3I55Z

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 10
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55Z00
1M902 1VQOZ 1KQSY 2QA4Z 3G6EZ 1QVFZ 3CMA1 1KD12 1YI2Z 1YJ91 3G711 3CXCY 3CC21 3CCVZ 1VQPZ 1QVGY 3CCQ1 1N8R2 3CC41 1M1K1 1VQ91 1K9M1 3OW2Z 3CMAZ 2QEX1 3I561 1YJ9Z 3G71Z 1Q821 3CC2Z 1YHQ1 1K8A2 3CCQZ 3CC4Z 1VQ9Z 1VQ51 2QEXZ 3I56Z 1VQ41 1Q7Y2 1W2BZ 1QVFY 1NJI1 1YHQZ 1JJ2Y 1S721 1VQ5Z 1K732 1Q862 3CCS1 1VQ4Z 1VQL1 3CPWY 2OTL1 3I551 1Q812 1YIJ1 1VQ81 3CCU1 1VQN1 1YJW1 1S72Z 1K8A1 1YIT1 3CCSZ 1VQLZ 1M901 2OTJ1 2OTLZ 3I55Z 1Q7Y1 1YIJZ 1VQ8Z 3CCUZ 3CCJ1 1KD11 1VQNZ 1YJWZ 1QVGZ 1YITZ 1KC82 2OTJZ 3CD61 1N8R1 1VQM1 1K9M2 3G4S1 3CCJZ 1Q811 3OW2Y 1VQ71 1VQ61 3CC71 3CD6Z 1KQSZ 3CCM1 1VQMZ 3G4SZ 1JJ2Z 1VQ7Z 1VQ6Z 3CXCZ 1NJI2 3CCL1 1KC81 3CC7Z 1VQK1 1W2BY 3CME1 3CCMZ 3CCR1 3CCE1 3CPWZ 1YJN1 1M1K2 1K731 1Q861 1VQO1 2QA41 3G6E1 3CCLZ 1Q822 1VQKZ 3CMEZ 1YI21 3CCRZ 3CCEZ 3CCV1 1VQP1 1YJNZ
chains in the Genus database with same CATH superfamily
4E31A 3NDJA 2R7ZI 4X6AI 3G6EZ 1QVFZ 1Q16A 2W04A 2JA8I 3PO3S 3D2LA 3Q87A 3TE5B 2F4OA 4A3GI 3TDHB 5C44I 4A3FI 1RO4A 4QTUA 3CC41 3S1QI 2QKDA 1K9M1 3EERA 2WB1A 2QEX1 2JA7I 3J80b 1TFIA 4E33A 3GTJI 4BY7I 5CM2M 3IF8A 2VF1A 3CC4Z 2V8KA 5FLXb 2ZAEB 1Y1VS 2QEXZ 3VTNA 2EGTA 2DE6A 4A3EI 4E2WA 1W2BZ 4A93I 2VPXA 1NJI1 3PO2I 2PMZA 4MRIA 1I6HI 1DL6A 2QREB 2M48A 3VMGA 2VPZA 2R6MA 3FQMA 2GTIA 1Q862 1RQFA 4DQYB 1Q812 3CCU1 3GTPI 1X0TA 2E2II 1K8A1 3GTMI 2OTJ1 1Q7Y1 4NBGA 3CCUZ 2NAPA 4DGLA 3BG0B 3CCJ1 1QVGZ 3I4MI 1X3WA 2W03A 1WCMI 2LEXA 2E2HI 2OTJZ 1N8R1 1LQLA 1VQM1 1K9M2 4MONA 3CCJZ 5C4XI 1S7MA 3H3VJ 4S1TA 3FQQA 1X3ZA 3RZOI 2K5RA 3CC71 1KQSZ 1VQMZ 3P5JB 2JMOA 1QF8A 1JJ2Z 4HH4A 4RVDA 3J81f 1NJI2 2OOXB 3U50C 5AN9F 1RO2A 2AYDA 2LIYA 3CME1 3CC7Z 1KC81 2YU9I 3CCR1 1YJN1 1M1K2 4E2YA 1TWCI 4NBHA 5IP9I 5IT9b 4BBRI 1Q822 3CMEZ 1VLAA 3CCRZ 1TWHI 1YJNZ 1K83I 3D9XA 3S1MI 4RVFA 2BJOA 3HOWI 2JIRA 3FKII 3CXCY 3CC21 1I3QI 5D1PA 3CCQ1 4A3II 1N8R2 1TWAI 2K3RA 2PM9A 5D1OB 3NH5A 2JNYA 2R92I 3CC2Z 1PFTA 2HU9A 1YHQ1 3CCQZ 3GTQI 4CL1A 2RHBA 2GU2A 3NH8A 5A2Qf 3RZDI 4NBAA 1FDIA 3GTOI 1QVFY 