQ4Z 3CC21 5FLXb 2VPXA 1WIIA 3RZDI 2VUMI 4CL1A 3CCRZ 1VQM1 3I551 1VQ61 3CCL1 3EERA 2V8IA 3HOYI 2DE5A 3GTOI 1I6HI 2JIQA 3D2LA 4RVDA 1TWAI 3CCVZ 2JIRA 2RHBA 3I4MI 2VPYA 2P28A 3GTJI 2PK7A 3CCQ1 2RBLA 4E31A 1VQ9Z 3BG0B 1R9TI 4RS4A 4BBRI 3G711 1KD11 1Q7Y1 2JA5I 3GTMS 4HGYA 4MRIA 2QA4Z 2NVYI 5IP7I 1YHQZ 3IR7A 3OW2Y 2B63I 3CCJZ 2J6AA 2K3RA 2GTHA 5C44I 3EEDA 1QVGZ 2PMZA 1S721 1ML8A 1YJWZ 1K9M2 2ZAEB 4HH4A 3CCU1 5FLXf 2V8KA 4NBCA 1QF8A 1VQKZ 2F4OA 3I561 3U50C 1NUIA 2QRCB 2F4MA 2OOXB 3KIFA 2OTLZ 1TWGI 3VMHA 4E2XA 3S16I 4A3MI 3HOWI 3NH5A 1KC82 1K732 2R92I 2E9HA 2HU9A 1Q862 1USPA 1VQO1 2LFUA 3ESWA 3G6EZ 5IP9I 5A2Qb 4A3FI 1VQNZ 2W04A 2R6MA 3PO3S 4BBSI 4NBGA 3LUSA 4A3EI 5C4JI
chains in the Genus database with same CATH topology
4NBHA 2I3CA 2LIYA 3CC41 2DE6A 1K9M1 3CMAZ 3S17I 4BY1I 1I50I 2QREB 5D1OB 2NVTI 4NB8A 2OZKA 3D6WA 1ZB9A 2W03A 3GKQA 3JAMb 2QEXZ 3HOZI 1JJ2Z 1YITZ 2QLVB 2QKDA 3G4S1 3CD6Z 2BJOA 2JR6A 2H85A 4NH1C 1YJN1 3K7AI 1YUAA 5A2Qf 2R7ZI 1KC81 1YJ91 1USPB 4AYBA 3CCS1 1K731 1VQ71 2E2II 1Z03A 2R93I 3Q87A 3CPWZ 1Q812 1Q861 3S1QI 1RNIA 1S72Z 5AN9F 2VUGA 1Z01A 3S2DI 3J80b 1I3QI 3KIHA 3CCUZ 3CCMZ 2K5RA 3CMEZ 2G2KA 3I56Z 1VQ8Z 3GTKI 3TDHB 1VQ51 1VLAA 3JAMf 1Y1VI 2OTJZ 1VQ41 1YI21 5T6BA 2P3YA 4E2WA 3CCR1 1K83I 3F3PC 4BY7I 1ZH1A 1TFIA 2WB1A 2RIQA 5D1PA 2IZ3A 1VQOZ 2JA8I 1PFTA 2GU2A 5IT9b 4RVGA 3FQQA 1NJI2 3CCV1 1SFOI 2PM9A 4DQYB 3CPWY 1LQLA 2GTIA 3NH8A 2O53A 3J80f 1QVFZ 3CC71 2RT9A 3GTMI 1RQFA 2QA41 1YHQ1 4QTUA 3HKZA 3CCJ1 1TWHI 4NOZA 3CC4Z 5FLMI 3T4NB 1Q811 3CQZI 3F3FC 5C4XI 1VQPZ 1N8R2 1YJW1 1K8A2 1QVGY 4MH4A 3I4NI 3CCEZ 3IF8A 3TE5B 1KQSZ 3VMGA 3S1MI 4NBDA 2KI7B 2YU9I 3CC2Z 3NFZA 3M4OI 4E30A 3I07A 3HOUI 1M902 1WW9A 5IT9f 1YJNZ 2QRDB 1ZB8A 4MD7A 3P5JB 2HF1A 3VMIA 1VQMZ 4E2ZA 3I55Z 3H3VJ 4BXXI 1TWFI 3HOXI 1VQL1 3CXCZ 1YUKA 1RLYA 3CCLZ 1RO4A 1VQ6Z 4A3DI 1VQ7Z 2RPRA 3IX0A 2WAQA 4MONA 1QVFY 2JA6I 3MONA 4NB9A 3CCQZ 3D9XA 1X0TA 2JUBA 4A3CI 4NFRA 1NJI1 