3JAMb

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamb00
5IT9b 5FLXb 3JAMb 5A2Qb 5LL6f 3J7A4 3J81b 3J80b
chains in the Genus database with same CATH superfamily
5IT9f 1R9TI 4NH1C 1YUAA 4QTTA 3CD6Z 1SIWA 1VQ61 3U50C 1M1K2 5IP7I 3JAMb 2VPYA 2NVYI 2K5RA 4E32A 2DE7A 3CC4Z 1W2BZ 1M902 3I4NI 4HGYA 3FQMA 4NBHA 2RHBA 4NB9A 2V8IA 3S1QI 2E7ZA 2QA4Z 1RO2A 1M1K1 3CCS1 4RVHA 1YJ91 1SFOI 1VQ5Z 2OTL1 2WAQA 4MXUA 2JA5I 1TWAI 5A2Qb 1TWGI 2AKLA 3HKZA 1YJN1 2NAPA 4Y52I 3KIHA 1Q821 2IZ3A 4S1TA 4NB8A 2RBLA 1S721 3I551 4NBAA 3PO3I 4BY1I 1Y8CA 1YI21 1VQMZ 5FLXb 1N8R2 1QVFY 3MONA 2OTJ1 4AYBA 3CPWZ 3GTGI 4A3JI 1VQK1 4TNUA 2M48A 1FDIA 2Q51A 1VQ9Z 1WZNA 3GTPI 2O53A 4MONA 1N8R1 2O4HA 3CMA1 3CCRZ 1RO0A 2QEX1 1K732 2JMOA 5D1OA 2LFUA 1DL6A 1Y1WI 4NBGA 1S7MA 2RPRA 1JJ2Y 3I4MI 3OW2Y 4Y7NI 2NVQI 4A3MI 1VQLZ 1QVGZ 1K731 4A3II 3GTKI 2E9HA 3GTOI 2EGTA 1WJ2A 4E2ZA 1YHQZ 2NVXI 3CQZI 4EWCA 2E2HI 1Y1VS 1TWCI 3KIFA 3VB9A 3G4S1 2LEXA 2KPIA 2JS4A 1QVFZ 4E30A 1VQO1 2W03A 3D2LA 2QRCB 4DGLA 2R6MA 3CCL1 2F4MA 3TE5B 3VMGA 3FQQA 3NDIA 2JIQA 3NH5A 1VQ6Z 1FDOA 1YIJ1 3IFUA 4DQYB 4RV9A 2IV2X 1KC82 4MD9A 3M4OI 3H3VJ 2RIQA 3GTLI 3K7AI 1P9NA 3G71Z 5IT9b 4X6AI 3I561 5T6BA 1JJ2Z 3OW2Z 1KC81 3CCSZ 5AN9F 1YJ9Z 3PO2I 4NBCA 3HOXI 4CL1A 3HOYI 1Q822 3EEDA 1Z03A 4NBEA 1YJNZ 4HGZA 1I6HI 4E33A 5LL6f 3S17I 4E31A 4QTUA 2I3CA 1K83I 3CME1 1S72Z 3I55Z 2VPXA 3VMHA 5CM2M 3CCQ1 1ML8A 2JUBA 1VLAA 3RZDI 2OTJZ 2DE6A 2JIRA 1VQKZ 3GTMI 1I3QI 3H0GI 1KQSY 2B63I 1USPB 2PM9A 4A3GI 3CMAZ 4RS4A 4BBRI 3CC21 2QEXZ 4A3CI 5C3EI 2QR1B 3CCU1 1YJW1 3BG0B 3HOWI 1L1OC 2JIOA 2BJOA 1YUKA 2R92I 2VPWA 2F4OA 1WCMI 3D9XA 3J81f 2GTIA 4MD8A 2ZAEB 4NFRA 1Q812 2IZ4A 2JIMA 3NFZA 3NH4A 3GTMS 3PO3S 1Q16A 1JWHC 3GKQA 2JNYA 2OOXB 3MZKB 2Y0SA 2JA6I 2J6AA 1VQP1 2YADA 2JR6A 3BG1B 4NBBA 1VQ8Z 2R93I 1Q811 1K8A2 5C4XI 3M3YI 2K3RA 1VQOZ 3Q87A 1VQ71 3D6WA 3CCE1 