3JAMb

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamb00
3J7A4 3JAMb 3J80b 3J81b 5LL6f 5FLXb 5A2Qb 5IT9b
chains in the Genus database with same CATH superfamily
3GTKI 3G71Z 3CCEZ 1QVGY 3I4NI 2VUGA 1YITZ 2F4OA 2V8IA 3VMIA 1Z02A 2JR6A 2P28A 5IP9I 2R92I 1VQ51 3CCJZ 3GTJI 2OTL1 2NVXI 4Y52I 2GTHA 3HOUI 2B63I 2ZAEB 3CCJ1 3EEDA 1DL6A 2OOXB 3M3YI 4MD7A 1KD11 3G4S1 2LEXA 4NH1C 2E2HI 3CCLZ 4HGZA 2WB1A 3F3PC 1VQ8Z 3GTGI 4DGLA 5D1PA 1K732 2V45A 3RZDI 1NUIA 2GU2A 3D9XA 1RO4A 2RHBA 1VQ4Z 2VUMI 1Q7Y1 3S1QI 3CPWZ 4RVHA 2PMZA 1ZB8A 4DK1A 2RT9A 4E33A 5FLXb 3CCV1 2YADA 2QKDA 1JJ2Y 1R9TI 1VQLZ 2PK7A 5D1OB 1FDIA 2DE7A 3K7AI 5AN9F 2M6NA 1SFOI 2GTIA 2OTLZ 1K8A2 3S15I 2H85A 4E2WA 1YI21 1Q16A 2OTJ1 4NBDA 2K3RA 5D1OA 3JAMb 2JIOA 3S17I 1W2BZ 2OTJZ 2W04A 2QLVB 3Q87A 3CCR1 2QEX1 1N8R1 3IFUA 1YHQ1 3GTLI 5A2Qb 2LIYA 4HGYA 1WZNA 3LUSA 1YJ9Z 4E2YA 5T64A 4NBFA 2R93I 3F3FC 1I6HI 1QYPA 1VQK1 1Z01A 3I55Z 2VPZA 3CME1 1KD12 3S2HI 3G6EZ 4MRIA 3IF8A 1Y1WI 5IP7I 2JMOA 1RO0A 2OOYB 3CC71 2JIQA 3CCS1 3NDJA 1RLYA 3CXCZ 3J7A4 5A2Qf 2DE5A 2O53A 3M4OI 3CCQZ 1VQP1 1X3WA 2QRCB 1YIJ1 1QVGZ 3IR7A 1M901 4MD8A 3S1MI 3RZOI 1VQMZ 1WW9A 1YHQZ 1YJNZ 3NH4A 3CCU1 3CCM1 3CD6Z 3PO3I 1Y1VS 4BY1I 2YU9I 3VTNA 3HOZI 4TNUA 2AYDA 3S1NI 2M48A 3NFZA 5T6BA 2JNYA 1WCMI 2BJOA 1NJI1 3CQZI 2R6MA 1ZB9A 3PO2I 1AA6A 3OW2Z 3VB9A 5FLXf 2RPRA 2JA5I 4RVGA 2WAQA 4EWCA 3CXCY 3S1RI 3G6E1 2QR1B 3CCL1 4A3II 4E32A 1TWHI 3GTPI 1I50I 2V8KA 2QA41 2E2JI 1RNIA 3TE5B 2Q51A 3H0GI 4E31A 2K5RA 1VQ7Z 1Q812 3U50C 1WJ2A 4A3EI 3CCE1 1Q7Y2 3GTQI 3HOVI 1YIT1 1Q811 2JIRA 3VMHA 2KPIA 1KRLA 4XX2A 2NAPA 1VQL1 3CCUZ 4QTUA 3TDHB 4A3MI 1USPA 1KQSY 2HU9A 1RQFA 3GKQA 1WIIA 4RS4A 1VQ61 4NOZA 1TWFI 4A3FI 1W2BY 1VQ5Z 3BG0B 1VQ6Z 1ML8A 1SIWA 1N2FA 5C4XI 2E7ZA 2LFUA 2JS4A 3I56Z 3JAMf 1NJI2 2VPXA 1VQO1 4AYBA 2QRDB 3P5JB 1KC81 4NBAA 1VQOZ 4Y7NI 1TWAI 1VQ9Z 2P3YA 