4RV9A 1YHQZ 1ZB8A 3PO3I 1YUKA 2RPRA 3M3YI 3QWUA 3K7AI 1L1OC 4Y7NI 4BY1I 3JAMb 2OTL1 4BXXI 1YIJ1 2WAQA 3EEDA 1Y8CA 3MZKB 2VUGA 1YJW1 2NVQI 2RT9A 2KPIA 3T4NB 1Y1VI 2OTLZ 1TWFI 1YIJZ 4XX2A 4Y52I 1YJWZ 4EWCA 2JUBA 2DE5A 4NH1C 1NUIA 5FLMI 3M4OI 2JIPA 3CD61 4E2XA 2QRCB 5LL6f 3OW2Y 1VQ71 2VPYA 2V45A 1WZNA 3CD6Z 3BG1B 2OOYB 4E30A 1TWGI 2I3CA 1VQ7Z 3S2HI 2VUMI 1ZB9A 1Z02A 2P3YA 4A3BI 2V8IA 2Q51A 4E2ZA 1VQO1 2P28A 3GTLI 2QA41 2V3VA 4NFRA 2OZKA 5D1OA 2JIOA 3H0GI 1YI21 2IV2X 4NBCA 2R93I 1VQOZ 1KQSY 1R9TI 2QA4Z 1ML8A 3S1RI 3CMA1 3J7A4 1USPB 1YI2Z 3HOZI 3G711 2DE7A 4RVGA 4NBFA 3HOXI 4RS4A 2QRDB 1VQ91 2VPWA 3CMAZ 3I561 3S17I 3IX0A 2NVYI 2O4HA 3NH4A 4HGYA 3G71Z 3KIFA 1K8A2 4MD9A 1VQ9Z 2QLVB 3IFUA 1VQ51 3J81b 4MD8A 4NOZA 3I56Z 1VQ41 2JA5I 1Q7Y2 4A3LI 4A3CI 3F3FC 5C3EI 1N2FA 1RNIA 2JIQA 1S721 2H85A 2RBLA 1VQ5Z 3GKQA 1VQ4Z 3CPWY 3S2DI 4HGZA 1S72Z 3MZLB 2NVXI 4NBEA 4A3KI 3S15I 3D6WA 2JIMA 1M901 1KD11 1WIIA 1Z03A 4RVHA 1KC82 3S16I 2KI7B 3G4S1 1Q811 2YADA 3J80f 5A2Qb 2QR1B 3I07A 3CCM1 1Y1WI 3NDIA 3G4SZ 3NFZA 5FLXf 3S14I 2G2KA 3CCL1 1QYPA 1VQK1 1W2BY 1AA6A 4NB8A 1USPA 3CCMZ 3CCE1 2JR6A 1K731 4BBSI 4E32A 3VB9A 2GTHA 4DK1A 3CCLZ 1VQKZ 1WJ2A 2B63I 3CCEZ 2JA6I 3CCV1 1VQP1 1M902 3HOYI 4TNUA 1KD12 3ESWA 1NP6A 1YJ91 4MD7A 3CCVZ 3CQZI 1VQPZ 3KIHA 1QVGY 1SFOI 2Q4ZA 1M1K1 3OW2Z 1YJ9Z 3VMIA 1Q821 2E2JI 3GTMS 5IP7I 1YUAA 1P9NA 1KRLA 2LFUA 4AYBA 2V8JA 1JJ2Y 2F4MA 1QXFA 5T67A 2AKLA 2JS4A 2J6AA 1K732 3CCS1 1VQL1 1I50I 2IZ3A 3LUSA 3I551 1VQ81 3HOVI 1SIWA 1VQN1 3VMHA 5IT9f 1YIT1 5C4JI 3CCSZ 1VQLZ 1RLYA 2RIQA 3I55Z 1VQ8Z 2E7ZA 3S1NI 3GTKI 1ZH1A 2O53A 1VQNZ 2E9HA 1YITZ 2NVTI 3IR7A 5T6BA 3MONA 1WW9A 1JWHC 1RO0A 1VQ61 2HF1A 4MH4A 4A3JI 1FDOA 4QTTA 4MXUA 2IZ4A 1Z01A 3GTGI 3F3PC 1VQ6Z 4NBBA 3CXCZ 2M6NA 4A3MI 3CPWZ 3HKZA 2PK7A 2Y0SA 1Q861 3I4NI 5T64A 4NBDA 3G6E1 3JAMf 3GCFA 4A3DI 3HOUI 4NB9A
chains in the Genus database with same CATH topology