1VQN1 2JA7I 2E2HI 3G71Z 2KPIA 2QR1B 3NDJA 3VB9A 4TNUA 1DL6A 3GTQI 4A3GI 3S2HI 4A93I 4MD8A 2M6NA 1KQSY 3IFUA 1YI2Z 1N2FA 4RVHA 3NH4A 1WCMI 3BG1B 1N8R1 1K8A1 3CMA1 4MD9A 4HGZA 3CXCY 2EGTA 1YIJ1 2QEX1 4NBBA 4NBEA 4DK1A 1NP6A 2VF1A 1YIT1 4A3LI 3CD61 3FQMA 1JJ2Y 1M901 3J81b 3CC7Z 4NBAA 2Q51A 3M3YI 1QYPA 2AKLA 3S1RI 1Z02A 1X3ZA 2DE7A 4A3KI 1P9NA 3HOVI 3FKII 5CM2M 1RO2A 2NVQI 3J7A4 2Y0SA 4A3BI 3CCM1 1VQ91 2E2JI 3QWUA 1W2BZ 3PO2I 3GTLI 3CME1 4QTTA 2Q4ZA 4Y7NI 1M1K2 3H0GI 1Q822 1VQ81 4E33A 5D1OA 3RZOI 4E32A 2M48A 2OOYB 2JS4A 2OTJ1 4Y52I 4S1TA 2JMOA 1VQLZ 2JNYA 4X6AI 3S1NI 2O4HA 1VQK1 3J81f 3S15I 4DGLA 5C3EI 3MZKB 5T64A 2OTL1 5T67A 2IZ4A 3G4SZ 5LL6f 1X3WA 3GCFA 4E2YA 1KD12 1Q7Y2 1YJ9Z 4A3II 4EWCA 3CCSZ 3VTNA 3MZLB 1W2BY 2V8JA 3S14I 4A3JI 1S7MA 3NDIA 3G6E1 1RO0A 4RV9A 1VQP1 1TWCI 1JWHC 1KRLA 2NVXI 1Y1WI 3GTPI 3OW2Z 4XX2A 3PO3I 1VQ5Z 1M1K1 3CCE1 1YIJZ 1Q821 3GTGI 1L1OC 4RVFA 1Y1VS 4MXUA 2YADA 4NBFA 1VQ4Z 3CC21 5FLXb 1WIIA 3RZDI 2VUMI 4CL1A 3CCRZ 1VQM1 3I551 1VQ61 3CCL1 3EERA 2V8IA 3HOYI 2DE5A 3GTOI 1I6HI 4RVDA 1TWAI 3CCVZ 2RHBA 3I4MI 2P28A 3GTJI 2PK7A 3CCQ1 2RBLA 4E31A 1VQ9Z 3BG0B 1R9TI 4RS4A 4BBRI 3G711 1KD11 1Q7Y1 2JA5I 3GTMS 4HGYA 4MRIA 2QA4Z 2NVYI 5IP7I 1YHQZ 3OW2Y 2B63I 3CCJZ 2J6AA 2K3RA 2GTHA 5C44I 3EEDA 1QVGZ 2PMZA 1S721 1ML8A 1YJWZ 1K9M2 2ZAEB 4HH4A 3CCU1 5FLXf 2V8KA 4NBCA 1QF8A 1VQKZ 2F4OA 3I561 3U50C 1NUIA 2QRCB 2F4MA 2OOXB 3KIFA 2OTLZ 1TWGI 3VMHA 4E2XA 3S16I 4A3MI 3HOWI 3NH5A 1KC82 1K732 2R92I 2E9HA 2HU9A 1Q862 1USPA 1VQO1 2LFUA 3ESWA 3G6EZ 5IP9I 5A2Qb 4A3FI 1VQNZ 2W04A 2R6MA 3PO3S 4BBSI 4NBGA 3LUSA 4A3EI 5C4JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 1;  3CC7 Z;  1YHQ 1;  3CCR Z;  1VQM 1;  3CC4 1;  3I55 1;  3CCJ 1;  3CC4 Z;  1Q81 1;  1K9M 1;  1VQ6 1;  3CCL 1;  3CMA Z;  1VQP Z;  1N8R 2;  1YJW 1;  1K8A 2;  1QVG Y;  2QEX Z;  3CCM 1;  3CCV Z;  1VQ9 1;  3CCE Z;  3CCQ 1;  1W2B Z;  1JJ2 Z;  3CME 1;  1KQS Z;  1VQ9 Z;  1M1K 2;  1YIT