3I55Z

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55Z00
1Q822 1KC81 3CCS1 1YJNZ 1VQ9Z 3CCQ1 1Q861 1N8R2 3CCVZ 1K8A1 1VQ5Z 2QA41 3CCJZ 1YITZ 3CCEZ 1VQLZ 3OW2Y 1K9M1 1VQ8Z 1YJ9Z 1VQMZ 2OTJ1 3G6E1 3CCU1 1NJI1 1YIJZ 1YI21 1QVGZ 1YI2Z 3CC41 1VQOZ 3CCSZ 1VQM1 1VQ7Z 1KD11 1K8A2 1K731 1M901 2QEXZ 3CMEZ 1W2BZ 3CD6Z 3CCL1 3CCLZ 1YHQZ 1K9M2 3I561 1QVGY 3CC21 3CC71 3CCJ1 1QVFZ 1VQ71 2QEX1 1VQP1 1JJ2Z 1S721 1W2BY 1Q7Y2 1S72Z 3G6EZ 3OW2Z 3CCRZ 3CMA1 3CC2Z 3CC7Z 3CCMZ 1VQ41 3CCE1 1VQL1 1YHQ1 1VQ81 1VQKZ 1M1K2 1KQSZ 3I55Z 3G4S1 1Q812 3CME1 3CCR1 1YJWZ 1KQSY 3CC4Z 3CXCY 2QA4Z 3CCM1 1KC82 1VQ6Z 1YJN1 1VQ61 3CCQZ 3I551 1KD12 3CPWY 1YIJ1 2OTJZ 3G4SZ 3CCUZ 1YJW1 3CXCZ 1QVFY 1M1K1 1VQ51 1VQN1 3I56Z 1VQK1 3G711 1YJ91 1Q811 1JJ2Y 1Q821 2OTL1 1VQ91 3CCV1 1VQPZ 2OTLZ 1Q862 1Q7Y1 1N8R1 1VQO1 3G71Z 1K732 1M902 3CPWZ 3CMAZ 3CD61 1VQ4Z 1VQNZ 1YIT1 1NJI2
chains in the Genus database with same CATH superfamily
5A2Qb 4A3FI 1VQ9Z 4NH1C 2NVXI 3VMIA 3S1QI 2VPXA 1FDIA 1VLAA 3CCJZ 1YITZ 5CM2M 1VQLZ 2LFUA 1K9M1 2NAPA 1VQ8Z 1ZB8A 2R92I 1P9NA 4TNUA 5LL6f 5FLXb 5AN9F 1YI21 1QVGZ 3CC41 2LEXA 2HF1A 4NBDA 5IT9b 4E2ZA 3CCSZ 3S14I 1VQ7Z 2AYDA 3NH5A 1K8A2 1SFOI 4AYBA 5IP7I 4A3DI 1X3WA 1W2BZ 2IZ4A 3CCL1 3BG1B 3GTPI 2W03A 3IF8A 3CC71 3CCJ1 4X6AI 1DL6A 4QTUA 2DE7A 2QEX1 2IV2X 3IR7A 1S72Z 3ESWA 4NBEA 4A3GI 3CC7Z 3QWUA 1FDOA 3CCMZ 3CCE1 4DK1A 1VQKZ 4E33A 1RNIA 5C44I 3CME1 1KQSY 4BY1I 3CC4Z 3CXCY 4A3MI 3S2HI 3CCM1 2B63I 4MRIA 1YUAA 1KD12 1NUIA 1USPB 1YIJ1 3NFZA 1RO2A 3GTQI 4CL1A 1TWAI 2RIQA 3FQMA 1QVFY 1RLYA 2VF1A 3KIFA 1YJ91 2VPZA 3S1MI 2JNYA 2E9HA 1Q821 2OTL1 2V8JA 1VQ91 1X0TA 4RVDA 2AKLA 3IFUA 1Q862 2K3RA 1Q7Y1 1N8R1 2JA5I 2RPRA 4NOZA 1RO0A 3NDIA 5T67A 3IX0A 3H3VJ 3I07A 4A3EI 3GCFA 2JA6I 3S17I 1N2FA 3S15I 3CD61 1YIT1 3PO2I 3GTGI 1SIWA 3VTNA 1KC81 2E2II 1WIIA 1YJNZ 3S2DI 3GTJI 4MD9A 3CCVZ 3HOUI 1TFIA 2JIPA 4RVGA 5T6BA 4A3II 2I3CA 3S1RI 5IT9f 4MH4A 3G6E1 1NJI1 2JUBA 1YI2Z 1KD11 1WJ2A 1K731 1AA6A 3MZKB 2QEXZ 4E30A 5D1PA 3JAMf 4DQYB 3NDJA 4E32A 1K9M2 3J80b 1QVFZ 1I3QI 1QYPA 3NH8A 4RV9A 1W2BY 1Q7Y2 4HGZA 4A93I 3G6EZ 3OW2Z 