1USPB 1TWCI 1JWHC 5FLMI 1K8A1 1VQ91 1X3ZA 3J80b 1QF8A 1NP6A 1VQ41 3GTMI 1KQSZ 3HOWI 4MD9A 3H3VJ 3GTMS 4A3GI 4A3CI 4MXUA 3VMGA 3CC4Z 2Q4ZA 2NVTI 4NBCA 3NDIA 1Q822 3GTOI 1RO2A 3CC41 1FDOA 3D6WA 3J81b 5CM2M 2JA8I 1Y8CA 2JUBA 3S2DI 1M1K1 4NB8A 1YI2Z 3NH5A 3PO3S 4NFRA 2AKLA 4A3LI 4NBGA 4BBSI 4BBRI 2QEXZ 1M1K2 1QVFY 3G4SZ 2IZ4A 1K731 1K9M1 4NBBA 4BXXI 1P9NA 4QTTA 1VQ81 5C4JI 1I3QI 1M902 1TWGI 5C44I 4A3BI 1YJ91 3CCRZ 2HF1A 3NH8A 1N8R2 1Q821 2VPWA 1YUKA 3CC2Z 4MH4A 3OW2Y 2RIQA 3I07A 3I551 4CL1A 2JIMA 3FKII 3EERA 1Q861 2VF1A 1TFIA 3I4MI 3IX0A 3CCVZ 2NVQI 1VQKZ 1YJW1 3QWUA 3CMEZ 3T4NB 1YJWZ 2F4MA 3KIFA 2QA4Z 3HOYI 3CC7Z 3HKZA 1VQPZ 2DE6A 2Y0SA 4NB9A 1QXFA 4X6AI 1L1OC 5IT9b 1VQ71 1VQM1 2IZ3A 5C3EI 2OZKA 2JA7I 2PM9A 2R7ZI 4NBHA 1YJN1 2VPYA 3KIHA 4RVFA 2QREB 1KC82 3CD61 2JIPA 4S1TA 2JA6I 4BY7I 1YUAA 3HOXI 2EGTA 2V8JA 3S14I 2O4HA 1S721 3CC21 3ESWA 1Z03A 3CCMZ 3FQMA 2V3VA 4RV9A 4E2XA 3J81f 4A93I 1S72Z 2E9HA 4A3JI 1QVFZ 3FQQA 5LL6f 4E2ZA 3BG1B 1ZH1A 1Y1VI 3D2LA 1VLAA 2J6AA 4RVDA 4NBEA 2RBLA 2I3CA 2W03A 3I561 1X0TA 3CPWY 1S7MA 4MONA 4E30A 3J80f 1PFTA 4DQYB 3S16I 3CCSZ 2E2II 4A3DI 1LQLA 2IV2X 1JJ2Z 5IT9f 3MZKB 3GCFA 5T67A 1VQN1 1K83I 3CCQ1 3CMA1 2G2KA 1YIJZ 3MONA 1VQNZ 4A3KI 3CMAZ 3G711 3MZLB 1K9M2 4HH4A 1Q862 2KI7B 2NVYI
chains in the Genus database with same CATH topology
3GTKI 3G71Z 3CCEZ 1QVGY 3I4NI 2VUGA 1YITZ 2F4OA 2V8IA 3VMIA 1Z02A 2JR6A 2P28A 5IP9I 2R92I 1VQ51 3CCJZ 3GTJI 2OTL1 2NVXI 4Y52I 2GTHA 3HOUI 2B63I 2ZAEB 3CCJ1 3EEDA 1DL6A 2OOXB 3M3YI 4MD7A 1KD11 3G4S1 4NH1C 2E2HI 3CCLZ 4HGZA 2WB1A 3F3PC 1VQ8Z 3GTGI 4DGLA 5D1PA 1K732 3RZDI 1NUIA 2GU2A 3D9XA 1RO4A 2RHBA 1VQ4Z 2VUMI 1Q7Y1 3S1QI 3CPWZ 4RVHA 2PMZA 1ZB8A 4DK1A 2RT9A 4E33A 5FLXb 3CCV1 2YADA 2QKDA 1JJ2Y 1R9TI 1VQLZ 2PK7A 5D1OB 2DE7A 3K7AI 5AN9F 2M6NA 1SFOI 2GTIA 2OTLZ 1K8A2 3S15I 2H85A 4E2WA 1YI21 2OTJ1 4NBDA 2K3RA 