3JAMb

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamb00
5LL6f 5IT9b 3J80b 5A2Qb 3JAMb 3J81b 5FLXb 3J7A4
chains in the Genus database with same CATH superfamily
3CCMZ 3Q87A 2I3CA 1VQM1 2E2JI 3PO3S 2OTJ1 1WW9A 3NH4A 4A3MI 4A3FI 1RNIA 3TDHB 2W03A 1YHQZ 3NH5A 3GTMS 1VQ6Z 4A3BI 1VQOZ 3CCQ1 3CCLZ 1RLYA 2VUMI 1KRLA 1TFIA 4DQYB 2RT9A 4NBDA 3IF8A 2VPXA 3GTLI 2G2KA 3CD61 2V8JA 5AN9F 1VQ91 2F4MA 3KIFA 3VMHA 3PO3I 5A2Qb 3CME1 1VQNZ 1Q862 2HU9A 1M1K2 4Y52I 4RVDA 1S7MA 1ZH1A 2R93I 3GTMI 4BBRI 1YJN1 3S15I 1Q7Y2 3M3YI 4A93I 3CCJ1 3CQZI 1ZB8A 2OTJZ 2DE6A 1TWFI 3LUSA 2JA5I 1NP6A 3TE5B 3HOYI 1Z01A 2JS4A 2VPYA 3K7AI 1PFTA 4X6AI 2K5RA 4E2ZA 3S2HI 1VQK1 2M48A 1WIIA 2E7ZA 1RQFA 2V45A 3S14I 4AYBA 1VQ71 3CPWZ 3CD6Z 3CCRZ 2O53A 3JAMb 3CCUZ 2P28A 2QKDA 3GTOI 1Q861 2W04A 1X0TA 1L1OC 4NH1C 1VQ51 2QEX1 4NBFA 1WZNA 1USPA 2OOYB 3J7A4 2K3RA 1YJNZ 3EEDA 1VQ81 5IP9I 3IX0A 3U50C 1Y1VI 4E31A 4NOZA 2JNYA 3CCJZ 2OTL1 3CMAZ 2PK7A 4E2XA 4A3JI 4A3DI 4NBHA 4MD7A 1QXFA 3HOVI 1YITZ 2QRDB 2HF1A 4TNUA 1W2BZ 3I4MI 2E9HA 2AYDA 4NBGA 1ZB9A 1JJ2Y 2RHBA 3M4OI 4BY7I 1K8A2 1ML8A 5IT9f 3J80b 2RIQA 4A3EI 1W2BY 1Y1WI 1VQL1 1K83I 1VQ7Z 3RZOI 1YUAA 2RBLA 3F3FC 4QTTA 1YJWZ 4RVFA 5C4JI 1R9TI 1YUKA 3CXCZ 3PO2I 2GTHA 2V3VA 3G6EZ 1VQ8Z 1X3ZA 3CXCY 4BY1I 1Q822 2WAQA 4DK1A 2OTLZ 3G711 3GTGI 3CC21 3CCV1 3D9XA 2QRCB 2WB1A 3HOXI 3NFZA 5D1OA 4Y7NI 2JIOA 2QR1B 2PMZA 2QA4Z 3S1RI 1VQP1 1TWHI 1RO4A 1X3WA 1AA6A 2QREB 1K8A1 1YI2Z 3J81f 1VQ4Z 3HOZI 3P5JB 5LL6f 3H0GI 4RV9A 1VLAA 3VMIA 3I551 1VQMZ 3OW2Y 2NVXI 2P3YA 1N8R2 1N2FA 4MD9A 4MH4A 3VMGA 2VF1A 5T6BA 2BJOA 2NVYI 2Q4ZA 3CCQZ 2JIQA 1Y1VS 4E2YA 4NBBA 2RPRA 1Z02A 3NH8A 1Q821 1Y8CA 2KI7B 3BG0B 3I07A 3G71Z 1S721 3CCVZ 4QTUA 3S16I 3GTQI 1QVFZ 1VQ9Z 4MRIA 4E33A 3CMEZ 3CC41 2R6MA 3MZKB 1VQPZ 4XX2A 1Q16A 1KC81 1QVFY 1WCMI 3RZDI 2V8IA 2NVQI 3F3PC 2JIPA 3IR7A 3S1NI 4A3CI 4NFRA 3GCFA 1QVGZ 3I55Z 1N8R1 1TWAI 1SIWA 1K731 1RO0A 1KQSZ 1I50I 1QF8A 2VPWA 1JJ2Z 