Z;  1Q82 2;  3G4S 1;  3CD6 Z;  1VQ8 1;  1YJN 1;  3CC2 Z;  3G71 1;  1KD1 1;  1Q7Y 1;  1M90 2;  1YJN Z;  2QA4 Z;  1KC8 1;  1YHQ Z;  3OW2 Y;  1YJ9 1;  1VQM Z;  3I55 Z;  3CCJ Z;  3CCS 1;  1K73 1;  2OTJ 1;  1VQ7 1;  1VQL 1;  3CXC Z;  1VQ6 Z;  3CCL Z;  1QVG Z;  1VQ7 Z;  1VQL Z;  1S72 1;  1YJW Z;  3CPW Z;  1Q81 2;  1Q86 1;  1K9M 2;  3CCU 1;  1S72 Z;  1VQK 1;  1QVF Y;  3CCU Z;  3CCM Z;  1VQK Z;  3I56 1;  3CCQ Z;  2OTL 1;  3CME Z;  3I56 Z;  1NJI 1;  1VQN 1;  3G4S Z;  2OTL Z;  1VQ8 Z;  3G71 Z;  1VQ5 1;  1KD1 2;  1Q7Y 2;  1YJ9 Z;  3CCS Z;  1KC8 2;  2OTJ Z;  1VQ4 1;  1YI2 1;  1W2B Y;  1K73 2;  1KQS Y;  1YI2 Z;  3CCR 1;  1Q86 2;  3G6E 1;  1VQO 1;  1N8R 1;  3G6E Z;  1K8A 1;  3CMA 1;  1VQP 1;  1VQO Z;  1VQN Z;  3CXC Y;  3OW2 Z;  1YIJ 1;  1NJI 2;  2QEX 1;  3CCV 1;  1VQ5 Z;  3CPW Y;  1M1K 1;  3CCE 1;  1YIJ Z;  1Q82 1;  1YIT 1;  3CD6 1;  1JJ2 Y;  1M90 1;  1VQ4 Z;  3CC2 1;  1QVF Z;  3CC7 1; 
#chains in the Genus database with same CATH topology
 4NBH A;  2I3C A;  2LIY A;  3CC4 1;  2DE6 A;  1K9M 1;  3CMA Z;  3S17 I;  4BY1 I;  1I50 I;  2QRE B;  5D1O B;  2NVT I;  4NB8 A;  2OZK A;  3D6W A;  1ZB9 A;  2VPW A;  2W03 A;  3GKQ A;  3JAM b;  2QEX Z;  3HOZ I;  1JJ2 Z;  1YIT Z;  2QLV B;  2QKD A;  3G4S 1;  3CD6 Z;  2BJO A;  2JR6 A;  2H85 A;  4NH1 C;  1YJN 1;  3K7A I;  1YUA A;  5A2Q f;  2R7Z I;  1KC8 1;  1YJ9 1;  1USP B;  4AYB A;  3CCS 1;  1K73 1;  1VQ7 1;  2E2I I;  1Z03 A;  2E7Z A;  2R93 I;  3Q87 A;  3CPW Z;  1Q81 2;  1Q86 1;  3S1Q I;  1RNI A;  1S72 Z;  5AN9 F;  2VUG A;  1Z01 A;  3S2D I;  1Q16 A;  3J80 b;  1I3Q I;  3KIH A;  3CCU Z;  3CCM Z;  2K5R A;  3CME Z;  2G2K A;  3I56 Z;  1VQ8 Z;  3GTK I;  3TDH B;  1VQ5 1;  1WZN A;  1VLA A;  3JAM f;  1QXF A;  1Y1V I;  2OTJ Z;  1VQ4 1;  1YI2 1;  5T6B A;  2P3Y A;  4E2W A;  2V3V A;  3CCR 1;  1K83 I;  3F3P C;  4BY7 I;  1ZH1 A;  1TFI A;  2WB1 A;  2RIQ A;  5D1P A;  2IZ3 A;  1VQO Z;  2JA8 I;  1PFT A;  2GU2 A;  5IT9 b;  4RVG A;  2LEX