5D1OA 3JAMb 3S17I 1W2BZ 2OTJZ 2W04A 2QLVB 3Q87A 3CCR1 2QEX1 1N8R1 3IFUA 1YHQ1 3GTLI 5A2Qb 2LIYA 4HGYA 3LUSA 1YJ9Z 4E2YA 5T64A 4NBFA 2R93I 3F3FC 1I6HI 1QYPA 1VQK1 1Z01A 3I55Z 3CME1 1KD12 3S2HI 3G6EZ 4MRIA 3IF8A 1Y1WI 5IP7I 2JMOA 1RO0A 2OOYB 3CC71 3CCS1 3NDJA 1RLYA 3CXCZ 3J7A4 5A2Qf 2DE5A 2O53A 3M4OI 3CCQZ 1VQP1 1X3WA 2QRCB 1YIJ1 1QVGZ 1M901 4MD8A 3S1MI 3RZOI 1VQMZ 1WW9A 1YHQZ 1YJNZ 3NH4A 3CCU1 3CCM1 3CD6Z 3PO3I 1Y1VS 4BY1I 2YU9I 3VTNA 3HOZI 4TNUA 3S1NI 2M48A 3NFZA 5T6BA 2JNYA 1WCMI 2BJOA 1NJI1 3CQZI 2R6MA 1ZB9A 3PO2I 3OW2Z 3VB9A 5FLXf 2RPRA 2JA5I 4RVGA 2WAQA 4EWCA 3CXCY 3S1RI 3G6E1 2QR1B 3CCL1 4A3II 4E32A 1TWHI 3GTPI 1I50I 2V8KA 2QA41 2E2JI 1RNIA 3TE5B 2Q51A 3H0GI 4E31A 2K5RA 1VQ7Z 1Q812 3U50C 4A3EI 3CCE1 1Q7Y2 3GTQI 3HOVI 1YIT1 1Q811 3VMHA 2KPIA 1KRLA 4XX2A 1VQL1 3CCUZ 4QTUA 3TDHB 4A3MI 1USPA 1KQSY 2HU9A 1RQFA 3GKQA 1WIIA 4RS4A 1VQ61 4NOZA 1TWFI 4A3FI 1W2BY 1VQ5Z 3BG0B 1VQ6Z 1ML8A 1N2FA 5C4XI 2LFUA 2JS4A 3I56Z 3JAMf 1NJI2 1VQO1 4AYBA 2QRDB 3P5JB 1KC81 4NBAA 1VQOZ 4Y7NI 1TWAI 1VQ9Z 2P3YA 1USPB 1TWCI 1JWHC 5FLMI 1K8A1 1VQ91 1X3ZA 3J80b 1QF8A 1NP6A 1VQ41 3GTMI 1KQSZ 3HOWI 4MD9A 3H3VJ 3GTMS 4A3GI 4A3CI 4MXUA 3VMGA 3CC4Z 2Q4ZA 2NVTI 4NBCA 3NDIA 1Q822 3GTOI 1RO2A 3CC41 3D6WA 3J81b 5CM2M 2JA8I 2JUBA 3S2DI 1M1K1 4NB8A 1YI2Z 3NH5A 3PO3S 4NFRA 2AKLA 4A3LI 4NBGA 4BBSI 4BBRI 2QEXZ 1M1K2 1QVFY 3G4SZ 2IZ4A 1K731 1K9M1 4NBBA 4BXXI 1P9NA 4QTTA 1VQ81 5C4JI 1I3QI 1M902 1TWGI 5C44I 4A3BI 1YJ91 3CCRZ 2HF1A 3NH8A 1N8R2 1Q821 1YUKA 3CC2Z 4MH4A 3OW2Y 2RIQA 3I07A 3I551 4CL1A 3FKII 3EERA 1Q861 2VF1A 1TFIA 3I4MI 3IX0A 3CCVZ 2NVQI 1VQKZ 1YJW1 3QWUA 3CMEZ 3T4NB 1YJWZ 2F4MA 3KIFA 2QA4Z 3HOYI 3CC7Z 3HKZA 1VQPZ 2DE6A 2Y0SA 4NB9A 4X6AI 1L1OC 5IT9b 1VQ71 1VQM1 2IZ3A 5C3EI 2OZKA 2JA7I 2PM9A 2R7ZI 4NBHA 1YJN1 3KIHA 4RVFA 2QREB 1KC82 3CD61 4S1TA 2JA6I 4BY7I 1YUAA 3HOXI 2EGTA 2V8JA 3S14I 2O4HA 