1KD12 1QXFA 2NVTI 1KQSZ 3IF8A 3S1NI 3S2HI 4XX2A 3FKII 1YIJZ 1I50I 3F3FC 4NBDA 1K8A1 3MZLB 4RVGA 4A3EI 2OOYB 2VUGA 4A3BI 1Q862 4A3DI 3CC71 1WIIA 1KD11 3G6E1 1VQ41 4HH4A 1LQLA 3I56Z 3VMIA 4RVDA 3J7A4 2V8JA 3J80f 5FLMI 2OZKA 2JA7I 3GTQI 2QREB 2DE5A 1RO4A 2AYDA 3ESWA 1Q861 3IX0A 2WB1A 5T67A 2QRDB 1YIT1 2QLVB 1WW9A 2HF1A 3CMEZ 2OTLZ 5C4JI 5D1OB 4DK1A 1ZH1A 3CCQZ 4A3FI 1VQN1 4BXXI 3CCV1 3JAMf 5IP9I 3CCM1 3CCJ1 1NP6A 1K9M2 4BY7I 3NDJA 3TDHB 2QKDA 1YI2Z 2E2II 1QF8A 3CD61 2H85A 3G711 3CC2Z 4A3KI 5A2Qf 1K9M1 3S1RI 3CCUZ 1YJWZ 1TWFI 1QVGY 2YU9I 3RZOI 3CC41 2R7ZI 1X0TA 4MH4A 1M901 2V3VA 3HOUI 2VPZA 1X3ZA 5C44I 2QA41 3P5JB 3F3PC 4NOZA 1VQ51 1RNIA 5FLXf 2VF1A 3EERA 1Q7Y2 1ZB9A 2PK7A 1TWHI 3S15I 1X3WA 2HU9A 2E2JI 1VQPZ 2V8KA 3CXCY 3J81b 1Z01A 2JA8I 1VQM1 1Q7Y1 2GTHA 4NBFA 1Y1VI 1ZB8A 1PFTA 1RLYA 1Z02A 2KI7B 1VQ7Z 2W04A 5T64A 3CCEZ 3HOVI 3G4SZ 1VQ91 3NH8A 1AA6A 3I07A 1NJI2 4E2XA 4E2YA 4E2WA 3CCR1 3IR7A 3CCLZ 3T4NB 2LIYA 4MD7A 3CC7Z 3S14I 1W2BY 3G6EZ 1VQ4Z 2P28A 1KRLA 2JIPA 3GTJI 1TFIA 1NUIA 2G2KA 1RQFA 3HOZI 2V45A 1NJI1 1VQL1 2Q4ZA 4BBSI 3S1MI 1USPA 4RVFA 2M6NA 4A3LI 2GU2A 3LUSA 2P3YA 1YHQ1 1VQ81 1YITZ 1N2FA 3J80b 3VTNA 4MRIA 2PMZA 5D1PA 1QYPA 3S2DI 3CXCZ 3QWUA 1VQNZ 3S16I 3CCVZ 2RT9A 4A93I 2VUMI 3GCFA 3CCMZ 3CCJZ 3CPWY
chains in the Genus database with same CATH topology
5IT9f 1R9TI 4NH1C 1YUAA 4QTTA 3CD6Z 1VQ61 3U50C 1M1K2 5IP7I 3JAMb 2NVYI 2K5RA 4E32A 2DE7A 3CC4Z 1W2BZ 1M902 3I4NI 4HGYA 3FQMA 4NBHA 2RHBA 4NB9A 2V8IA 3S1QI 2QA4Z 1RO2A 1M1K1 3CCS1 4RVHA 1YJ91 1SFOI 1VQ5Z 2OTL1 2WAQA 4MXUA 2JA5I 1TWAI 5A2Qb 1TWGI 2AKLA 3HKZA 1YJN1 4Y52I 3KIHA 1Q821 2IZ3A 4S1TA 4NB8A 2RBLA 1S721 3I551 4NBAA 3PO3I 4BY1I 1YI21 1VQMZ 5FLXb 1N8R2 1QVFY 3MONA 2OTJ1 4AYBA 3CPWZ 3GTGI 4A3JI 1VQK1 4TNUA 2M48A 2Q51A 1VQ9Z 3GTPI 2O53A 4MONA 1N8R1 2O4HA 3CMA1 3CCRZ 1RO0A 2QEX1 1K732 2JMOA 5D1OA 2LFUA 