A;  3FQQ A;  1NJI 2;  3CCV 1;  1SFO I;  2PM9 A;  4DQY B;  3CPW Y;  1LQL A;  2GTI A;  3NH8 A;  2O53 A;  3J80 f;  1QVF Z;  3CC7 1;  2RT9 A;  3GTM I;  1RQF A;  2QA4 1;  1YHQ 1;  4QTU A;  3HKZ A;  3CCJ 1;  1TWH I;  4NOZ A;  3CC4 Z;  5FLM I;  3T4N B;  1Q81 1;  3CQZ I;  3F3F C;  5C4X I;  1VQP Z;  1N8R 2;  1YJW 1;  1K8A 2;  1QVG Y;  4MH4 A;  3I4N I;  3CCE Z;  3IF8 A;  3TE5 B;  1KQS Z;  3VMG A;  3S1M I;  4NBD A;  2KI7 B;  1Y8C A;  2YU9 I;  3CC2 Z;  3NFZ A;  3M4O I;  4E30 A;  3I07 A;  3HOU I;  1M90 2;  1WW9 A;  5IT9 f;  1YJN Z;  2QRD B;  1ZB8 A;  4MD7 A;  3P5J B;  1AA6 A;  2HF1 A;  3VMI A;  1VQM Z;  4E2Z A;  3I55 Z;  3H3V J;  4BXX I;  1TWF I;  3HOX I;  1VQL 1;  3CXC Z;  1YUK A;  1RLY A;  3CCL Z;  1RO4 A;  1VQ6 Z;  4A3D I;  1VQ7 Z;  2RPR A;  3IX0 A;  2WAQ A;  4MON A;  1QVF Y;  2JA6 I;  3MON A;  4NB9 A;  3CCQ Z;  3D9X A;  1X0T A;  2JUB A;  4A3C I;  4NFR A;  1NJI 1;  1VQN 1;  2JA7 I;  2E2H I;  2NAP A;  3G71 Z;  2KPI A;  2QR1 B;  3NDJ A;  3VB9 A;  4TNU A;  1DL6 A;  3GTQ I;  4A3G I;  3S2H I;  4A93 I;  4MD8 A;  2M6N A;  1KQS Y;  3IFU A;  1YI2 Z;  1N2F A;  4RVH A;  3NH4 A;  1WCM I;  3BG1 B;  1N8R 1;  1K8A 1;  3CMA 1;  4MD9 A;  4HGZ A;  3CXC Y;  2JIM A;  2EGT A;  1YIJ 1;  2QEX 1;  4NBB A;  4NBE A;  4DK1 A;  1NP6 A;  2VF1 A;  1YIT 1;  4A3L I;  3CD6 1;  3FQM A;  1JJ2 Y;  1M90 1;  3J81 b;  2AYD A;  3CC7 Z;  4NBA A;  2Q51 A;  3M3Y I;  1QYP A;  2AKL A;  3S1R I;  1Z02 A;  1X3Z A;  2DE7 A;  4A3K I;  1P9N A;  2V45 A;  3HOV I;  3FKI I;  5CM2 M;  1RO2 A;  2NVQ I;  3J7A 4;  2Y0S A;  4A3B I;  3CCM 1;  1VQ9 1;  2E2J I;  3QWU A;  1W2B Z;  3PO2 I;  3GTL I;  3CME 1;  4QTT A;  2Q4Z A;  4Y7N I;  1M1K 2;  3H0G I;  2VPZ A;  1Q82 2;  1SIW A;  1VQ8 1;  4E33 A;  5D1O A;  3RZO I;  4E32 A;  2M48 A;  2OOY B;  2JS4 A;  2OTJ 1;  4Y52 I;  4S1T A;  2JMO A;  1VQL Z;  2JNY A;  4X6A I;  3S1N I;  2O4H A;  1VQK 1;  3J81 f;  2JIP A;  3S15 I;  4DGL A;  5C3E I;  3MZK B;  1WJ2 A;  2IV2 