2GTIA 3K7AI 2PM9A 3D6WA 1VQ41 3FKII 1YHQ1 4QTTA 2M6NA 1TWGI 1X3ZA 3I55Z 3G4S1 2F4OA 1Q812 3GTOI 1YJWZ 5C4XI 2R7ZI 2VPWA 5FLMI 1KC82 2KPIA 1YJN1 2RHBA 1L1OC 3CPWY 2GTHA 4RVHA 2OTJZ 3G4SZ 3CCUZ 1YJW1 2K5RA 3TE5B 3GTKI 1VQ51 3I56Z 1VQPZ 1Y1VI 3RZDI 4EWCA 2VUMI 3VMHA 4NBGA 4DGLA 1VQO1 1I50I 3J81b 3VB9A 1K732 2LIYA 2JIQA 4HH4A 3CPWZ 1I6HI 5D1OB 4Y52I 3JAMb 3CMAZ 5C4JI 1VQNZ 2OOYB 2NVQI 1Q822 3HOZI 2RT9A 1Y8CA 4RS4A 4A3LI 1Q861 1N8R2 2OZKA 1RO4A 2QA41 2HU9A 2DE6A 2G2KA 3OW2Y 3BG0B 2O53A 1WCMI 2VPYA 1LQLA 3S1NI 2OTJ1 3J81f 3F3FC 4RVFA 2R6MA 3CCU1 2JMOA 2E7ZA 3F3PC 2F4MA 3FQQA 3H0GI 1VQM1 3P5JB 4E2XA 1M901 2M48A 3CD6Z 3HOVI 3CCLZ 3CC21 2KI7B 3T4NB 4NB9A 1Z03A 1VQ71 4BBRI 1VQP1 3EEDA 2V3VA 3CC2Z 3MZLB 4NBHA 1VQ81 5A2Qf 1M1K2 1KQSZ 3CCR1 4A3BI 1QXFA 4A3KI 2E2HI 3Q87A 2DE5A 3CCQZ 3I551 2Q51A 3KIHA 1TWCI 3M4OI 2V8IA 3D9XA 4NBCA 4MONA 4MXUA 1VQK1 4A3JI 1Z02A 1Q811 1JJ2Y 4BXXI 1PFTA 3CCV1 1USPA 2OTLZ 1RQFA 3CQZI 3M3YI 3J7A4 2NVTI 2WAQA 4BBSI 1R9TI 1ML8A 3G71Z 1M902 2JA7I 2R93I 1TWHI 1ZH1A 2IZ3A 2WB1A 4NBAA 3GTMS 1KRLA 3U50C 5T64A 3I4MI 2JIMA 2V45A 3CCS1 3S16I 4NFRA 2OOXB 3GTLI 3CCQ1 1ZB9A 3LUSA 4A3CI 5FLXf 1K8A1 1VQ5Z 4NBBA 3CCEZ 2PMZA 4HGYA 2BJOA 2P28A 1YJ9Z 1VQMZ 2QR1B 3J80f 2JR6A 2YU9I 1YIJZ 4E2WA 2J6AA 3TDHB 4E2YA 1VQOZ 3PO3S 3HOYI 4XX2A 3CMEZ 2Q4ZA 1NP6A 1TWFI 2GU2A 1YHQZ 3EERA 1Q16A 1WW9A 3I561 1QVGY 2VUGA 4BY7I 2JIRA 2JS4A 2V8KA 3NH4A 4MD8A 4E31A 2W04A 1JJ2Z 1S721 3PO3I 3CCRZ 3HOXI 3CMA1 1JWHC 1VQL1 1S7MA 2QRDB 1K83I 3D2LA 2NVYI 3MONA 2ZAEB 3HOWI 3I4NI 2YADA 2QA4Z 1Z01A 2PK7A 2QRCB 1VQ6Z 4S1TA 3GTMI 1VQ61 2E2JI 2QKDA 4MD7A 1QF8A 1Y1VS 1YUKA 2H85A 3GKQA 5C3EI 2P3YA 4NB8A 3CXCZ 1M1K1 1VQN1 3G711 2RBLA 2QREB 2JA8I 3HKZA 3RZOI 4Y7NI 2Y0SA 4NBFA 2QLVB 2EGTA 2JIOA 1WZNA 5D1OA 3VMGA 2O4HA 1VQ4Z 5IP9I 1Y1WI 1NJI2
chains in the Genus database with same CATH topology