1DL6A 1Y1WI 4NBGA 1S7MA 2RPRA 1JJ2Y 3I4MI 3OW2Y 4Y7NI 2NVQI 4A3MI 1VQLZ 1QVGZ 1K731 4A3II 3GTKI 2E9HA 3GTOI 2EGTA 4E2ZA 1YHQZ 2NVXI 3CQZI 4EWCA 2E2HI 1Y1VS 1TWCI 3KIFA 3VB9A 3G4S1 2KPIA 2JS4A 1QVFZ 4E30A 1VQO1 2W03A 2QRCB 4DGLA 2R6MA 3CCL1 2F4MA 3TE5B 3VMGA 3FQQA 3NDIA 3NH5A 1VQ6Z 1YIJ1 3IFUA 4DQYB 4RV9A 1KC82 4MD9A 3M4OI 3H3VJ 2RIQA 3GTLI 3K7AI 1P9NA 3G71Z 5IT9b 4X6AI 3I561 5T6BA 1JJ2Z 3OW2Z 1KC81 3CCSZ 5AN9F 1YJ9Z 3PO2I 4NBCA 3HOXI 4CL1A 3HOYI 1Q822 3EEDA 1Z03A 4NBEA 1YJNZ 4HGZA 1I6HI 4E33A 5LL6f 3S17I 4E31A 4QTUA 2I3CA 1K83I 3CME1 1S72Z 3I55Z 3VMHA 5CM2M 3CCQ1 1ML8A 2JUBA 1VLAA 3RZDI 2OTJZ 2DE6A 1VQKZ 3GTMI 1I3QI 3H0GI 1KQSY 2B63I 1USPB 2PM9A 4A3GI 3CMAZ 4RS4A 4BBRI 3CC21 2QEXZ 4A3CI 5C3EI 2QR1B 3CCU1 1YJW1 3BG0B 3HOWI 1L1OC 2BJOA 1YUKA 2R92I 2F4OA 1WCMI 3D9XA 3J81f 2GTIA 4MD8A 2ZAEB 4NFRA 1Q812 2IZ4A 3NFZA 3NH4A 3GTMS 3PO3S 1JWHC 3GKQA 2JNYA 2OOXB 3MZKB 2Y0SA 2JA6I 2J6AA 1VQP1 2YADA 2JR6A 3BG1B 4NBBA 1VQ8Z 2R93I 1Q811 1K8A2 5C4XI 3M3YI 2K3RA 1VQOZ 3Q87A 1VQ71 3D6WA 3CCE1 1KD12 2NVTI 1KQSZ 3IF8A 3S1NI 3S2HI 4XX2A 3FKII 1YIJZ 1I50I 3F3FC 4NBDA 1K8A1 3MZLB 4RVGA 4A3EI 2OOYB 2VUGA 4A3BI 1Q862 4A3DI 3CC71 1WIIA 1KD11 3G6E1 1VQ41 4HH4A 1LQLA 3I56Z 3VMIA 4RVDA 3J7A4 2V8JA 3J80f 5FLMI 2OZKA 2JA7I 3GTQI 2QREB 2DE5A 1RO4A 3ESWA 1Q861 3IX0A 2WB1A 5T67A 2QRDB 1YIT1 2QLVB 1WW9A 2HF1A 3CMEZ 2OTLZ 5C4JI 5D1OB 4DK1A 1ZH1A 3CCQZ 4A3FI 1VQN1 4BXXI 3CCV1 3JAMf 5IP9I 3CCM1 3CCJ1 1NP6A 1K9M2 4BY7I 3NDJA 3TDHB 2QKDA 1YI2Z 2E2II 1QF8A 3CD61 2H85A 3G711 3CC2Z 4A3KI 5A2Qf 1K9M1 3S1RI 3CCUZ 1YJWZ 1TWFI 1QVGY 2YU9I 3RZOI 3CC41 2R7ZI 1X0TA 4MH4A 1M901 3HOUI 1X3ZA 5C44I 2QA41 3P5JB 3F3PC 4NOZA 1VQ51 1RNIA 5FLXf 2VF1A 3EERA 1Q7Y2 1ZB9A 2PK7A 1TWHI 3S15I 1X3WA 2HU9A 2E2JI 1VQPZ 2V8KA 3CXCY 3J81b 1Z01A 2JA8I 1VQM1 1Q7Y1 2GTHA 4NBFA 1Y1VI 1ZB8A 1PFTA 1RLYA 1Z02A 2KI7B 1VQ7Z 2W04A 5T64A 