4E31A 3NDJA 2R7ZI 4X6AI 3G6EZ 1QVFZ 2W04A 2JA8I 3PO3S 3Q87A 3TE5B 2F4OA 4A3GI 3TDHB 5C44I 4A3FI 1RO4A 4QTUA 3CC41 3S1QI 2QKDA 1K9M1 3EERA 2WB1A 2QEX1 2JA7I 3J80b 1TFIA 4E33A 3GTJI 4BY7I 5CM2M 3IF8A 2VF1A 3CC4Z 2V8KA 5FLXb 2ZAEB 1Y1VS 2QEXZ 3VTNA 2EGTA 2DE6A 4A3EI 4E2WA 1W2BZ 4A93I 1NJI1 3PO2I 2PMZA 4MRIA 1I6HI 1DL6A 2QREB 2M48A 3VMGA 2R6MA 3FQMA 2GTIA 1Q862 1RQFA 4DQYB 1Q812 3CCU1 3GTPI 1X0TA 2E2II 1K8A1 3GTMI 2OTJ1 1Q7Y1 4NBGA 3CCUZ 4DGLA 3BG0B 3CCJ1 1QVGZ 3I4MI 1X3WA 2W03A 1WCMI 2E2HI 2OTJZ 1N8R1 1LQLA 1VQM1 1K9M2 4MONA 3CCJZ 5C4XI 1S7MA 3H3VJ 4S1TA 3FQQA 1X3ZA 3RZOI 2K5RA 3CC71 1KQSZ 1VQMZ 3P5JB 2JMOA 1QF8A 1JJ2Z 4HH4A 4RVDA 3J81f 1NJI2 2OOXB 3U50C 3CC7Z 5AN9F 1RO2A 2LIYA 3CME1 1KC81 2YU9I 3CCR1 1YJN1 1M1K2 4E2YA 1TWCI 4NBHA 5IP9I 5IT9b 4BBRI 1Q822 3CMEZ 1VLAA 3CCRZ 1TWHI 1YJNZ 1K83I 3D9XA 3S1MI 4RVFA 2BJOA 3HOWI 3FKII 3CXCY 3CC21 1I3QI 5D1PA 3CCQ1 4A3II 1N8R2 1TWAI 2K3RA 2PM9A 5D1OB 3NH5A 2JNYA 2R92I 3CC2Z 1PFTA 2HU9A 1YHQ1 3CCQZ 3GTQI 4CL1A 2RHBA 2GU2A 3NH8A 5A2Qf 3RZDI 4NBAA 3GTOI 1QVFY 4RV9A 1YHQZ 1ZB8A 3PO3I 1YUKA 2RPRA 3M3YI 3QWUA 3K7AI 1L1OC 4Y7NI 4BY1I 3JAMb 2OTL1 4BXXI 1YIJ1 2WAQA 3EEDA 3MZKB 2VUGA 1YJW1 2NVQI 2RT9A 2KPIA 3T4NB 1Y1VI 2OTLZ 1TWFI 1YIJZ 4XX2A 4Y52I 1YJWZ 4EWCA 2JUBA 2DE5A 4NH1C 1NUIA 5FLMI 3M4OI 3CD61 4E2XA 2QRCB 5LL6f 3OW2Y 1VQ71 3CD6Z 3BG1B 2OOYB 4E30A 1TWGI 2I3CA 1VQ7Z 3S2HI 2VUMI 1ZB9A 1Z02A 2P3YA 4A3BI 2V8IA 2Q51A 4E2ZA 1VQO1 2P28A 3GTLI 2QA41 4NFRA 2OZKA 5D1OA 3H0GI 1YI21 4NBCA 2R93I 1VQOZ 1KQSY 1R9TI 2QA4Z 1ML8A 3S1RI 3CMA1 3J7A4 1USPB 1YI2Z 3HOZI 3G711 2DE7A 4RVGA 4NBFA 3HOXI 4RS4A 2QRDB 1VQ91 3CMAZ 3I561 3S17I 3IX0A 2NVYI 2O4HA 3NH4A 4HGYA 3G71Z 3KIFA 1K8A2 4MD9A 1VQ9Z 2QLVB 3IFUA 1VQ51 3J81b 4MD8A 4NOZA 3I56Z 1VQ41 2JA5I 1Q7Y2 4A3LI 4A3CI 3F3FC 5C3EI 1N2FA 1RNIA 1S721 2H85A 2RBLA 1VQ5Z 3GKQA 1VQ4Z 3CPWY 3S2DI 4HGZA 1S72Z 3MZLB 2NVXI 4NBEA 4A3KI 3S15I 3D6WA 1M901 1KD11 1WIIA 1Z03A 4RVHA 1KC82 3S16I 2KI7B 3G4S1 1Q811 2YADA 3J80f 5A2Qb 2QR1B 3I07A 3CCM1 1Y1WI 3NDIA 3G4SZ 3NFZA 5FLXf 3S14I 2G2KA 3CCL1 1QYPA 1VQK1 1W2BY 4NB8A 1USPA 3CCMZ 3CCE1 2JR6A 1K731 4BBSI 4E32A 3VB9A 2GTHA 4DK1A 3CCLZ 1VQKZ 2B63I 3CCEZ 2JA6I 3CCV1 1VQP1 1M902 3HOYI 4TNUA 1KD12 3ESWA 1NP6A 1YJ91 4MD7A 3CCVZ 3CQZI 1VQPZ 3KIHA 1QVGY 1SFOI 2Q4ZA 1M1K1 3OW2Z 1YJ9Z 3VMIA 1Q821 