5A2Qb 4A3FI 1VQ9Z 4NH1C 2NVXI 3VMIA 3S1QI 1VLAA 3CCJZ 1YITZ 5CM2M 1VQLZ 2LFUA 1K9M1 1VQ8Z 1ZB8A 2R92I 1P9NA 4TNUA 5LL6f 5FLXb 5AN9F 1YI21 1QVGZ 3CC41 2HF1A 4NBDA 5IT9b 4E2ZA 3CCSZ 3S14I 1VQ7Z 3NH5A 1K8A2 1SFOI 4AYBA 5IP7I 4A3DI 1X3WA 1W2BZ 2IZ4A 3CCL1 3BG1B 3GTPI 2W03A 3IF8A 3CC71 3CCJ1 4X6AI 1DL6A 4QTUA 2DE7A 2QEX1 1S72Z 3ESWA 4NBEA 4A3GI 3CC7Z 3QWUA 3CCMZ 3CCE1 4DK1A 1VQKZ 4E33A 1RNIA 5C44I 3CME1 1KQSY 4BY1I 3CC4Z 3CXCY 4A3MI 3S2HI 3CCM1 2B63I 4MRIA 1YUAA 1KD12 1NUIA 1USPB 1YIJ1 3NFZA 1RO2A 3GTQI 4CL1A 1TWAI 2RIQA 3FQMA 1QVFY 1RLYA 2VF1A 3KIFA 1YJ91 3S1MI 2JNYA 2E9HA 1Q821 2OTL1 2V8JA 1VQ91 1X0TA 4RVDA 2AKLA 3IFUA 1Q862 2K3RA 1Q7Y1 1N8R1 2JA5I 2RPRA 4NOZA 1RO0A 3NDIA 5T67A 3IX0A 3H3VJ 3I07A 4A3EI 3GCFA 2JA6I 3S17I 1N2FA 3S15I 3CD61 1YIT1 3PO2I 3GTGI 3VTNA 1KC81 2E2II 1WIIA 1YJNZ 3S2DI 3GTJI 4MD9A 3CCVZ 3HOUI 1TFIA 4RVGA 5T6BA 4A3II 2I3CA 3S1RI 5IT9f 4MH4A 3G6E1 1NJI1 2JUBA 1YI2Z 1KD11 1K731 3MZKB 2QEXZ 4E30A 5D1PA 3JAMf 4DQYB 3NDJA 4E32A 1K9M2 3J80b 1QVFZ 1QYPA 1I3QI 3NH8A 4RV9A 1W2BY 1Q7Y2 4HGZA 4A93I 3G6EZ 3OW2Z 2GTIA 3K7AI 2PM9A 3D6WA 1VQ41 3FKII 1YHQ1 4QTTA 2M6NA 1TWGI 1X3ZA 3I55Z 3G4S1 2F4OA 1Q812 3GTOI 1YJWZ 5C4XI 2R7ZI 5FLMI 1KC82 2KPIA 1YJN1 2RHBA 1L1OC 3CPWY 2GTHA 4RVHA 2OTJZ 3G4SZ 3CCUZ 1YJW1 2K5RA 3TE5B 3GTKI 1VQ51 3I56Z 1VQPZ 1Y1VI 3RZDI 4EWCA 2VUMI 3VMHA 4NBGA 4DGLA 1VQO1 1I50I 3J81b 3VB9A 1K732 2LIYA 4HH4A 3CPWZ 1I6HI 5D1OB 4Y52I 3JAMb 3CMAZ 5C4JI 1VQNZ 2OOYB 2NVQI 1Q822 3HOZI 2RT9A 4RS4A 4A3LI 1Q861 1N8R2 2OZKA 1RO4A 2QA41 2HU9A 2DE6A 2G2KA 3OW2Y 3BG0B 2O53A 1WCMI 1LQLA 3S1NI 2OTJ1 3J81f 3F3FC 4RVFA 2R6MA 3CCU1 2JMOA 3F3PC 2F4MA 3FQQA 3H0GI 1VQM1 3P5JB 4E2XA 1M901 2M48A 3CD6Z 3HOVI 3CCLZ 3CC21 2KI7B 3T4NB 4NB9A 1Z03A 1VQ71 4BBRI 1VQP1 3EEDA 3CC2Z 3MZLB 4NBHA 1VQ81 5A2Qf 1M1K2 1KQSZ 3CCR1 4A3BI 4A3KI 2E2HI 3Q87A 2DE5A 3CCQZ 3I551 2Q51A 3KIHA 1TWCI 3M4OI 2V8IA 3D9XA 4NBCA 4MONA 4MXUA 1VQK1 4A3JI 1Z02A 1Q811 1JJ2Y 4BXXI 1PFTA 3CCV1 1USPA 2OTLZ 1RQFA 3CQZI 3M3YI 3J7A4 2NVTI 2WAQA 4BBSI 1R9TI 1ML8A 3G71Z 1M902 2JA7I 2R93I 1TWHI 1ZH1A 2IZ3A 2WB1A 4NBAA 3GTMS 1KRLA 3U50C 5T64A 3I4MI 3CCS1 3S16I 4NFRA 2OOXB 3GTLI 3CCQ1 1ZB9A 3LUSA 4A3CI 5FLXf 1K8A1 1VQ5Z 4NBBA 3CCEZ 2PMZA 4HGYA 2BJOA 2P28A 1YJ9Z 1VQMZ 2QR1B 3J80f 2JR6A 2YU9I 1YIJZ 4E2WA 2J6AA 3TDHB 4E2YA 1VQOZ 3PO3S 3HOYI 4XX2A 3CMEZ 2Q4ZA 1NP6A 1TWFI 