1S721 3CC21 3ESWA 1Z03A 3CCMZ 3FQMA 4RV9A 4E2XA 3J81f 4A93I 1S72Z 2E9HA 4A3JI 1QVFZ 3FQQA 5LL6f 4E2ZA 3BG1B 1ZH1A 1Y1VI 1VLAA 2J6AA 4RVDA 4NBEA 2RBLA 2I3CA 2W03A 3I561 1X0TA 3CPWY 1S7MA 4MONA 4E30A 3J80f 1PFTA 4DQYB 3S16I 3CCSZ 2E2II 4A3DI 1LQLA 1JJ2Z 5IT9f 3MZKB 3GCFA 5T67A 1VQN1 1K83I 3CCQ1 3CMA1 2G2KA 1YIJZ 3MONA 1VQNZ 4A3KI 3CMAZ 3G711 3MZLB 1K9M2 4HH4A 1Q862 2KI7B 2NVYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A 4;  3JAM b;  3J80 b;  3J81 b;  5LL6 f;  5FLX b;  5A2Q b;  5IT9 b; 
#chains in the Genus database with same CATH topology
 3GTK I;  3G71 Z;  3CCE Z;  1QVG Y;  3I4N I;  2VUG A;  1YIT Z;  2F4O A;  2V8I A;  3VMI A;  1Z02 A;  2JR6 A;  2P28 A;  5IP9 I;  2R92 I;  1VQ5 1;  3CCJ Z;  3GTJ I;  2OTL 1;  2NVX I;  4Y52 I;  2GTH A;  3HOU I;  2B63 I;  2ZAE B;  3CCJ 1;  3EED A;  1DL6 A;  2OOX B;  3M3Y I;  4MD7 A;  1KD1 1;  3G4S 1;  2LEX A;  4NH1 C;  2E2H I;  3CCL Z;  4HGZ A;  2WB1 A;  3F3P C;  1VQ8 Z;  3GTG I;  4DGL A;  5D1P A;  1K73 2;  2V45 A;  3RZD I;  1NUI A;  2GU2 A;  3D9X A;  1RO4 A;  2RHB A;  1VQ4 Z;  2VUM I;  1Q7Y 1;  3S1Q I;  3CPW Z;  4RVH A;  2PMZ A;  1ZB8 A;  4DK1 A;  2RT9 A;  4E33 A;  5FLX b;  3CCV 1;  2YAD A;  2QKD A;  1JJ2 Y;  1R9T I;  1VQL Z;  2PK7 A;  5D1O B;  1FDI A;  2DE7 A;  3K7A I;  5AN9 F;  2M6N A;  1SFO I;  2GTI A;  2OTL Z;  1K8A 2;  3S15 I;  2H85 A;  4E2W A;  1YI2 1;  1Q16 A;  2OTJ 1;  4NBD A;  2K3R A;  5D1O A;  3JAM b;  2JIO A;  3S17 I;  1W2B Z;  2OTJ Z;  2W04 A;  2QLV B;  3Q87 A;  3CCR 1;  2QEX 1;  1N8R 1;  3IFU A;  1YHQ 1;  3GTL I;  5A2Q b;  2LIY A;  4HGY A;  1WZN A;  3LUS A;  1YJ9 Z;  4E2Y A;  5T64 A;  4NBF A;  2R93 I;  3F3F C;  1I6H I;  1QYP A;  1VQK 1;  1Z01 A;  3I55 Z;  2VPZ A;  3CME 1;  1KD1 2;  3S2H I;  3G6E Z;  4MRI A;  3IF8 A;  1Y1W I;  5IP7 I;  2JMO A;  1RO0 A;  2OOY B;  3CC7 1;  2JIQ A;  3CCS 1;  3NDJ A;  1RLY A;  