3CCEZ 3HOVI 3G4SZ 1VQ91 3NH8A 3I07A 1NJI2 4E2XA 4E2YA 4E2WA 3CCR1 3CCLZ 3T4NB 2LIYA 4MD7A 3CC7Z 3S14I 1W2BY 3G6EZ 1VQ4Z 2P28A 1KRLA 3GTJI 1TFIA 1NUIA 2G2KA 1RQFA 3HOZI 1NJI1 1VQL1 4BBSI 2Q4ZA 3S1MI 1USPA 4RVFA 2M6NA 4A3LI 2GU2A 3LUSA 2P3YA 1YHQ1 1VQ81 1YITZ 1N2FA 3J80b 3VTNA 4MRIA 2PMZA 5D1PA 1QYPA 3S2DI 3CXCZ 3QWUA 1VQNZ 3S16I 3CCVZ 2RT9A 4A93I 2VUMI 3GCFA 3CCMZ 3CCJZ 3CPWY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 b;  5FLX b;  3JAM b;  5A2Q b;  5LL6 f;  3J7A 4;  3J81 b;  3J80 b; 
#chains in the Genus database with same CATH topology
 5IT9 f;  1R9T I;  4NH1 C;  1YUA A;  4QTT A;  3CD6 Z;  1SIW A;  1VQ6 1;  3U50 C;  1M1K 2;  5IP7 I;  3JAM b;  2VPY A;  2NVY I;  2K5R A;  4E32 A;  2DE7 A;  3CC4 Z;  1W2B Z;  1M90 2;  3I4N I;  4HGY A;  3FQM A;  4NBH A;  2RHB A;  4NB9 A;  2V8I A;  3S1Q I;  2E7Z A;  2QA4 Z;  1RO2 A;  1M1K 1;  3CCS 1;  4RVH A;  1YJ9 1;  1SFO I;  1VQ5 Z;  2OTL 1;  2WAQ A;  4MXU A;  2JA5 I;  1TWA I;  5A2Q b;  1TWG I;  2AKL A;  3HKZ A;  1YJN 1;  2NAP A;  4Y52 I;  3KIH A;  1Q82 1;  2IZ3 A;  4S1T A;  4NB8 A;  2RBL A;  1S72 1;  3I55 1;  4NBA A;  3PO3 I;  4BY1 I;  1Y8C A;  1YI2 1;  1VQM Z;  5FLX b;  1N8R 2;  1QVF Y;  3MON A;  2OTJ 1;  4AYB A;  3CPW Z;  3GTG I;  4A3J I;  1VQK 1;  4TNU A;  2M48 A;  1FDI A;  2Q51 A;  1VQ9 Z;  1WZN A;  3GTP I;  2O53 A;  4MON A;  1N8R 1;  2O4H A;  3CMA 1;  3CCR Z;  1RO0 A;  2QEX 1;  1K73 2;  2JMO A;  5D1O A;  2LFU A;  1DL6 A;  1Y1W I;  4NBG A;  1S7M A;  2RPR A;  1JJ2 Y;  3I4M I;  3OW2 Y;  4Y7N I;  2NVQ I;  4A3M I;  1VQL Z;  1QVG Z;  1K73 1;  4A3I I;  3GTK I;  2E9H A;  3GTO I;  2EGT A;  1WJ2 A;  4E2Z A;  1YHQ Z;  2NVX I;  3CQZ I;  4EWC A;  2E2H I;  1Y1V S;  1TWC I;  3KIF A;  3VB9 A;  3G4S 1;  2LEX A;  2KPI A;  2JS4 A;  1QVF Z;  4E30 A;  1VQO 1;  2W03 A;  3D2L A;  2QRC B;  4DGL A;  2R6M A;  3CCL 1;  2F4M A;  3TE5 B;  