2GU2A 1YHQZ 3EERA 1WW9A 1QVGY 3I561 4BY7I 2VUGA 2JS4A 2V8KA 3NH4A 4MD8A 4E31A 2W04A 1JJ2Z 1S721 3PO3I 3CCRZ 3HOXI 3CMA1 1JWHC 1VQL1 1S7MA 2QRDB 1K83I 2NVYI 3MONA 2ZAEB 3HOWI 3I4NI 2YADA 2QA4Z 1Z01A 2PK7A 2QRCB 1VQ6Z 4S1TA 3GTMI 1VQ61 2E2JI 2QKDA 4MD7A 1QF8A 1Y1VS 1YUKA 2H85A 3GKQA 5C3EI 2P3YA 4NB8A 3CXCZ 1M1K1 1VQN1 3G711 2RBLA 2QREB 2JA8I 3HKZA 3RZOI 4Y7NI 2Y0SA 4NBFA 2QLVB 2EGTA 5D1OA 3VMGA 2O4HA 1VQ4Z 5IP9I 1Y1WI 1NJI2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 2;  1KC8 1;  3CCS 1;  1YJN Z;  1VQ9 Z;  3CCQ 1;  1Q86 1;  1N8R 2;  3CCV Z;  1K8A 1;  1VQ5 Z;  2QA4 1;  3CCJ Z;  1YIT Z;  3CCE Z;  1VQL Z;  3OW2 Y;  1K9M 1;  1VQ8 Z;  1YJ9 Z;  1VQM Z;  2OTJ 1;  3G6E 1;  3CCU 1;  1NJI 1;  1YIJ Z;  1YI2 1;  1QVG Z;  1YI2 Z;  3CC4 1;  1VQO Z;  3CCS Z;  1VQM 1;  1VQ7 Z;  1KD1 1;  1K8A 2;  1K73 1;  1M90 1;  2QEX Z;  3CME Z;  1W2B Z;  3CD6 Z;  3CCL 1;  3CCL Z;  1YHQ Z;  1K9M 2;  3I56 1;  1QVG Y;  3CC2 1;  3CC7 1;  3CCJ 1;  1QVF Z;  1VQ7 1;  2QEX 1;  1VQP 1;  1JJ2 Z;  1S72 1;  1W2B Y;  1Q7Y 2;  1S72 Z;  3G6E Z;  3OW2 Z;  3CCR Z;  3CMA 1;  3CC2 Z;  3CC7 Z;  3CCM Z;  1VQ4 1;  3CCE 1;  1VQL 1;  1YHQ 1;  1VQ8 1;  1VQK Z;  1M1K 2;  1KQS Z;  3I55 Z;  3G4S 1;  1Q81 2;  3CME 1;  3CCR 1;  1YJW Z;  1KQS Y;  3CC4 Z;  3CXC Y;  2QA4 Z;  3CCM 1;  1KC8 2;  1VQ6 Z;  1YJN 1;  1VQ6 1;  3CCQ Z;  3I55 1;  1KD1 2;  3CPW Y;  1YIJ 1;  2OTJ Z;  3G4S Z;  3CCU Z;  1YJW 1;  3CXC Z;  1QVF Y;  1M1K 1;  1VQ5 1;  1VQN 1;  3I56 Z;  1VQK 1;  3G71 1;  1YJ9 1;  1Q81 1;  1JJ2 Y;  1Q82 1;  2OTL 1;  1VQ9 1;  3CCV 1;  1VQP Z;  2OTL Z;  1Q86 2;  1Q7Y 1;  1N8R 1;  1VQO 1;  3G71 Z;  1K73 2;  1M90 2;  3CPW Z;  3CMA Z;  3CD6 1;  1VQ4 Z;  1VQN Z;  1YIT 1;  1NJI 2; 
#chains in the Genus database with same CATH topology
 5A2Q b;  4A3F I;  1VQ9 Z;  4NH1 C;  2NVX I;  3VMI A;  3S1Q I;  2VPX A;  1FDI A;  1VLA A;  3CCJ Z;  1YIT Z;  5CM2 M;  1VQL Z;  2LFU A;  1K9M 1;  2NAP A;  1VQ8 Z;  1ZB8 A;  2R92 I;  1P9N A;  4TNU A;  5LL6 f;  5FLX b;  5AN9 F;  1YI2 1;  1QVG Z;  3CC4 1;  2LEX A;  2HF1 A;  4NBD A;  5IT9 b;  4E2Z A;  3CCS Z;  3S14 I;  1VQ7 