3CXC Z;  3J7A 4;  5A2Q f;  2DE5 A;  2O53 A;  3M4O I;  3CCQ Z;  1VQP 1;  1X3W A;  2QRC B;  1YIJ 1;  1QVG Z;  3IR7 A;  1M90 1;  4MD8 A;  3S1M I;  3RZO I;  1VQM Z;  1WW9 A;  1YHQ Z;  1YJN Z;  3NH4 A;  3CCU 1;  3CCM 1;  3CD6 Z;  3PO3 I;  1Y1V S;  4BY1 I;  2YU9 I;  3VTN A;  3HOZ I;  4TNU A;  2AYD A;  3S1N I;  2M48 A;  3NFZ A;  5T6B A;  2JNY A;  1WCM I;  2BJO A;  1NJI 1;  3CQZ I;  2R6M A;  1ZB9 A;  3PO2 I;  1AA6 A;  3OW2 Z;  3VB9 A;  5FLX f;  2RPR A;  2JA5 I;  4RVG A;  2WAQ A;  4EWC A;  3CXC Y;  3S1R I;  3G6E 1;  2QR1 B;  3CCL 1;  4A3I I;  4E32 A;  1TWH I;  3GTP I;  1I50 I;  2V8K A;  2QA4 1;  2E2J I;  1RNI A;  3TE5 B;  2Q51 A;  3H0G I;  4E31 A;  2K5R A;  1VQ7 Z;  1Q81 2;  3U50 C;  1WJ2 A;  4A3E I;  3CCE 1;  1Q7Y 2;  3GTQ I;  3HOV I;  1YIT 1;  1Q81 1;  2JIR A;  3VMH A;  2KPI A;  1KRL A;  4XX2 A;  2NAP A;  1VQL 1;  3CCU Z;  4QTU A;  3TDH B;  4A3M I;  1USP A;  1KQS Y;  2HU9 A;  1RQF A;  3GKQ A;  1WII A;  4RS4 A;  1VQ6 1;  4NOZ A;  1TWF I;  4A3F I;  1W2B Y;  1VQ5 Z;  3BG0 B;  1VQ6 Z;  1ML8 A;  1SIW A;  1N2F A;  5C4X I;  2E7Z A;  2LFU A;  2JS4 A;  3I56 Z;  3JAM f;  1NJI 2;  2VPX A;  1VQO 1;  4AYB A;  2QRD B;  3P5J B;  1KC8 1;  4NBA A;  1VQO Z;  4Y7N I;  1TWA I;  1VQ9 Z;  2P3Y A;  1USP B;  1TWC I;  1JWH C;  5FLM I;  1K8A 1;  1VQ9 1;  1X3Z A;  3J80 b;  1QF8 A;  1NP6 A;  1VQ4 1;  3GTM I;  1KQS Z;  3HOW I;  4MD9 A;  3H3V J;  3GTM S;  4A3G I;  4A3C I;  4MXU A;  3VMG A;  3CC4 Z;  2Q4Z A;  2NVT I;  4NBC A;  3NDI A;  1Q82 2;  3GTO I;  1RO2 A;  3CC4 1;  1FDO A;  3D6W A;  3J81 b;  5CM2 M;  2JA8 I;  1Y8C A;  2JUB A;  3S2D I;  1M1K 1;  4NB8 A;  1YI2 Z;  3NH5 A;  3PO3 S;  4NFR A;  2AKL A;  4A3L I;  4NBG A;  4BBS I;  4BBR I;  2QEX Z;  1M1K 2;  1QVF Y;  3G4S Z;  2IZ4 A;  1K73 1;  1K9M 1;  4NBB A;  4BXX I;  1P9N A;  4QTT A;  1VQ8 1;  5C4J I;  1I3Q I;  1M90 2;  1TWG I;  5C44 I;  4A3B