1P9NA 2O4HA 5T64A 1YHQ1 3H3VJ 1VQ61 3KIHA 1QVGY 4EWCA 3CCL1 1KQSY 4MD8A 2E2HI 1Z03A 1SFOI 2JMOA 2IV2X 2GU2A 2M6NA 2Y0SA 3CCE1 1VQKZ 2JA8I 1I3QI 3FQMA 3GTKI 5FLXf 2QLVB 1I6HI 2KPIA 2LFUA 2NAPA 2EGTA 2IZ3A 4A3GI 3GTPI 3QWUA 2JA6I 5FLMI 1USPB 1VQ5Z 2QEXZ 3CCS1 3CC71 1NUIA 2YADA 3BG1B 3IFUA 2NVTI 4E30A 1NJI1 3S1MI 4RVHA 4MXUA 1YIJ1 4NB9A 3S2DI 3I4NI 2IZ4A 1YJ91 5T67A 1LQLA 3OW2Z 2JA7I 2E2II 3NDJA 2VPZA 3CCEZ 3G4S1 1KC82 2OOXB 1M901 5D1PA 5A2Qf 3D2LA 4NBEA 1VQLZ 3CCR1 1Q811 3CCU1 3J81b 1K732 3I561 4A3II 4HGZA 4A3LI 4NB8A 4BXXI 5IP7I 2DE7A 1K9M1 3ESWA 3CCSZ 1KD12 3GKQA 4HGYA 2AKLA 3CC7Z 4RS4A 3D6WA 4S1TA 3CMA1 5D1OB 3CC2Z 2LIYA 3MZLB 3HOWI 3NDIA 2H85A 1YIT1 3FKII 1YIJZ 4NBCA 1JWHC 3S17I 5C44I 1YJ9Z 4HH4A 3VB9A 3JAMf 1RO2A 3MONA 2JR6A 3G4SZ 2JUBA 4CL1A 4BBSI 2OZKA 2VUGA 2PM9A 3CCM1 1TWCI 3T4NB 2V8KA 2JIRA 1DL6A 4E2WA 3I56Z 1YJW1 2R7ZI 1NJI2 3FQQA 2LEXA 5C4XI 1M1K1 3GTJI 3CPWY 1VQO1 2R92I 2DE5A 1WJ2A 1KD11 1Q7Y1 2YU9I 1FDOA 4NBAA 3G6E1 2ZAEB 2Q51A 4RVGA 3HKZA 1M902 4A3KI 3HOUI 2GTIA 1QYPA 1S72Z 1Q812 4MONA 2B63I 2QA41 2F4OA 5IT9b 3EERA 3J80f 1VQN1 5FLXb 3CC4Z 2J6AA 1FDIA 1YI21 4E32A 1VQ41 3S1QI 2JIMA 1TWGI 5C3EI 3VTNA 4DGLA 5CM2M 1K9M2
chains in the Genus database with same CATH topology
3CCMZ 3Q87A 2I3CA 1VQM1 2E2JI 3PO3S 2OTJ1 1WW9A 3NH4A 4A3MI 4A3FI 1RNIA 3TDHB 2W03A 1YHQZ 3NH5A 3GTMS 1VQ6Z 4A3BI 1VQOZ 3CCQ1 3CCLZ 1RLYA 2VUMI 1KRLA 1TFIA 4DQYB 2RT9A 4NBDA 3IF8A 3GTLI 2G2KA 3CD61 2V8JA 5AN9F 1VQ91 2F4MA 3KIFA 3VMHA 3PO3I 5A2Qb 3CME1 1VQNZ 1Q862 2HU9A 1M1K2 4Y52I 4RVDA 1S7MA 1ZH1A 2R93I 3GTMI 4BBRI 1YJN1 3S15I 1Q7Y2 3M3YI 4A93I 3CCJ1 3CQZI 1ZB8A 2OTJZ 2DE6A 1TWFI 3LUSA 2JA5I 1NP6A 3TE5B 3HOYI 1Z01A 2JS4A 3K7AI 1PFTA 4X6AI 2K5RA 4E2ZA 3S2HI 1VQK1 2M48A 1WIIA 1RQFA 3S14I 4AYBA 1VQ71 3CPWZ 3CD6Z 3CCRZ 2O53A 3JAMb 3CCUZ 2P28A 2QKDA 3GTOI 1Q861 2W04A 1X0TA 1L1OC 4NH1C 1VQ51 2QEX1 4NBFA 1USPA 2OOYB 3J7A4 2K3RA 1YJNZ 3EEDA 1VQ81 5IP9I 3IX0A 3U50C 