Z;  2AYD A;  3NH5 A;  1K8A 2;  1SFO I;  4AYB A;  5IP7 I;  4A3D I;  1X3W A;  1W2B Z;  2IZ4 A;  3CCL 1;  3BG1 B;  3GTP I;  2W03 A;  3IF8 A;  3CC7 1;  3CCJ 1;  4X6A I;  1DL6 A;  4QTU A;  2DE7 A;  2QEX 1;  2IV2 X;  3IR7 A;  1S72 Z;  3ESW A;  4NBE A;  4A3G I;  3CC7 Z;  3QWU A;  1FDO A;  3CCM Z;  3CCE 1;  4DK1 A;  1VQK Z;  4E33 A;  1RNI A;  5C44 I;  3CME 1;  1KQS Y;  4BY1 I;  3CC4 Z;  3CXC Y;  4A3M I;  3S2H I;  3CCM 1;  2B63 I;  4MRI A;  1YUA A;  1KD1 2;  1NUI A;  1USP B;  1YIJ 1;  3NFZ A;  1RO2 A;  3GTQ I;  4CL1 A;  1TWA I;  2RIQ A;  3FQM A;  1QVF Y;  1RLY A;  2VF1 A;  3KIF A;  1YJ9 1;  2VPZ A;  3S1M I;  2JNY A;  2E9H A;  1Q82 1;  2OTL 1;  2V8J A;  1VQ9 1;  1X0T A;  4RVD A;  2AKL A;  3IFU A;  1Q86 2;  2K3R A;  1Q7Y 1;  1N8R 1;  2JA5 I;  2RPR A;  4NOZ A;  1RO0 A;  3NDI A;  5T67 A;  3IX0 A;  3H3V J;  3I07 A;  4A3E I;  3GCF A;  2JA6 I;  3S17 I;  1N2F A;  3S15 I;  3CD6 1;  1YIT 1;  3PO2 I;  3GTG I;  1SIW A;  3VTN A;  1KC8 1;  2E2I I;  1WII A;  1YJN Z;  3S2D I;  3GTJ I;  4MD9 A;  3CCV Z;  3HOU I;  1TFI A;  2JIP A;  4RVG A;  5T6B A;  4A3I I;  2I3C A;  3S1R I;  5IT9 f;  4MH4 A;  3G6E 1;  1NJI 1;  2JUB A;  1YI2 Z;  1KD1 1;  1WJ2 A;  1K73 1;  1AA6 A;  3MZK B;  2QEX Z;  4E30 A;  5D1P A;  3JAM f;  4DQY B;  3NDJ A;  4E32 A;  1K9M 2;  3J80 b;  1QVF Z;  1I3Q I;  1QYP A;  3NH8 A;  4RV9 A;  1W2B Y;  1Q7Y 2;  4HGZ A;  4A93 I;  3G6E Z;  3OW2 Z;  2GTI A;  3K7A I;  2PM9 A;  3D6W A;  1VQ4 1;  3FKI I;  1YHQ 1;  4QTT A;  2M6N A;  1TWG I;  1X3Z A;  3I55 Z;  3G4S 1;  2F4O A;  1Q81 2;  3GTO I;  1YJW Z;  5C4X I;  2R7Z I;  2VPW A;  5FLM I;  1KC8 2;  2KPI A;  1YJN 1;  2RHB A;  1L1O C;  3CPW Y;  2GTH A;  4RVH A;  2OTJ Z;  3G4S Z;  3CCU Z;  1YJW 1;  2K5R A;  3TE5 B;  3GTK I;  1VQ5 1;  3I56 Z;  1VQP Z;  1Y1V I;  3RZD I;  4EWC A;  2VUM I;  3VMH A;  4NBG A;  4DGL A;  1VQO 1;  1I50 I;  3J81 b;  3VB9 A;  1K73 2;  2LIY A;  2JIQ A;  4HH4 A;  3CPW Z;  1I6H I;  5D1O B;  4Y52 I;  3JAM b;  3CMA Z;  5C4J I;  1VQN Z;  2OOY B;  2NVQ I;  1Q82 2;  3HOZ I;  2RT9 A;  1Y8C A;  4RS4 A;  4A3L I;  1Q86 1;  1N8R 2;  2OZK A;  1RO4 A;  