2E2JI 3GTMS 5IP7I 1YUAA 1P9NA 1KRLA 2LFUA 4AYBA 2V8JA 1JJ2Y 2F4MA 5T67A 2AKLA 2JS4A 2J6AA 1K732 3CCS1 1VQL1 1I50I 2IZ3A 3LUSA 3I551 1VQ81 3HOVI 1VQN1 3VMHA 5IT9f 1YIT1 5C4JI 3CCSZ 1VQLZ 1RLYA 2RIQA 3I55Z 1VQ8Z 3S1NI 3GTKI 1ZH1A 2O53A 1VQNZ 2E9HA 1YITZ 2NVTI 5T6BA 3MONA 1WW9A 1JWHC 1RO0A 1VQ61 2HF1A 4MH4A 4A3JI 4QTTA 4MXUA 2IZ4A 1Z01A 3GTGI 3F3PC 1VQ6Z 4NBBA 3CXCZ 4A3MI 2M6NA 3CPWZ 3HKZA 2PK7A 2Y0SA 1Q861 3I4NI 5T64A 4NBDA 3G6E1 3JAMf 3GCFA 4A3DI 3HOUI 4NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 2;  1VQO Z;  1KQS Y;  2QA4 Z;  3G6E Z;  1QVF Z;  3CMA 1;  1KD1 2;  1YI2 Z;  1YJ9 1;  3G71 1;  3CXC Y;  3CC2 1;  3CCV Z;  1VQP Z;  1QVG Y;  3CCQ 1;  1N8R 2;  3CC4 1;  1M1K 1;  1VQ9 1;  1K9M 1;  3OW2 Z;  3CMA Z;  2QEX 1;  3I56 1;  1YJ9 Z;  3G71 Z;  1Q82 1;  3CC2 Z;  1YHQ 1;  1K8A 2;  3CCQ Z;  3CC4 Z;  1VQ9 Z;  1VQ5 1;  2QEX Z;  3I56 Z;  1VQ4 1;  1Q7Y 2;  1W2B Z;  1QVF Y;  1NJI 1;  1YHQ Z;  1JJ2 Y;  1S72 1;  1VQ5 Z;  1K73 2;  1Q86 2;  3CCS 1;  1VQ4 Z;  1VQL 1;  3CPW Y;  2OTL 1;  3I55 1;  1Q81 2;  1YIJ 1;  1VQ8 1;  3CCU 1;  1VQN 1;  1YJW 1;  1S72 Z;  1K8A 1;  1YIT 1;  3CCS Z;  1VQL Z;  1M90 1;  2OTJ 1;  2OTL Z;  3I55 Z;  1Q7Y 1;  1YIJ Z;  1VQ8 Z;  3CCU Z;  3CCJ 1;  1KD1 1;  1VQN Z;  1YJW Z;  1QVG Z;  1YIT Z;  1KC8 2;  2OTJ Z;  3CD6 1;  1N8R 1;  1VQM 1;  1K9M 2;  3G4S 1;  3CCJ Z;  1Q81 1;  3OW2 Y;  1VQ7 1;  1VQ6 1;  3CC7 1;  3CD6 Z;  1KQS Z;  3CCM 1;  1VQM Z;  3G4S Z;  1JJ2 Z;  1VQ7 Z;  1VQ6 Z;  3CXC Z;  1NJI 2;  3CCL 1;  1KC8 1;  3CC7 Z;  1VQK 1;  1W2B Y;  3CME 1;  3CCM Z;  3CCR 1;  3CCE 1;  3CPW Z;  1YJN 1;  1M1K 2;  1K73 1;  1Q86 1;  1VQO 1;  2QA4 1;  3G6E 1;  3CCL Z;  1Q82 2;  1VQK Z;  3CME Z;  1YI2 1;  3CCR Z;  3CCE Z;  3CCV 1;  1VQP 1;  1YJN Z; 
#chains in the Genus database with same CATH topology