X;  5T64 A;  2OTL 1;  5T67 A;  2IZ4 A;  3G4S Z;  5LL6 f;  1X3W A;  3GCF A;  2JIO A;  4E2Y A;  1KD1 2;  1Q7Y 2;  1YJ9 Z;  4A3I I;  4EWC A;  3CCS Z;  3VTN A;  3MZL B;  1W2B Y;  2V8J A;  3S14 I;  4A3J I;  1S7M A;  3NDI A;  3G6E 1;  1RO0 A;  4RV9 A;  1FDO A;  1VQP 1;  1TWC I;  1FDI A;  1JWH C;  1KRL A;  2NVX I;  1Y1W I;  3GTP I;  3OW2 Z;  4XX2 A;  3PO3 I;  1VQ5 Z;  1M1K 1;  3CCE 1;  1YIJ Z;  1Q82 1;  3GTG I;  1L1O C;  4RVF A;  1Y1V S;  4MXU A;  2YAD A;  4NBF A;  1VQ4 Z;  3CC2 1;  5FLX b;  2VPX A;  1WII A;  3RZD I;  2VUM I;  4CL1 A;  3CCR Z;  1VQM 1;  3I55 1;  1VQ6 1;  3CCL 1;  3EER A;  2V8I A;  3HOY I;  2DE5 A;  3GTO I;  1I6H I;  2JIQ A;  3D2L A;  4RVD A;  1TWA I;  3CCV Z;  2JIR A;  2RHB A;  3I4M I;  2VPY A;  2P28 A;  3GTJ I;  2PK7 A;  3CCQ 1;  2RBL A;  4E31 A;  1VQ9 Z;  3BG0 B;  1R9T I;  4RS4 A;  4BBR I;  3G71 1;  1KD1 1;  1Q7Y 1;  2JA5 I;  3GTM S;  4HGY A;  4MRI A;  2QA4 Z;  2NVY I;  5IP7 I;  1YHQ Z;  3IR7 A;  3OW2 Y;  2B63 I;  3CCJ Z;  2J6A A;  2K3R A;  2GTH A;  5C44 I;  3EED A;  1QVG Z;  2PMZ A;  1S72 1;  1ML8 A;  1YJW Z;  1K9M 2;  2ZAE B;  4HH4 A;  3CCU 1;  5FLX f;  2V8K A;  4NBC A;  1QF8 A;  1VQK Z;  2F4O A;  3I56 1;  3U50 C;  1NUI A;  2QRC B;  2F4M A;  2OOX B;  3KIF A;  2OTL Z;  1TWG I;  3VMH A;  4E2X A;  3S16 I;  4A3M I;  3HOW I;  3NH5 A;  1KC8 2;  1K73 2;  2R92 I;  2E9H A;  2HU9 A;  1Q86 2;  1USP A;  1VQO 1;  2LFU A;  3ESW A;  3G6E Z;  5IP9 I;  5A2Q b;  4A3F I;  1VQN Z;  2W04 A;  2R6M A;  3PO3 S;  4BBS I;  4NBG A;  3LUS A;  4A3E I;  5C4J I; 
#chains in the Genus database with same CATH homology
 4NBH A;  2I3C A;  2LIY A;  3CC4 1;  2DE6 A;  1K9M 1;  3CMA Z;  3S17 I;  4BY1 I;  1I50 I;  2QRE B;  5D1O B;  2NVT I;  4NB8 A;  2OZK A;  3D6W A;  1ZB9 A;  2W03 A;  3GKQ A;  3JAM b;  2QEX Z;  3HOZ I;  1JJ2 Z;  1YIT Z;  2QLV B;  2QKD A;  3G4S 1;  3CD6 Z;  2BJO A;  2JR6 A;  2H85 A;  4NH1 C;  1YJN 1;  3K7A I;  1YUA A;  5A2Q f;  2R7Z I;  1KC8 