2QA4 1;  2HU9 A;  2DE6 A;  2G2K A;  3OW2 Y;  3BG0 B;  2O53 A;  1WCM I;  2VPY A;  1LQL A;  3S1N I;  2OTJ 1;  3J81 f;  3F3F C;  4RVF A;  2R6M A;  3CCU 1;  2JMO A;  2E7Z A;  3F3P C;  2F4M A;  3FQQ A;  3H0G I;  1VQM 1;  3P5J B;  4E2X A;  1M90 1;  2M48 A;  3CD6 Z;  3HOV I;  3CCL Z;  3CC2 1;  2KI7 B;  3T4N B;  4NB9 A;  1Z03 A;  1VQ7 1;  4BBR I;  1VQP 1;  3EED A;  2V3V A;  3CC2 Z;  3MZL B;  4NBH A;  1VQ8 1;  5A2Q f;  1M1K 2;  1KQS Z;  3CCR 1;  4A3B I;  1QXF A;  4A3K I;  2E2H I;  3Q87 A;  2DE5 A;  3CCQ Z;  3I55 1;  2Q51 A;  3KIH A;  1TWC I;  3M4O I;  2V8I A;  3D9X A;  4NBC A;  4MON A;  4MXU A;  1VQK 1;  4A3J I;  1Z02 A;  1Q81 1;  1JJ2 Y;  4BXX I;  1PFT A;  3CCV 1;  1USP A;  2OTL Z;  1RQF A;  3CQZ I;  3M3Y I;  3J7A 4;  2NVT I;  2WAQ A;  4BBS I;  1R9T I;  1ML8 A;  3G71 Z;  1M90 2;  2JA7 I;  2R93 I;  1TWH I;  1ZH1 A;  2IZ3 A;  2WB1 A;  4NBA A;  3GTM S;  1KRL A;  3U50 C;  5T64 A;  3I4M I;  2JIM A;  2V45 A;  3CCS 1;  3S16 I;  4NFR A;  2OOX B;  3GTL I;  3CCQ 1;  1ZB9 A;  3LUS A;  4A3C I;  5FLX f;  1K8A 1;  1VQ5 Z;  4NBB A;  3CCE Z;  2PMZ A;  4HGY A;  2BJO A;  2P28 A;  1YJ9 Z;  1VQM Z;  2QR1 B;  3J80 f;  2JR6 A;  2YU9 I;  1YIJ Z;  4E2W A;  2J6A A;  3TDH B;  4E2Y A;  1VQO Z;  3PO3 S;  3HOY I;  4XX2 A;  3CME Z;  2Q4Z A;  1NP6 A;  1TWF I;  2GU2 A;  1YHQ Z;  3EER A;  1Q16 A;  1WW9 A;  3I56 1;  1QVG Y;  2VUG A;  4BY7 I;  2JIR A;  2JS4 A;  2V8K A;  3NH4 A;  4MD8 A;  4E31 A;  2W04 A;  1JJ2 Z;  1S72 1;  3PO3 I;  3CCR Z;  3HOX I;  3CMA 1;  1JWH C;  1VQL 1;  1S7M A;  2QRD B;  1K83 I;  3D2L A;  2NVY I;  3MON A;  2ZAE B;  3HOW I;  3I4N I;  2YAD A;  2QA4 Z;  1Z01 A;  2PK7 A;  2QRC B;  1VQ6 Z;  4S1T A;  3GTM I;  1VQ6 1;  2E2J I;  2QKD A;  4MD7 A;  1QF8 A;  1Y1V S;  1YUK A;  2H85 A;  3GKQ A;  5C3E I;  2P3Y A;  4NB8 A;  3CXC Z;  1M1K 1;  1VQN 1;  3G71 1;  2RBL A;  2QRE B;  2JA8 I;  3HKZ A;  3RZO I;  4Y7N I;  2Y0S A;  4NBF A;  2QLV B;  2EGT A;  2JIO A;  1WZN A;  5D1O A;  3VMG A;  2O4H A;  1VQ4 Z;  5IP9 I;  1Y1W I;  1NJI 2; 
#chains in the Genus database with same CATH homology