 4E31 A;  3NDJ A;  2R7Z I;  4X6A I;  3G6E Z;  1QVF Z;  1Q16 A;  2W04 A;  2JA8 I;  3PO3 S;  3D2L A;  3Q87 A;  3TE5 B;  2F4O A;  4A3G I;  3TDH B;  5C44 I;  4A3F I;  1RO4 A;  4QTU A;  3CC4 1;  3S1Q I;  2QKD A;  1K9M 1;  3EER A;  2WB1 A;  2QEX 1;  2JA7 I;  3J80 b;  1TFI A;  4E33 A;  3GTJ I;  4BY7 I;  5CM2 M;  3IF8 A;  2VF1 A;  3CC4 Z;  2V8K A;  5FLX b;  2ZAE B;  1Y1V S;  2QEX Z;  3VTN A;  2EGT A;  2DE6 A;  4A3E I;  4E2W A;  1W2B Z;  4A93 I;  2VPX A;  1NJI 1;  3PO2 I;  2PMZ A;  4MRI A;  1I6H I;  1DL6 A;  2QRE B;  2M48 A;  3VMG A;  2VPZ A;  2R6M A;  3FQM A;  2GTI A;  1Q86 2;  1RQF A;  4DQY B;  1Q81 2;  3CCU 1;  3GTP I;  1X0T A;  2E2I I;  1K8A 1;  3GTM I;  2OTJ 1;  1Q7Y 1;  4NBG A;  3CCU Z;  2NAP A;  4DGL A;  3BG0 B;  3CCJ 1;  1QVG Z;  3I4M I;  1X3W A;  2W03 A;  1WCM I;  2LEX A;  2E2H I;  2OTJ Z;  1N8R 1;  1LQL A;  1VQM 1;  1K9M 2;  4MON A;  3CCJ Z;  5C4X I;  1S7M A;  3H3V J;  4S1T A;  3FQQ A;  1X3Z A;  3RZO I;  2K5R A;  3CC7 1;  1KQS Z;  1VQM Z;  3P5J B;  2JMO A;  1QF8 A;  1JJ2 Z;  4HH4 A;  4RVD A;  3J81 f;  1NJI 2;  2OOX B;  3U50 C;  5AN9 F;  1RO2 A;  2AYD A;  2LIY A;  3CME 1;  3CC7 Z;  1KC8 1;  2YU9 I;  3CCR 1;  1YJN 1;  1M1K 2;  4E2Y A;  1TWC I;  4NBH A;  5IP9 I;  5IT9 b;  4BBR I;  1Q82 2;  3CME Z;  1VLA A;  3CCR Z;  1TWH I;  1YJN Z;  1K83 I;  3D9X A;  3S1M I;  4RVF A;  2BJO A;  3HOW I;  2JIR A;  3FKI I;  3CXC Y;  3CC2 1;  1I3Q I;  5D1P A;  3CCQ 1;  4A3I I;  1N8R 2;  1TWA I;  2K3R A;  2PM9 A;  5D1O B;  3NH5 A;  2JNY A;  2R92 I;  3CC2 Z;  1PFT A;  2HU9 A;  1YHQ 1;  3CCQ Z;  3GTQ I;  4CL1 A;  2RHB A;  2GU2 A;  3NH8 A;  5A2Q f;  3RZD I;  4NBA A;  1FDI A;  3GTO I;  1QVF Y;  4RV9 A;  1YHQ Z;  1ZB8 A;  3PO3 I;  1YUK A;  2RPR A;  3M3Y I;  3QWU A;  3K7A I;  1L1O C;  4Y7N I;  4BY1 I;  3JAM b;  2OTL 1;  4BXX I;  1YIJ 1;  2WAQ A;  3EED A;  1Y8C A;  3MZK B;  2VUG A;  1YJW 1;  2NVQ I;  2RT9 A;  2KPI A;  3T4N B;  1Y1V I;  2OTL Z;  1TWF I;  1YIJ Z;  4XX2 A;  4Y52 I;  1YJW Z;  4EWC A;  2JUB A;  2DE5 A;  4NH1 C;  1NUI A;  5FLM I;  3M4O I;  2JIP A;  3CD6 1;  4E2X A;  2QRC B;  5LL6 f;  3OW2 Y;  1VQ7 1;  2VPY A;  2V45 A;  1WZN A;  3CD6 Z;  3BG1 B;  2OOY B;  4E30 A;  1TWG I;  2I3C A;  1VQ7 Z;  3S2H I;  2VUM I;  1ZB9 A;  1Z02 A;  2P3Y A;  4A3B I;  2V8I A;  2Q51 A;  4E2Z A;  1VQO 1;  2P28 A;  3GTL I;  2QA4 1;  2V3V A;  4NFR A;  2OZK A;  5D1O A;  2JIO A;  3H0G I;  1YI2 1;  2IV2 X;  4NBC A;  2R93 