1;  1YJ9 1;  1USP B;  4AYB A;  3CCS 1;  1K73 1;  1VQ7 1;  2E2I I;  1Z03 A;  2R93 I;  3Q87 A;  3CPW Z;  1Q81 2;  1Q86 1;  3S1Q I;  1RNI A;  1S72 Z;  5AN9 F;  2VUG A;  1Z01 A;  3S2D I;  3J80 b;  1I3Q I;  3KIH A;  3CCU Z;  3CCM Z;  2K5R A;  3CME Z;  2G2K A;  3I56 Z;  1VQ8 Z;  3GTK I;  3TDH B;  1VQ5 1;  1VLA A;  3JAM f;  1Y1V I;  2OTJ Z;  1VQ4 1;  1YI2 1;  5T6B A;  2P3Y A;  4E2W A;  3CCR 1;  1K83 I;  3F3P C;  4BY7 I;  1ZH1 A;  1TFI A;  2WB1 A;  2RIQ A;  5D1P A;  2IZ3 A;  1VQO Z;  2JA8 I;  1PFT A;  2GU2 A;  5IT9 b;  4RVG A;  3FQQ A;  1NJI 2;  3CCV 1;  1SFO I;  2PM9 A;  4DQY B;  3CPW Y;  1LQL A;  2GTI A;  3NH8 A;  2O53 A;  3J80 f;  1QVF Z;  3CC7 1;  2RT9 A;  3GTM I;  1RQF A;  2QA4 1;  1YHQ 1;  4QTU A;  3HKZ A;  3CCJ 1;  1TWH I;  4NOZ A;  3CC4 Z;  5FLM I;  3T4N B;  1Q81 1;  3CQZ I;  3F3F C;  5C4X I;  1VQP Z;  1N8R 2;  1YJW 1;  1K8A 2;  1QVG Y;  4MH4 A;  3I4N I;  3CCE Z;  3IF8 A;  3TE5 B;  1KQS Z;  3VMG A;  3S1M I;  4NBD A;  2KI7 B;  2YU9 I;  3CC2 Z;  3NFZ A;  3M4O I;  4E30 A;  3I07 A;  3HOU I;  1M90 2;  1WW9 A;  5IT9 f;  1YJN Z;  2QRD B;  1ZB8 A;  4MD7 A;  3P5J B;  2HF1 A;  3VMI A;  1VQM Z;  4E2Z A;  3I55 Z;  3H3V J;  4BXX I;  1TWF I;  3HOX I;  1VQL 1;  3CXC Z;  1YUK A;  1RLY A;  3CCL Z;  1RO4 A;  1VQ6 Z;  4A3D I;  1VQ7 Z;  2RPR A;  3IX0 A;  2WAQ A;  4MON A;  1QVF Y;  2JA6 I;  3MON A;  4NB9 A;  3CCQ Z;  3D9X A;  1X0T A;  2JUB A;  4A3C I;  4NFR A;  1NJI 1;  1VQN 1;  2JA7 I;  2E2H I;  3G71 Z;  2KPI A;  2QR1 B;  3NDJ A;  3VB9 A;  4TNU A;  1DL6 A;  3GTQ I;  4A3G I;  3S2H I;  4A93 I;  4MD8 A;  2M6N A;  1KQS Y;  3IFU A;  1YI2 Z;  1N2F A;  4RVH A;  3NH4 A;  1WCM I;  3BG1 B;  1N8R 1;  1K8A 1;  3CMA 1;  4MD9 A;  4HGZ A;  3CXC Y;  2EGT A;  1YIJ 1;  2QEX 1;  4NBB A;  4NBE A;  4DK1 A;  1NP6 A;  2VF1 A;  1YIT 1;  4A3L I;  3CD6 1;  3FQM A;  1JJ2 Y;  1M90 1;  3J81 b;  3CC7 Z;  4NBA A;  2Q51 A;  3M3Y I;  1QYP A;  2AKL A;  3S1R I;  1Z02 A;  1X3Z A;  2DE7 