 5A2Q b;  4A3F I;  1VQ9 Z;  4NH1 C;  2NVX I;  3VMI A;  3S1Q I;  1VLA A;  3CCJ Z;  1YIT Z;  5CM2 M;  1VQL Z;  2LFU A;  1K9M 1;  1VQ8 Z;  1ZB8 A;  2R92 I;  1P9N A;  4TNU A;  5LL6 f;  5FLX b;  5AN9 F;  1YI2 1;  1QVG Z;  3CC4 1;  2HF1 A;  4NBD A;  5IT9 b;  4E2Z A;  3CCS Z;  3S14 I;  1VQ7 Z;  3NH5 A;  1K8A 2;  1SFO I;  4AYB A;  5IP7 I;  4A3D I;  1X3W A;  1W2B Z;  2IZ4 A;  3CCL 1;  3BG1 B;  3GTP I;  2W03 A;  3IF8 A;  3CC7 1;  3CCJ 1;  4X6A I;  1DL6 A;  4QTU A;  2DE7 A;  2QEX 1;  1S72 Z;  3ESW A;  4NBE A;  4A3G I;  3CC7 Z;  3QWU A;  3CCM Z;  3CCE 1;  4DK1 A;  1VQK Z;  4E33 A;  1RNI A;  5C44 I;  3CME 1;  1KQS Y;  4BY1 I;  3CC4 Z;  3CXC Y;  4A3M I;  3S2H I;  3CCM 1;  2B63 I;  4MRI A;  1YUA A;  1KD1 2;  1NUI A;  1USP B;  1YIJ 1;  3NFZ A;  1RO2 A;  3GTQ I;  4CL1 A;  1TWA I;  2RIQ A;  3FQM A;  1QVF Y;  1RLY A;  2VF1 A;  3KIF A;  1YJ9 1;  3S1M I;  2JNY A;  2E9H A;  1Q82 1;  2OTL 1;  2V8J A;  1VQ9 1;  1X0T A;  4RVD A;  2AKL A;  3IFU A;  1Q86 2;  2K3R A;  1Q7Y 1;  1N8R 1;  2JA5 I;  2RPR A;  4NOZ A;  1RO0 A;  3NDI A;  5T67 A;  3IX0 A;  3H3V J;  3I07 A;  4A3E I;  3GCF A;  2JA6 I;  3S17 I;  1N2F A;  3S15 I;  3CD6 1;  1YIT 1;  3PO2 I;  3GTG I;  3VTN A;  1KC8 1;  2E2I I;  1WII A;  1YJN Z;  3S2D I;  3GTJ I;  4MD9 A;  3CCV Z;  3HOU I;  1TFI A;  4RVG A;  5T6B A;  4A3I I;  2I3C A;  3S1R I;  5IT9 f;  4MH4 A;  3G6E 1;  1NJI 1;  2JUB A;  1YI2 Z;  1KD1 1;  1K73 1;  3MZK B;  2QEX Z;  4E30 A;  5D1P A;  3JAM f;  4DQY B;  3NDJ A;  4E32 A;  1K9M 2;  3J80 b;  1QVF Z;  1QYP A;  1I3Q I;  3NH8 A;  4RV9 A;  1W2B Y;  1Q7Y 2;  4HGZ A;  4A93 I;  3G6E Z;  3OW2 Z;  2GTI A;  3K7A I;  2PM9 A;  3D6W A;  1VQ4 1;  3FKI I;  1YHQ 1;  4QTT A;  2M6N A;  1TWG I;  1X3Z A;  3I55 Z;  3G4S 1;  2F4O A;  1Q81 2;  3GTO I;  1YJW Z;  5C4X I;  2R7Z I;  5FLM I;  1KC8 2;  2KPI A;  1YJN 1;  2RHB A;  1L1O C;  3CPW Y;  2GTH A;  4RVH A;  2OTJ Z;  3G4S Z;  3CCU Z;  1YJW 1;  2K5R A;  3TE5 B;  3GTK I;  1VQ5 1;  3I56 Z;  1VQP Z;  1Y1V I;  3RZD I;  4EWC A;  2VUM I;  3VMH A;  4NBG A;  4DGL A;  1VQO 1;  1I50 I;  3J81 b;  3VB9 A;  1K73 2;  2LIY A;  4HH4 A;  3CPW Z;  1I6H I;  5D1O B;  4Y52 I;  