I;  1VQO Z;  1KQS Y;  1R9T I;  2QA4 Z;  1ML8 A;  3S1R I;  3CMA 1;  3J7A 4;  1USP B;  1YI2 Z;  3HOZ I;  3G71 1;  2DE7 A;  4RVG A;  4NBF A;  3HOX I;  4RS4 A;  2QRD B;  1VQ9 1;  2VPW A;  3CMA Z;  3I56 1;  3S17 I;  3IX0 A;  2NVY I;  2O4H A;  3NH4 A;  4HGY A;  3G71 Z;  3KIF A;  1K8A 2;  4MD9 A;  1VQ9 Z;  2QLV B;  3IFU A;  1VQ5 1;  3J81 b;  4MD8 A;  4NOZ A;  3I56 Z;  1VQ4 1;  2JA5 I;  1Q7Y 2;  4A3L I;  4A3C I;  3F3F C;  5C3E I;  1N2F A;  1RNI A;  2JIQ A;  1S72 1;  2H85 A;  2RBL A;  1VQ5 Z;  3GKQ A;  1VQ4 Z;  3CPW Y;  3S2D I;  4HGZ A;  1S72 Z;  3MZL B;  2NVX I;  4NBE A;  4A3K I;  3S15 I;  3D6W A;  2JIM A;  1M90 1;  1KD1 1;  1WII A;  1Z03 A;  4RVH A;  1KC8 2;  3S16 I;  2KI7 B;  3G4S 1;  1Q81 1;  2YAD A;  3J80 f;  5A2Q b;  2QR1 B;  3I07 A;  3CCM 1;  1Y1W I;  3NDI A;  3G4S Z;  3NFZ A;  5FLX f;  3S14 I;  2G2K A;  3CCL 1;  1QYP A;  1VQK 1;  1W2B Y;  1AA6 A;  4NB8 A;  1USP A;  3CCM Z;  3CCE 1;  2JR6 A;  1K73 1;  4BBS I;  4E32 A;  3VB9 A;  2GTH A;  4DK1 A;  3CCL Z;  1VQK Z;  1WJ2 A;  2B63 I;  3CCE Z;  2JA6 I;  3CCV 1;  1VQP 1;  1M90 2;  3HOY I;  4TNU A;  1KD1 2;  3ESW A;  1NP6 A;  1YJ9 1;  4MD7 A;  3CCV Z;  3CQZ I;  1VQP Z;  3KIH A;  1QVG Y;  1SFO I;  2Q4Z A;  1M1K 1;  3OW2 Z;  1YJ9 Z;  3VMI A;  1Q82 1;  2E2J I;  3GTM S;  5IP7 I;  1YUA A;  1P9N A;  1KRL A;  2LFU A;  4AYB A;  2V8J A;  1JJ2 Y;  2F4M A;  1QXF A;  5T67 A;  2AKL A;  2JS4 A;  2J6A A;  1K73 2;  3CCS 1;  1VQL 1;  1I50 I;  2IZ3 A;  3LUS A;  3I55 1;  1VQ8 1;  3HOV I;  1SIW A;  1VQN 1;  3VMH A;  5IT9 f;  1YIT 1;  5C4J I;  3CCS Z;  1VQL Z;  1RLY A;  2RIQ A;  3I55 Z;  1VQ8 Z;  2E7Z A;  3S1N I;  3GTK I;  1ZH1 A;  2O53 A;  1VQN Z;  2E9H A;  1YIT Z;  2NVT I;  3IR7 A;  5T6B A;  3MON A;  1WW9 A;  1JWH C;  1RO0 A;  1VQ6 1;  2HF1 A;  4MH4 A;  4A3J I;  1FDO A;  4QTT A;  4MXU A;  2IZ4 A;  1Z01 A;  3GTG I;  3F3P C;  1VQ6 Z;  4NBB A;  3CXC Z;  2M6N A;  4A3M I;  3CPW Z;  3HKZ A;  2PK7 A;  2Y0S A;  1Q86 1;  3I4N I;  5T64 A;  4NBD A;  3G6E 1;  3JAM f;  3GCF A;  4A3D I;  3HOU I;  4NB9 A; 
#chains in the Genus database with same CATH homology