I;  1YJ9 1;  3CCR Z;  2HF1 A;  3NH8 A;  1N8R 2;  1Q82 1;  2VPW A;  1YUK A;  3CC2 Z;  4MH4 A;  3OW2 Y;  2RIQ A;  3I07 A;  3I55 1;  4CL1 A;  2JIM A;  3FKI I;  3EER A;  1Q86 1;  2VF1 A;  1TFI A;  3I4M I;  3IX0 A;  3CCV Z;  2NVQ I;  1VQK Z;  1YJW 1;  3QWU A;  3CME Z;  3T4N B;  1YJW Z;  2F4M A;  3KIF A;  2QA4 Z;  3HOY I;  3CC7 Z;  3HKZ A;  1VQP Z;  2DE6 A;  2Y0S A;  4NB9 A;  1QXF A;  4X6A I;  1L1O C;  5IT9 b;  1VQ7 1;  1VQM 1;  2IZ3 A;  5C3E I;  2OZK A;  2JA7 I;  2PM9 A;  2R7Z I;  4NBH A;  1YJN 1;  2VPY A;  3KIH A;  4RVF A;  2QRE B;  1KC8 2;  3CD6 1;  2JIP A;  4S1T A;  2JA6 I;  4BY7 I;  1YUA A;  3HOX I;  2EGT A;  2V8J A;  3S14 I;  2O4H A;  1S72 1;  3CC2 1;  3ESW A;  1Z03 A;  3CCM Z;  3FQM A;  2V3V A;  4RV9 A;  4E2X A;  3J81 f;  4A93 I;  1S72 Z;  2E9H A;  4A3J I;  1QVF Z;  3FQQ A;  5LL6 f;  4E2Z A;  3BG1 B;  1ZH1 A;  1Y1V I;  3D2L A;  1VLA A;  2J6A A;  4RVD A;  4NBE A;  2RBL A;  2I3C A;  2W03 A;  3I56 1;  1X0T A;  3CPW Y;  1S7M A;  4MON A;  4E30 A;  3J80 f;  1PFT A;  4DQY B;  3S16 I;  3CCS Z;  2E2I I;  4A3D I;  1LQL A;  2IV2 X;  1JJ2 Z;  5IT9 f;  3MZK B;  3GCF A;  5T67 A;  1VQN 1;  1K83 I;  3CCQ 1;  3CMA 1;  2G2K A;  1YIJ Z;  3MON A;  1VQN Z;  4A3K I;  3CMA Z;  3G71 1;  3MZL B;  1K9M 2;  4HH4 A;  1Q86 2;  2KI7 B;  2NVY I; 
#chains in the Genus database with same CATH homology
 3GTK I;  3G71 Z;  3CCE Z;  1QVG Y;  3I4N I;  2VUG A;  1YIT Z;  2F4O A;  2V8I A;  3VMI A;  1Z02 A;  2JR6 A;  2P28 A;  5IP9 I;  2R92 I;  1VQ5 1;  3CCJ Z;  3GTJ I;  2OTL 1;  2NVX I;  4Y52 I;  2GTH A;  3HOU I;  2B63 I;  2ZAE B;  3CCJ 1;  3EED A;  1DL6 A;  2OOX B;  3M3Y I;  4MD7 A;  1KD1 1;  3G4S 1;  4NH1 C;  2E2H I;  3CCL Z;  4HGZ A;  2WB1 A;  3F3P C;  1VQ8 Z;  3GTG I;  4DGL A;  5D1P A;  1K73 2;  3RZD I;  1NUI A;  2GU2 A;  3D9X A;  1RO4 A;  2RHB A;  1VQ4 Z;  2VUM I;  1Q7Y 1;  3S1Q I;  3CPW