3JAM b;  3CMA Z;  5C4J I;  1VQN Z;  2OOY B;  2NVQ I;  1Q82 2;  3HOZ I;  2RT9 A;  4RS4 A;  4A3L I;  1Q86 1;  1N8R 2;  2OZK A;  1RO4 A;  2QA4 1;  2HU9 A;  2DE6 A;  2G2K A;  3OW2 Y;  3BG0 B;  2O53 A;  1WCM I;  1LQL A;  3S1N I;  2OTJ 1;  3J81 f;  3F3F C;  4RVF A;  2R6M A;  3CCU 1;  2JMO A;  3F3P C;  2F4M A;  3FQQ A;  3H0G I;  1VQM 1;  3P5J B;  4E2X A;  1M90 1;  2M48 A;  3CD6 Z;  3HOV I;  3CCL Z;  3CC2 1;  2KI7 B;  3T4N B;  4NB9 A;  1Z03 A;  1VQ7 1;  4BBR I;  1VQP 1;  3EED A;  3CC2 Z;  3MZL B;  4NBH A;  1VQ8 1;  5A2Q f;  1M1K 2;  1KQS Z;  3CCR 1;  4A3B I;  4A3K I;  2E2H I;  3Q87 A;  2DE5 A;  3CCQ Z;  3I55 1;  2Q51 A;  3KIH A;  1TWC I;  3M4O I;  2V8I A;  3D9X A;  4NBC A;  4MON A;  4MXU A;  1VQK 1;  4A3J I;  1Z02 A;  1Q81 1;  1JJ2 Y;  4BXX I;  1PFT A;  3CCV 1;  1USP A;  2OTL Z;  1RQF A;  3CQZ I;  3M3Y I;  3J7A 4;  2NVT I;  2WAQ A;  4BBS I;  1R9T I;  1ML8 A;  3G71 Z;  1M90 2;  2JA7 I;  2R93 I;  1TWH I;  1ZH1 A;  2IZ3 A;  2WB1 A;  4NBA A;  3GTM S;  1KRL A;  3U50 C;  5T64 A;  3I4M I;  3CCS 1;  3S16 I;  4NFR A;  2OOX B;  3GTL I;  3CCQ 1;  1ZB9 A;  3LUS A;  4A3C I;  5FLX f;  1K8A 1;  1VQ5 Z;  4NBB A;  3CCE Z;  2PMZ A;  4HGY A;  2BJO A;  2P28 A;  1YJ9 Z;  1VQM Z;  2QR1 B;  3J80 f;  2JR6 A;  2YU9 I;  1YIJ Z;  4E2W A;  2J6A A;  3TDH B;  4E2Y A;  1VQO Z;  3PO3 S;  3HOY I;  4XX2 A;  3CME Z;  2Q4Z A;  1NP6 A;  1TWF I;  2GU2 A;  1YHQ Z;  3EER A;  1WW9 A;  1QVG Y;  3I56 1;  4BY7 I;  2VUG A;  2JS4 A;  2V8K A;  3NH4 A;  4MD8 A;  4E31 A;  2W04 A;  1JJ2 Z;  1S72 1;  3PO3 I;  3CCR Z;  3HOX I;  3CMA 1;  1JWH C;  1VQL 1;  1S7M A;  2QRD B;  1K83 I;  2NVY I;  3MON A;  2ZAE B;  3HOW I;  3I4N I;  2YAD A;  2QA4 Z;  1Z01 A;  2PK7 A;  2QRC B;  1VQ6 Z;  4S1T A;  3GTM I;  1VQ6 1;  2E2J I;  2QKD A;  4MD7 A;  1QF8 A;  1Y1V S;  1YUK A;  2H85 A;  3GKQ A;  5C3E I;  2P3Y A;  4NB8 A;  3CXC Z;  1M1K 1;  1VQN 1;  3G71 1;  2RBL A;  2QRE B;  2JA8 I;  3HKZ A;  3RZO I;  4Y7N I;  2Y0S A;  4NBF A;  2QLV B;  2EGT A;  5D1O A;  3VMG A;  2O4H A;  1VQ4 Z;  5IP9 I;  1Y1W I;  1NJI 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...