 4E31 A;  3NDJ A;  2R7Z I;  4X6A I;  3G6E Z;  1QVF Z;  2W04 A;  2JA8 I;  3PO3 S;  3Q87 A;  3TE5 B;  2F4O A;  4A3G I;  3TDH B;  5C44 I;  4A3F I;  1RO4 A;  4QTU A;  3CC4 1;  3S1Q I;  2QKD A;  1K9M 1;  3EER A;  2WB1 A;  2QEX 1;  2JA7 I;  3J80 b;  1TFI A;  4E33 A;  3GTJ I;  4BY7 I;  5CM2 M;  3IF8 A;  2VF1 A;  3CC4 Z;  2V8K A;  5FLX b;  2ZAE B;  1Y1V S;  2QEX Z;  3VTN A;  2EGT A;  2DE6 A;  4A3E I;  4E2W A;  1W2B Z;  4A93 I;  1NJI 1;  3PO2 I;  2PMZ A;  4MRI A;  1I6H I;  1DL6 A;  2QRE B;  2M48 A;  3VMG A;  2R6M A;  3FQM A;  2GTI A;  1Q86 2;  1RQF A;  4DQY B;  1Q81 2;  3CCU 1;  3GTP I;  1X0T A;  2E2I I;  1K8A 1;  3GTM I;  2OTJ 1;  1Q7Y 1;  4NBG A;  3CCU Z;  4DGL A;  3BG0 B;  3CCJ 1;  1QVG Z;  3I4M I;  1X3W A;  2W03 A;  1WCM I;  2E2H I;  2OTJ Z;  1N8R 1;  1LQL A;  1VQM 1;  1K9M 2;  4MON A;  3CCJ Z;  5C4X I;  1S7M A;  3H3V J;  4S1T A;  3FQQ A;  1X3Z A;  3RZO I;  2K5R A;  3CC7 1;  1KQS Z;  1VQM Z;  3P5J B;  2JMO A;  1QF8 A;  1JJ2 Z;  4HH4 A;  4RVD A;  3J81 f;  1NJI 2;  2OOX B;  3U50 C;  3CC7 Z;  5AN9 F;  1RO2 A;  2LIY A;  3CME 1;  1KC8 1;  2YU9 I;  3CCR 1;  1YJN 1;  1M1K 2;  4E2Y A;  1TWC I;  4NBH A;  5IP9 I;  5IT9 b;  4BBR I;  1Q82 2;  3CME Z;  1VLA A;  3CCR Z;  1TWH I;  1YJN Z;  1K83 I;  3D9X A;  3S1M I;  4RVF A;  2BJO A;  3HOW I;  3FKI I;  3CXC Y;  3CC2 1;  1I3Q I;  5D1P A;  3CCQ 1;  4A3I I;  1N8R 2;  1TWA I;  2K3R A;  2PM9 A;  5D1O B;  3NH5 A;  2JNY A;  2R92 I;  3CC2 Z;  1PFT A;  2HU9 A;  1YHQ 1;  3CCQ Z;  3GTQ I;  4CL1 A;  2RHB A;  2GU2 A;  3NH8 A;  5A2Q f;  3RZD I;  4NBA A;  3GTO I;  1QVF Y;  4RV9 A;  1YHQ Z;  1ZB8 A;  3PO3 I;  1YUK A;  2RPR A;  3M3Y I;  3QWU A;  3K7A I;  1L1O C;  4Y7N I;  4BY1 I;  3JAM b;  2OTL 1;  4BXX I;  1YIJ 1;  2WAQ A;  3EED A;  3MZK B;  2VUG A;  1YJW 1;  2NVQ I;  2RT9 A;  2KPI A;  3T4N B;  1Y1V I;  2OTL Z;  1TWF I;  1YIJ Z;  4XX2 A;  4Y52 I;  1YJW Z;  4EWC A;  2JUB A;  2DE5 A;  4NH1 C;  1NUI A;  5FLM I;  3M4O I;  3CD6 1;  4E2X A;  2QRC B;  5LL6 f;  3OW2 Y;  1VQ7 1;  3CD6 Z;  3BG1 B;  2OOY B;  4E30 A;  1TWG I;  2I3C A;  1VQ7 Z;  3S2H I;  2VUM I;  1ZB9 A;  1Z02 A;  2P3Y A;  4A3B I;  2V8I A;  