3VMG A;  3FQQ A;  3NDI A;  2JIQ A;  3NH5 A;  1VQ6 Z;  1FDO A;  1YIJ 1;  3IFU A;  4DQY B;  4RV9 A;  2IV2 X;  1KC8 2;  4MD9 A;  3M4O I;  3H3V J;  2RIQ A;  3GTL I;  3K7A I;  1P9N A;  3G71 Z;  5IT9 b;  4X6A I;  3I56 1;  5T6B A;  1JJ2 Z;  3OW2 Z;  1KC8 1;  3CCS Z;  5AN9 F;  1YJ9 Z;  3PO2 I;  4NBC A;  3HOX I;  4CL1 A;  3HOY I;  1Q82 2;  3EED A;  1Z03 A;  4NBE A;  1YJN Z;  4HGZ A;  1I6H I;  4E33 A;  5LL6 f;  3S17 I;  4E31 A;  4QTU A;  2I3C A;  1K83 I;  3CME 1;  1S72 Z;  3I55 Z;  2VPX A;  3VMH A;  5CM2 M;  3CCQ 1;  1ML8 A;  2JUB A;  1VLA A;  3RZD I;  2OTJ Z;  2DE6 A;  2JIR A;  1VQK Z;  3GTM I;  1I3Q I;  3H0G I;  1KQS Y;  2B63 I;  1USP B;  2PM9 A;  4A3G I;  3CMA Z;  4RS4 A;  4BBR I;  3CC2 1;  2QEX Z;  4A3C I;  5C3E I;  2QR1 B;  3CCU 1;  1YJW 1;  3BG0 B;  3HOW I;  1L1O C;  2JIO A;  2BJO A;  1YUK A;  2R92 I;  2VPW A;  2F4O A;  1WCM I;  3D9X A;  3J81 f;  2GTI A;  4MD8 A;  2ZAE B;  4NFR A;  1Q81 2;  2IZ4 A;  2JIM A;  3NFZ A;  3NH4 A;  3GTM S;  3PO3 S;  1Q16 A;  1JWH C;  3GKQ A;  2JNY A;  2OOX B;  3MZK B;  2Y0S A;  2JA6 I;  2J6A A;  1VQP 1;  2YAD A;  2JR6 A;  3BG1 B;  4NBB A;  1VQ8 Z;  2R93 I;  1Q81 1;  1K8A 2;  5C4X I;  3M3Y I;  2K3R A;  1VQO Z;  3Q87 A;  1VQ7 1;  3D6W A;  3CCE 1;  1KD1 2;  1QXF A;  2NVT I;  1KQS Z;  3IF8 A;  3S1N I;  3S2H I;  4XX2 A;  3FKI I;  1YIJ Z;  1I50 I;  3F3F C;  4NBD A;  1K8A 1;  3MZL B;  4RVG A;  4A3E I;  2OOY B;  2VUG A;  4A3B I;  1Q86 2;  4A3D I;  3CC7 1;  1WII A;  1KD1 1;  3G6E 1;  1VQ4 1;  4HH4 A;  1LQL A;  3I56 Z;  3VMI A;  4RVD A;  3J7A 4;  2V8J A;  3J80 f;  5FLM I;  2OZK A;  2JA7 I;  3GTQ I;  2QRE B;  2DE5 A;  1RO4 A;  2AYD A;  3ESW A;  1Q86 1;  3IX0 A;  2WB1 A;  5T67 A;  2QRD B;  1YIT 1;  2QLV B;  1WW9 A;  2HF1 A;  3CME Z;  2OTL Z;  5C4J I;  5D1O B;  4DK1 A;  1ZH1 A;  3CCQ Z;  4A3F I;  1VQN 1;  4BXX I;  3CCV 1;  3JAM f;  5IP9 I;  3CCM 