1Y1VI 4E31A 4NOZA 2JNYA 3CCJZ 2OTL1 3CMAZ 2PK7A 4E2XA 4A3JI 4A3DI 4NBHA 4MD7A 3HOVI 1YITZ 2QRDB 2HF1A 4TNUA 1W2BZ 3I4MI 2E9HA 4NBGA 1ZB9A 1JJ2Y 2RHBA 3M4OI 4BY7I 1K8A2 1ML8A 5IT9f 3J80b 2RIQA 4A3EI 1W2BY 1Y1WI 1VQL1 1K83I 1VQ7Z 3RZOI 1YUAA 2RBLA 3F3FC 4QTTA 1YJWZ 4RVFA 5C4JI 1R9TI 1YUKA 3CXCZ 3PO2I 2GTHA 3G6EZ 1VQ8Z 1X3ZA 3CXCY 4BY1I 1Q822 2WAQA 4DK1A 2OTLZ 3G711 3GTGI 3CC21 3CCV1 3D9XA 2QRCB 2WB1A 3HOXI 3NFZA 5D1OA 4Y7NI 2QR1B 2PMZA 2QA4Z 3S1RI 1VQP1 1TWHI 1RO4A 1X3WA 1K8A1 2QREB 1YI2Z 3J81f 1VQ4Z 3HOZI 3P5JB 5LL6f 3H0GI 4RV9A 1VLAA 3VMIA 3I551 1VQMZ 3OW2Y 2NVXI 2P3YA 1N8R2 1N2FA 4MD9A 4MH4A 3VMGA 2VF1A 5T6BA 2BJOA 2NVYI 2Q4ZA 3CCQZ 1Y1VS 4E2YA 4NBBA 2RPRA 1Z02A 3NH8A 1Q821 2KI7B 3BG0B 3I07A 3G71Z 1S721 3CCVZ 4QTUA 3S16I 3GTQI 1QVFZ 1VQ9Z 4MRIA 4E33A 3CMEZ 3CC41 2R6MA 3MZKB 1VQPZ 4XX2A 1KC81 1QVFY 1WCMI 3RZDI 2V8IA 2NVQI 3F3PC 3S1NI 4A3CI 4NFRA 3GCFA 1QVGZ 3I55Z 1N8R1 1TWAI 1K731 1KQSZ 1RO0A 1I50I 1QF8A 1JJ2Z 1P9NA 2O4HA 5T64A 1YHQ1 3H3VJ 1VQ61 3KIHA 1QVGY 4EWCA 3CCL1 1KQSY 4MD8A 2E2HI 1Z03A 1SFOI 2JMOA 2GU2A 2M6NA 2Y0SA 3CCE1 1VQKZ 2JA8I 1I3QI 3FQMA 3GTKI 5FLXf 2QLVB 1I6HI 2KPIA 2LFUA 2EGTA 2IZ3A 4A3GI 3GTPI 3QWUA 2JA6I 5FLMI 1USPB 1VQ5Z 2QEXZ 3CCS1 3CC71 1NUIA 2YADA 3BG1B 3IFUA 2NVTI 4E30A 1NJI1 3S1MI 4RVHA 4MXUA 1YIJ1 4NB9A 3S2DI 3I4NI 2IZ4A 1YJ91 5T67A 1LQLA 3OW2Z 2JA7I 2E2II 3NDJA 3CCEZ 3G4S1 1KC82 2OOXB 1M901 5D1PA 5A2Qf 4NBEA 1VQLZ 3CCR1 1Q811 3CCU1 3J81b 1K732 3I561 4A3II 4HGZA 4A3LI 4NB8A 4BXXI 5IP7I 2DE7A 1K9M1 3ESWA 3CCSZ 1KD12 3GKQA 4HGYA 2AKLA 3CC7Z 4RS4A 3D6WA 4S1TA 3CMA1 5D1OB 3CC2Z 2LIYA 3MZLB 3HOWI 3NDIA 2H85A 1YIT1 3FKII 1YIJZ 4NBCA 1JWHC 3S17I 5C44I 1YJ9Z 4HH4A 3VB9A 3JAMf 1RO2A 3MONA 2JR6A 3G4SZ 2JUBA 4CL1A 4BBSI 2OZKA 2VUGA 2PM9A 3CCM1 1TWCI 3T4NB 2V8KA 1DL6A 4E2WA 3I56Z 1YJW1 2R7ZI 1NJI2 3FQQA 5C4XI 1M1K1 3GTJI 3CPWY 1VQO1 2R92I 2DE5A 1KD11 1Q7Y1 2YU9I 4NBAA 3G6E1 2ZAEB 2Q51A 4RVGA 3HKZA 1M902 4A3KI 3HOUI 2GTIA 1QYPA 1S72Z 1Q812 4MONA 2B63I 2QA41 2F4OA 5IT9b 3EERA 3J80f 1VQN1 5FLXb 3CC4Z 2J6AA 1YI21 4E32A 1VQ41 3S1QI 1TWGI 5C3EI 3VTNA 4DGLA 5CM2M 1K9M2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 f;  5IT9 b;  3J80 b;  5A2Q b;  3JAM b;  3J81 b;  5FLX b;  3J7A 4; 