Z;  4RVH A;  2PMZ A;  1ZB8 A;  4DK1 A;  2RT9 A;  4E33 A;  5FLX b;  3CCV 1;  2YAD A;  2QKD A;  1JJ2 Y;  1R9T I;  1VQL Z;  2PK7 A;  5D1O B;  2DE7 A;  3K7A I;  5AN9 F;  2M6N A;  1SFO I;  2GTI A;  2OTL Z;  1K8A 2;  3S15 I;  2H85 A;  4E2W A;  1YI2 1;  2OTJ 1;  4NBD A;  2K3R A;  5D1O A;  3JAM b;  3S17 I;  1W2B Z;  2OTJ Z;  2W04 A;  2QLV B;  3Q87 A;  3CCR 1;  2QEX 1;  1N8R 1;  3IFU A;  1YHQ 1;  3GTL I;  5A2Q b;  2LIY A;  4HGY A;  3LUS A;  1YJ9 Z;  4E2Y A;  5T64 A;  4NBF A;  2R93 I;  3F3F C;  1I6H I;  1QYP A;  1VQK 1;  1Z01 A;  3I55 Z;  3CME 1;  1KD1 2;  3S2H I;  3G6E Z;  4MRI A;  3IF8 A;  1Y1W I;  5IP7 I;  2JMO A;  1RO0 A;  2OOY B;  3CC7 1;  3CCS 1;  3NDJ A;  1RLY A;  3CXC Z;  3J7A 4;  5A2Q f;  2DE5 A;  2O53 A;  3M4O I;  3CCQ Z;  1VQP 1;  1X3W A;  2QRC B;  1YIJ 1;  1QVG Z;  1M90 1;  4MD8 A;  3S1M I;  3RZO I;  1VQM Z;  1WW9 A;  1YHQ Z;  1YJN Z;  3NH4 A;  3CCU 1;  3CCM 1;  3CD6 Z;  3PO3 I;  1Y1V S;  4BY1 I;  2YU9 I;  3VTN A;  3HOZ I;  4TNU A;  3S1N I;  2M48 A;  3NFZ A;  5T6B A;  2JNY A;  1WCM I;  2BJO A;  1NJI 1;  3CQZ I;  2R6M A;  1ZB9 A;  3PO2 I;  3OW2 Z;  3VB9 A;  5FLX f;  2RPR A;  2JA5 I;  4RVG A;  2WAQ A;  4EWC A;  3CXC Y;  3S1R I;  3G6E 1;  2QR1 B;  3CCL 1;  4A3I I;  4E32 A;  1TWH I;  3GTP I;  1I50 I;  2V8K A;  2QA4 1;  2E2J I;  1RNI A;  3TE5 B;  2Q51 A;  3H0G I;  4E31 A;  2K5R A;  1VQ7 Z;  1Q81 2;  3U50 C;  4A3E I;  3CCE 1;  1Q7Y 2;  3GTQ I;  3HOV I;  1YIT 1;  1Q81 1;  3VMH A;  2KPI A;  1KRL A;  4XX2 A;  1VQL 1;  3CCU Z;  4QTU A;  3TDH B;  4A3M I;  1USP A;  1KQS Y;  2HU9 A;  1RQF A;  3GKQ A;  1WII A;  4RS4 A;  1VQ6 1;  4NOZ A;  1TWF I;  4A3F I;  1W2B Y;  1VQ5 Z;  3BG0 B;  1VQ6 Z;  1ML8 A;  1N2F A;  5C4X I;  2LFU A;  2JS4 A;  3I56 Z;  3JAM f;  1NJI 2;  1VQO 1;  4AYB A;  2QRD B;  3P5J B;  1KC8 1;  4NBA A;  1VQO Z;  4Y7N I;  1TWA I;  1VQ9 Z;  2P3Y A;  1USP B;  