1;  3CCJ 1;  1NP6 A;  1K9M 2;  4BY7 I;  3NDJ A;  3TDH B;  2QKD A;  1YI2 Z;  2E2I I;  1QF8 A;  3CD6 1;  2H85 A;  3G71 1;  3CC2 Z;  4A3K I;  5A2Q f;  1K9M 1;  3S1R I;  3CCU Z;  1YJW Z;  1TWF I;  1QVG Y;  2YU9 I;  3RZO I;  3CC4 1;  2R7Z I;  1X0T A;  4MH4 A;  1M90 1;  2V3V A;  3HOU I;  2VPZ A;  1X3Z A;  5C44 I;  2QA4 1;  3P5J B;  3F3P C;  4NOZ A;  1VQ5 1;  1RNI A;  5FLX f;  2VF1 A;  3EER A;  1Q7Y 2;  1ZB9 A;  2PK7 A;  1TWH I;  3S15 I;  1X3W A;  2HU9 A;  2E2J I;  1VQP Z;  2V8K A;  3CXC Y;  3J81 b;  1Z01 A;  2JA8 I;  1VQM 1;  1Q7Y 1;  2GTH A;  4NBF A;  1Y1V I;  1ZB8 A;  1PFT A;  1RLY A;  1Z02 A;  2KI7 B;  1VQ7 Z;  2W04 A;  5T64 A;  3CCE Z;  3HOV I;  3G4S Z;  1VQ9 1;  3NH8 A;  1AA6 A;  3I07 A;  1NJI 2;  4E2X A;  4E2Y A;  4E2W A;  3CCR 1;  3IR7 A;  3CCL Z;  3T4N B;  2LIY A;  4MD7 A;  3CC7 Z;  3S14 I;  1W2B Y;  3G6E Z;  1VQ4 Z;  2P28 A;  1KRL A;  2JIP A;  3GTJ I;  1TFI A;  1NUI A;  2G2K A;  1RQF A;  3HOZ I;  2V45 A;  1NJI 1;  1VQL 1;  2Q4Z A;  4BBS I;  3S1M I;  1USP A;  4RVF A;  2M6N A;  4A3L I;  2GU2 A;  3LUS A;  2P3Y A;  1YHQ 1;  1VQ8 1;  1YIT Z;  1N2F A;  3J80 b;  3VTN A;  4MRI A;  2PMZ A;  5D1P A;  1QYP A;  3S2D I;  3CXC Z;  3QWU A;  1VQN Z;  3S16 I;  3CCV Z;  2RT9 A;  4A93 I;  2VUM I;  3GCF A;  3CCM Z;  3CCJ Z;  3CPW Y; 
#chains in the Genus database with same CATH homology
 5IT9 f;  1R9T I;  4NH1 C;  1YUA A;  4QTT A;  3CD6 Z;  1VQ6 1;  3U50 C;  1M1K 2;  5IP7 I;  3JAM b;  2NVY I;  2K5R A;  4E32 A;  2DE7 A;  3CC4 Z;  1W2B Z;  1M90 2;  3I4N I;  4HGY A;  3FQM A;  4NBH A;  2RHB A;  4NB9 A;  2V8I A;  3S1Q I;  2QA4 Z;  1RO2 A;  1M1K 1;  3CCS 1;  4RVH A;  1YJ9 1;  1SFO I;  1VQ5 Z;  2OTL 1;  2WAQ A;  4MXU A;  2JA5 I;  1TWA I;  5A2Q b;  1TWG I;  2AKL A;  3HKZ A;  1YJN 1;  4Y52 I;  3KIH A;  1Q82 1;  2IZ3 A;  4S1T A;  4NB8 A;  2RBL A;  1S72 1;  3I55 1;  4NBA A;  3PO3 