#chains in the Genus database with same CATH topology
 3CCM Z;  3Q87 A;  2I3C A;  1VQM 1;  2E2J I;  3PO3 S;  2OTJ 1;  1WW9 A;  3NH4 A;  4A3M I;  4A3F I;  1RNI A;  3TDH B;  2W03 A;  1YHQ Z;  3NH5 A;  3GTM S;  1VQ6 Z;  4A3B I;  1VQO Z;  3CCQ 1;  3CCL Z;  1RLY A;  2VUM I;  1KRL A;  1TFI A;  4DQY B;  2RT9 A;  4NBD A;  3IF8 A;  2VPX A;  3GTL I;  2G2K A;  3CD6 1;  2V8J A;  5AN9 F;  1VQ9 1;  2F4M A;  3KIF A;  3VMH A;  3PO3 I;  5A2Q b;  3CME 1;  1VQN Z;  1Q86 2;  2HU9 A;  1M1K 2;  4Y52 I;  4RVD A;  1S7M A;  1ZH1 A;  2R93 I;  3GTM I;  4BBR I;  1YJN 1;  3S15 I;  1Q7Y 2;  3M3Y I;  4A93 I;  3CCJ 1;  3CQZ I;  1ZB8 A;  2OTJ Z;  2DE6 A;  1TWF I;  3LUS A;  2JA5 I;  1NP6 A;  3TE5 B;  3HOY I;  1Z01 A;  2JS4 A;  2VPY A;  3K7A I;  1PFT A;  4X6A I;  2K5R A;  4E2Z A;  3S2H I;  1VQK 1;  2M48 A;  1WII A;  2E7Z A;  1RQF A;  2V45 A;  3S14 I;  4AYB A;  1VQ7 1;  3CPW Z;  3CD6 Z;  3CCR Z;  2O53 A;  3JAM b;  3CCU Z;  2P28 A;  2QKD A;  3GTO I;  1Q86 1;  2W04 A;  1X0T A;  1L1O C;  4NH1 C;  1VQ5 1;  2QEX 1;  4NBF A;  1WZN A;  1USP A;  2OOY B;  3J7A 4;  2K3R A;  1YJN Z;  3EED A;  1VQ8 1;  5IP9 I;  3IX0 A;  3U50 C;  1Y1V I;  4E31 A;  4NOZ A;  2JNY A;  3CCJ Z;  2OTL 1;  3CMA Z;  2PK7 A;  4E2X A;  4A3J I;  4A3D I;  4NBH A;  4MD7 A;  1QXF A;  3HOV I;  1YIT Z;  2QRD B;  2HF1 A;  4TNU A;  1W2B Z;  3I4M I;  2E9H A;  2AYD A;  4NBG A;  1ZB9 A;  1JJ2 Y;  2RHB A;  3M4O I;  4BY7 I;  1K8A 2;  1ML8 A;  5IT9 f;  3J80 b;  2RIQ A;  4A3E I;  1W2B Y;  1Y1W I;  1VQL 1;  1K83 I;  1VQ7 Z;  3RZO I;  1YUA A;  2RBL A;  3F3F C;  4QTT A;  1YJW Z;  4RVF A;  5C4J I;  1R9T I;  1YUK A;  3CXC Z;  3PO2 I;  2GTH A;  2V3V A;  3G6E Z;  1VQ8 Z;  