1TWC I;  1JWH C;  5FLM I;  1K8A 1;  1VQ9 1;  1X3Z A;  3J80 b;  1QF8 A;  1NP6 A;  1VQ4 1;  3GTM I;  1KQS Z;  3HOW I;  4MD9 A;  3H3V J;  3GTM S;  4A3G I;  4A3C I;  4MXU A;  3VMG A;  3CC4 Z;  2Q4Z A;  2NVT I;  4NBC A;  3NDI A;  1Q82 2;  3GTO I;  1RO2 A;  3CC4 1;  3D6W A;  3J81 b;  5CM2 M;  2JA8 I;  2JUB A;  3S2D I;  1M1K 1;  4NB8 A;  1YI2 Z;  3NH5 A;  3PO3 S;  4NFR A;  2AKL A;  4A3L I;  4NBG A;  4BBS I;  4BBR I;  2QEX Z;  1M1K 2;  1QVF Y;  3G4S Z;  2IZ4 A;  1K73 1;  1K9M 1;  4NBB A;  4BXX I;  1P9N A;  4QTT A;  1VQ8 1;  5C4J I;  1I3Q I;  1M90 2;  1TWG I;  5C44 I;  4A3B I;  1YJ9 1;  3CCR Z;  2HF1 A;  3NH8 A;  1N8R 2;  1Q82 1;  1YUK A;  3CC2 Z;  4MH4 A;  3OW2 Y;  2RIQ A;  3I07 A;  3I55 1;  4CL1 A;  3FKI I;  3EER A;  1Q86 1;  2VF1 A;  1TFI A;  3I4M I;  3IX0 A;  3CCV Z;  2NVQ I;  1VQK Z;  1YJW 1;  3QWU A;  3CME Z;  3T4N B;  1YJW Z;  2F4M A;  3KIF A;  2QA4 Z;  3HOY I;  3CC7 Z;  3HKZ A;  1VQP Z;  2DE6 A;  2Y0S A;  4NB9 A;  4X6A I;  1L1O C;  5IT9 b;  1VQ7 1;  1VQM 1;  2IZ3 A;  5C3E I;  2OZK A;  2JA7 I;  2PM9 A;  2R7Z I;  4NBH A;  1YJN 1;  3KIH A;  4RVF A;  2QRE B;  1KC8 2;  3CD6 1;  4S1T A;  2JA6 I;  4BY7 I;  1YUA A;  3HOX I;  2EGT A;  2V8J A;  3S14 I;  2O4H A;  1S72 1;  3CC2 1;  3ESW A;  1Z03 A;  3CCM Z;  3FQM A;  4RV9 A;  4E2X A;  3J81 f;  4A93 I;  1S72 Z;  2E9H A;  4A3J I;  1QVF Z;  3FQQ A;  5LL6 f;  4E2Z A;  3BG1 B;  1ZH1 A;  1Y1V I;  1VLA A;  2J6A A;  4RVD A;  4NBE A;  2RBL A;  2I3C A;  2W03 A;  3I56 1;  1X0T A;  3CPW Y;  1S7M A;  4MON A;  4E30 A;  3J80 f;  1PFT A;  4DQY B;  3S16 I;  3CCS Z;  2E2I I;  4A3D I;  1LQL A;  1JJ2 Z;  5IT9 f;  3MZK B;  3GCF A;  5T67 A;  1VQN 1;  1K83 I;  3CCQ 1;  3CMA 1;  2G2K A;  1YIJ Z;  3MON A;  1VQN Z;  4A3K I;  3CMA Z;  3G71 1;  3MZL B;  1K9M 2;  4HH4 A;  1Q86 2;  2KI7 B;  2NVY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...