I;  4BY1 I;  1YI2 1;  1VQM Z;  5FLX b;  1N8R 2;  1QVF Y;  3MON A;  2OTJ 1;  4AYB A;  3CPW Z;  3GTG I;  4A3J I;  1VQK 1;  4TNU A;  2M48 A;  2Q51 A;  1VQ9 Z;  3GTP I;  2O53 A;  4MON A;  1N8R 1;  2O4H A;  3CMA 1;  3CCR Z;  1RO0 A;  2QEX 1;  1K73 2;  2JMO A;  5D1O A;  2LFU A;  1DL6 A;  1Y1W I;  4NBG A;  1S7M A;  2RPR A;  1JJ2 Y;  3I4M I;  3OW2 Y;  4Y7N I;  2NVQ I;  4A3M I;  1VQL Z;  1QVG Z;  1K73 1;  4A3I I;  3GTK I;  2E9H A;  3GTO I;  2EGT A;  4E2Z A;  1YHQ Z;  2NVX I;  3CQZ I;  4EWC A;  2E2H I;  1Y1V S;  1TWC I;  3KIF A;  3VB9 A;  3G4S 1;  2KPI A;  2JS4 A;  1QVF Z;  4E30 A;  1VQO 1;  2W03 A;  2QRC B;  4DGL A;  2R6M A;  3CCL 1;  2F4M A;  3TE5 B;  3VMG A;  3FQQ A;  3NDI A;  3NH5 A;  1VQ6 Z;  1YIJ 1;  3IFU A;  4DQY B;  4RV9 A;  1KC8 2;  4MD9 A;  3M4O I;  3H3V J;  2RIQ A;  3GTL I;  3K7A I;  1P9N A;  3G71 Z;  5IT9 b;  4X6A I;  3I56 1;  5T6B A;  1JJ2 Z;  3OW2 Z;  1KC8 1;  3CCS Z;  5AN9 F;  1YJ9 Z;  3PO2 I;  4NBC A;  3HOX I;  4CL1 A;  3HOY I;  1Q82 2;  3EED A;  1Z03 A;  4NBE A;  1YJN Z;  4HGZ A;  1I6H I;  4E33 A;  5LL6 f;  3S17 I;  4E31 A;  4QTU A;  2I3C A;  1K83 I;  3CME 1;  1S72 Z;  3I55 Z;  3VMH A;  5CM2 M;  3CCQ 1;  1ML8 A;  2JUB A;  1VLA A;  3RZD I;  2OTJ Z;  2DE6 A;  1VQK Z;  3GTM I;  1I3Q I;  3H0G I;  1KQS Y;  2B63 I;  1USP B;  2PM9 A;  4A3G I;  3CMA Z;  4RS4 A;  4BBR I;  3CC2 1;  2QEX Z;  4A3C I;  5C3E I;  2QR1 B;  3CCU 1;  1YJW 1;  3BG0 B;  3HOW I;  1L1O C;  2BJO A;  1YUK A;  2R92 I;  2F4O A;  1WCM I;  3D9X A;  3J81 f;  2GTI A;  4MD8 A;  2ZAE B;  4NFR A;  1Q81 2;  2IZ4 A;  3NFZ A;  3NH4 A;  3GTM S;  3PO3 S;  1JWH C;  3GKQ A;  2JNY A;  2OOX B;  3MZK B;  2Y0S A;  2JA6 I;  2J6A A;  1VQP 1;  2YAD A;  2JR6 A;  3BG1 B;  4NBB A;  1VQ8 Z;  2R93 I;  1Q81 1;  1K8A 2;  5C4X I;  3M3Y I;  2K3R A;  1VQO Z;  3Q87 A;  1VQ7 1;  3D6W A;  3CCE 1;  1KD1 2;  2NVT I;  1KQS Z;  