1X3Z A;  3CXC Y;  4BY1 I;  1Q82 2;  2WAQ A;  4DK1 A;  2OTL Z;  3G71 1;  3GTG I;  3CC2 1;  3CCV 1;  3D9X A;  2QRC B;  2WB1 A;  3HOX I;  3NFZ A;  5D1O A;  4Y7N I;  2JIO A;  2QR1 B;  2PMZ A;  2QA4 Z;  3S1R I;  1VQP 1;  1TWH I;  1RO4 A;  1X3W A;  1AA6 A;  2QRE B;  1K8A 1;  1YI2 Z;  3J81 f;  1VQ4 Z;  3HOZ I;  3P5J B;  5LL6 f;  3H0G I;  4RV9 A;  1VLA A;  3VMI A;  3I55 1;  1VQM Z;  3OW2 Y;  2NVX I;  2P3Y A;  1N8R 2;  1N2F A;  4MD9 A;  4MH4 A;  3VMG A;  2VF1 A;  5T6B A;  2BJO A;  2NVY I;  2Q4Z A;  3CCQ Z;  2JIQ A;  1Y1V S;  4E2Y A;  4NBB A;  2RPR A;  1Z02 A;  3NH8 A;  1Q82 1;  1Y8C A;  2KI7 B;  3BG0 B;  3I07 A;  3G71 Z;  1S72 1;  3CCV Z;  4QTU A;  3S16 I;  3GTQ I;  1QVF Z;  1VQ9 Z;  4MRI A;  4E33 A;  3CME Z;  3CC4 1;  2R6M A;  3MZK B;  1VQP Z;  4XX2 A;  1Q16 A;  1KC8 1;  1QVF Y;  1WCM I;  3RZD I;  2V8I A;  2NVQ I;  3F3P C;  2JIP A;  3IR7 A;  3S1N I;  4A3C I;  4NFR A;  3GCF A;  1QVG Z;  3I55 Z;  1N8R 1;  1TWA I;  1SIW A;  1K73 1;  1RO0 A;  1KQS Z;  1I50 I;  1QF8 A;  2VPW A;  1JJ2 Z;  1P9N A;  2O4H A;  5T64 A;  1YHQ 1;  3H3V J;  1VQ6 1;  3KIH A;  1QVG Y;  4EWC A;  3CCL 1;  1KQS Y;  4MD8 A;  2E2H I;  1Z03 A;  1SFO I;  2JMO A;  2IV2 X;  2GU2 A;  2M6N A;  2Y0S A;  3CCE 1;  1VQK Z;  2JA8 I;  1I3Q I;  3FQM A;  3GTK I;  5FLX f;  2QLV B;  1I6H I;  2KPI A;  2LFU A;  2NAP A;  2EGT A;  2IZ3 A;  4A3G I;  3GTP I;  3QWU A;  2JA6 I;  5FLM I;  1USP B;  1VQ5 Z;  2QEX Z;  3CCS 1;  3CC7 1;  1NUI A;  2YAD A;  3BG1 B;  3IFU A;  2NVT I;  4E30 A;  1NJI 1;  3S1M I;  4RVH A;  4MXU A;  1YIJ 1;  4NB9 A;  3S2D I;  3I4N I;  2IZ4 A;  1YJ9 1;  5T67 A;  1LQL A;  3OW2 Z;  2JA7 I;  2E2I I;  3NDJ A;  2VPZ A;  3CCE Z;  3G4S 1;  1KC8 2;  2OOX B;  1M90 1;  5D1P A;  5A2Q f;  3D2L A;  4NBE A;  1VQL Z;  3CCR 1;  1Q81 1;  3CCU 1;  3J81 b;  1K73 2;  3I56 1;  4A3I I;  4HGZ A;  4A3L I;  4NB8 A;  4BXX I;  5IP7 I;  2DE7 A;  1K9M 1;  3ESW A;  3CCS Z;  1KD1 2;  3GKQ A;  4HGY A;  2AKL A;  