2Q51 A;  4E2Z A;  1VQO 1;  2P28 A;  3GTL I;  2QA4 1;  4NFR A;  2OZK A;  5D1O A;  3H0G I;  1YI2 1;  4NBC A;  2R93 I;  1VQO Z;  1KQS Y;  1R9T I;  2QA4 Z;  1ML8 A;  3S1R I;  3CMA 1;  3J7A 4;  1USP B;  1YI2 Z;  3HOZ I;  3G71 1;  2DE7 A;  4RVG A;  4NBF A;  3HOX I;  4RS4 A;  2QRD B;  1VQ9 1;  3CMA Z;  3I56 1;  3S17 I;  3IX0 A;  2NVY I;  2O4H A;  3NH4 A;  4HGY A;  3G71 Z;  3KIF A;  1K8A 2;  4MD9 A;  1VQ9 Z;  2QLV B;  3IFU A;  1VQ5 1;  3J81 b;  4MD8 A;  4NOZ A;  3I56 Z;  1VQ4 1;  2JA5 I;  1Q7Y 2;  4A3L I;  4A3C I;  3F3F C;  5C3E I;  1N2F A;  1RNI A;  1S72 1;  2H85 A;  2RBL A;  1VQ5 Z;  3GKQ A;  1VQ4 Z;  3CPW Y;  3S2D I;  4HGZ A;  1S72 Z;  3MZL B;  2NVX I;  4NBE A;  4A3K I;  3S15 I;  3D6W A;  1M90 1;  1KD1 1;  1WII A;  1Z03 A;  4RVH A;  1KC8 2;  3S16 I;  2KI7 B;  3G4S 1;  1Q81 1;  2YAD A;  3J80 f;  5A2Q b;  2QR1 B;  3I07 A;  3CCM 1;  1Y1W I;  3NDI A;  3G4S Z;  3NFZ A;  5FLX f;  3S14 I;  2G2K A;  3CCL 1;  1QYP A;  1VQK 1;  1W2B Y;  4NB8 A;  1USP A;  3CCM Z;  3CCE 1;  2JR6 A;  1K73 1;  4BBS I;  4E32 A;  3VB9 A;  2GTH A;  4DK1 A;  3CCL Z;  1VQK Z;  2B63 I;  3CCE Z;  2JA6 I;  3CCV 1;  1VQP 1;  1M90 2;  3HOY I;  4TNU A;  1KD1 2;  3ESW A;  1NP6 A;  1YJ9 1;  4MD7 A;  3CCV Z;  3CQZ I;  1VQP Z;  3KIH A;  1QVG Y;  1SFO I;  2Q4Z A;  1M1K 1;  3OW2 Z;  1YJ9 Z;  3VMI A;  1Q82 1;  2E2J I;  3GTM S;  5IP7 I;  1YUA A;  1P9N A;  1KRL A;  2LFU A;  4AYB A;  2V8J A;  1JJ2 Y;  2F4M A;  5T67 A;  2AKL A;  2JS4 A;  2J6A A;  1K73 2;  3CCS 1;  1VQL 1;  1I50 I;  2IZ3 A;  3LUS A;  3I55 1;  1VQ8 1;  3HOV I;  1VQN 1;  3VMH A;  5IT9 f;  1YIT 1;  5C4J I;  3CCS Z;  1VQL Z;  1RLY A;  2RIQ A;  3I55 Z;  1VQ8 Z;  3S1N I;  3GTK I;  1ZH1 A;  2O53 A;  1VQN Z;  2E9H A;  1YIT Z;  2NVT I;  5T6B A;  3MON A;  1WW9 A;  1JWH C;  1RO0 A;  1VQ6 1;  2HF1 A;  4MH4 A;  4A3J I;  4QTT A;  4MXU A;  2IZ4 A;  1Z01 A;  3GTG I;  3F3P C;  1VQ6 Z;  4NBB A;  3CXC Z;  4A3M I;  2M6N A;  3CPW Z;  3HKZ A;  2PK7 A;  2Y0S A;  1Q86 1;  3I4N I;  5T64 A;  4NBD A;  3G6E 1;  3JAM f;  3GCF A;  4A3D I;  3HOU I;  4NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...