3IF8 A;  3S1N I;  3S2H I;  4XX2 A;  3FKI I;  1YIJ Z;  1I50 I;  3F3F C;  4NBD A;  1K8A 1;  3MZL B;  4RVG A;  4A3E I;  2OOY B;  2VUG A;  4A3B I;  1Q86 2;  4A3D I;  3CC7 1;  1WII A;  1KD1 1;  3G6E 1;  1VQ4 1;  4HH4 A;  1LQL A;  3I56 Z;  3VMI A;  4RVD A;  3J7A 4;  2V8J A;  3J80 f;  5FLM I;  2OZK A;  2JA7 I;  3GTQ I;  2QRE B;  2DE5 A;  1RO4 A;  3ESW A;  1Q86 1;  3IX0 A;  2WB1 A;  5T67 A;  2QRD B;  1YIT 1;  2QLV B;  1WW9 A;  2HF1 A;  3CME Z;  2OTL Z;  5C4J I;  5D1O B;  4DK1 A;  1ZH1 A;  3CCQ Z;  4A3F I;  1VQN 1;  4BXX I;  3CCV 1;  3JAM f;  5IP9 I;  3CCM 1;  3CCJ 1;  1NP6 A;  1K9M 2;  4BY7 I;  3NDJ A;  3TDH B;  2QKD A;  1YI2 Z;  2E2I I;  1QF8 A;  3CD6 1;  2H85 A;  3G71 1;  3CC2 Z;  4A3K I;  5A2Q f;  1K9M 1;  3S1R I;  3CCU Z;  1YJW Z;  1TWF I;  1QVG Y;  2YU9 I;  3RZO I;  3CC4 1;  2R7Z I;  1X0T A;  4MH4 A;  1M90 1;  3HOU I;  1X3Z A;  5C44 I;  2QA4 1;  3P5J B;  3F3P C;  4NOZ A;  1VQ5 1;  1RNI A;  5FLX f;  2VF1 A;  3EER A;  1Q7Y 2;  1ZB9 A;  2PK7 A;  1TWH I;  3S15 I;  1X3W A;  2HU9 A;  2E2J I;  1VQP Z;  2V8K A;  3CXC Y;  3J81 b;  1Z01 A;  2JA8 I;  1VQM 1;  1Q7Y 1;  2GTH A;  4NBF A;  1Y1V I;  1ZB8 A;  1PFT A;  1RLY A;  1Z02 A;  2KI7 B;  1VQ7 Z;  2W04 A;  5T64 A;  3CCE Z;  3HOV I;  3G4S Z;  1VQ9 1;  3NH8 A;  3I07 A;  1NJI 2;  4E2X A;  4E2Y A;  4E2W A;  3CCR 1;  3CCL Z;  3T4N B;  2LIY A;  4MD7 A;  3CC7 Z;  3S14 I;  1W2B Y;  3G6E Z;  1VQ4 Z;  2P28 A;  1KRL A;  3GTJ I;  1TFI A;  1NUI A;  2G2K A;  1RQF A;  3HOZ I;  1NJI 1;  1VQL 1;  4BBS I;  2Q4Z A;  3S1M I;  1USP A;  4RVF A;  2M6N A;  4A3L I;  2GU2 A;  3LUS A;  2P3Y A;  1YHQ 1;  1VQ8 1;  1YIT Z;  1N2F A;  3J80 b;  3VTN A;  4MRI A;  2PMZ A;  5D1P A;  1QYP A;  3S2D I;  3CXC Z;  3QWU A;  1VQN Z;  3S16 I;  3CCV Z;  2RT9 A;  4A93 I;  2VUM I;  3GCF A;  3CCM Z;  3CCJ Z;  3CPW Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...