A;  4A3K I;  1P9N A;  3HOV I;  3FKI I;  5CM2 M;  1RO2 A;  2NVQ I;  3J7A 4;  2Y0S A;  4A3B I;  3CCM 1;  1VQ9 1;  2E2J I;  3QWU A;  1W2B Z;  3PO2 I;  3GTL I;  3CME 1;  4QTT A;  2Q4Z A;  4Y7N I;  1M1K 2;  3H0G I;  1Q82 2;  1VQ8 1;  4E33 A;  5D1O A;  3RZO I;  4E32 A;  2M48 A;  2OOY B;  2JS4 A;  2OTJ 1;  4Y52 I;  4S1T A;  2JMO A;  1VQL Z;  2JNY A;  4X6A I;  3S1N I;  2O4H A;  1VQK 1;  3J81 f;  3S15 I;  4DGL A;  5C3E I;  3MZK B;  5T64 A;  2OTL 1;  5T67 A;  2IZ4 A;  3G4S Z;  5LL6 f;  1X3W A;  3GCF A;  4E2Y A;  1KD1 2;  1Q7Y 2;  1YJ9 Z;  4A3I I;  4EWC A;  3CCS Z;  3VTN A;  3MZL B;  1W2B Y;  2V8J A;  3S14 I;  4A3J I;  1S7M A;  3NDI A;  3G6E 1;  1RO0 A;  4RV9 A;  1VQP 1;  1TWC I;  1JWH C;  1KRL A;  2NVX I;  1Y1W I;  3GTP I;  3OW2 Z;  4XX2 A;  3PO3 I;  1VQ5 Z;  1M1K 1;  3CCE 1;  1YIJ Z;  1Q82 1;  3GTG I;  1L1O C;  4RVF A;  1Y1V S;  4MXU A;  2YAD A;  4NBF A;  1VQ4 Z;  3CC2 1;  5FLX b;  1WII A;  3RZD I;  2VUM I;  4CL1 A;  3CCR Z;  1VQM 1;  3I55 1;  1VQ6 1;  3CCL 1;  3EER A;  2V8I A;  3HOY I;  2DE5 A;  3GTO I;  1I6H I;  4RVD A;  1TWA I;  3CCV Z;  2RHB A;  3I4M I;  2P28 A;  3GTJ I;  2PK7 A;  3CCQ 1;  2RBL A;  4E31 A;  1VQ9 Z;  3BG0 B;  1R9T I;  4RS4 A;  4BBR I;  3G71 1;  1KD1 1;  1Q7Y 1;  2JA5 I;  3GTM S;  4HGY A;  4MRI A;  2QA4 Z;  2NVY I;  5IP7 I;  1YHQ Z;  3OW2 Y;  2B63 I;  3CCJ Z;  2J6A A;  2K3R A;  2GTH A;  5C44 I;  3EED A;  1QVG Z;  2PMZ A;  1S72 1;  1ML8 A;  1YJW Z;  1K9M 2;  2ZAE B;  4HH4 A;  3CCU 1;  5FLX f;  2V8K A;  4NBC A;  1QF8 A;  1VQK Z;  2F4O A;  3I56 1;  3U50 C;  1NUI A;  2QRC B;  2F4M A;  2OOX B;  3KIF A;  2OTL Z;  1TWG I;  3VMH A;  4E2X A;  3S16 I;  4A3M I;  3HOW I;  3NH5 A;  1KC8 2;  1K73 2;  2R92 I;  2E9H A;  2HU9 A;  1Q86 2;  1USP A;  1VQO 1;  2LFU A;  3ESW A;  3G6E Z;  5IP9 I;  5A2Q b;  4A3F I;  1VQN Z;  2W04 A;  2R6M A;  3PO3 S;  4BBS I;  4NBG A;  3LUS A;  4A3E I;  5C4J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...