3CC7 Z;  4RS4 A;  3D6W A;  4S1T A;  3CMA 1;  5D1O B;  3CC2 Z;  2LIY A;  3MZL B;  3HOW I;  3NDI A;  2H85 A;  1YIT 1;  3FKI I;  1YIJ Z;  4NBC A;  1JWH C;  3S17 I;  5C44 I;  1YJ9 Z;  4HH4 A;  3VB9 A;  3JAM f;  1RO2 A;  3MON A;  2JR6 A;  3G4S Z;  2JUB A;  4CL1 A;  4BBS I;  2OZK A;  2VUG A;  2PM9 A;  3CCM 1;  1TWC I;  3T4N B;  2V8K A;  2JIR A;  1DL6 A;  4E2W A;  3I56 Z;  1YJW 1;  2R7Z I;  1NJI 2;  3FQQ A;  2LEX A;  5C4X I;  1M1K 1;  3GTJ I;  3CPW Y;  1VQO 1;  2R92 I;  2DE5 A;  1WJ2 A;  1KD1 1;  1Q7Y 1;  2YU9 I;  1FDO A;  4NBA A;  3G6E 1;  2ZAE B;  2Q51 A;  4RVG A;  3HKZ A;  1M90 2;  4A3K I;  3HOU I;  2GTI A;  1QYP A;  1S72 Z;  1Q81 2;  4MON A;  2B63 I;  2QA4 1;  2F4O A;  5IT9 b;  3EER A;  3J80 f;  1VQN 1;  5FLX b;  3CC4 Z;  2J6A A;  1FDI A;  1YI2 1;  4E32 A;  1VQ4 1;  3S1Q I;  2JIM A;  1TWG I;  5C3E I;  3VTN A;  4DGL A;  5CM2 M;  1K9M 2; 
#chains in the Genus database with same CATH homology
 3CCM Z;  3Q87 A;  2I3C A;  1VQM 1;  2E2J I;  3PO3 S;  2OTJ 1;  1WW9 A;  3NH4 A;  4A3M I;  4A3F I;  1RNI A;  3TDH B;  2W03 A;  1YHQ Z;  3NH5 A;  3GTM S;  1VQ6 Z;  4A3B I;  1VQO Z;  3CCQ 1;  3CCL Z;  1RLY A;  2VUM I;  1KRL A;  1TFI A;  4DQY B;  2RT9 A;  4NBD A;  3IF8 A;  3GTL I;  2G2K A;  3CD6 1;  2V8J A;  5AN9 F;  1VQ9 1;  2F4M A;  3KIF A;  3VMH A;  3PO3 I;  5A2Q b;  3CME 1;  1VQN Z;  1Q86 2;  2HU9 A;  1M1K 2;  4Y52 I;  4RVD A;  1S7M A;  1ZH1 A;  2R93 I;  3GTM I;  4BBR I;  1YJN 1;  3S15 I;  1Q7Y 2;  3M3Y I;  4A93 I;  3CCJ 1;  3CQZ I;  1ZB8 A;  2OTJ Z;  2DE6 A;  1TWF I;  3LUS A;  2JA5 I;  1NP6 A;  3TE5 B;  3HOY I;  1Z01 A;  2JS4 A;  3K7A I;  1PFT A;  4X6A I;  2K5R A;  4E2Z A;  3S2H I;  1VQK 1;  2M48 A;  1WII A;  1RQF A;  3S14 I;  4AYB A;  1VQ7 1;  3CPW Z;  3CD6 Z;  3CCR Z;  2O53 A;  3JAM b;  3CCU Z;  2P28 A;  2QKD A;  3GTO I;  1Q86 1;  2W04 A;  1X0T A;  1L1O C;  4NH1 C;  1VQ5 1;  2QEX 1;  4NBF A;  1USP A;  2OOY B;  3J7A 4;  2K3R A;  1YJN Z;  3EED A;  1VQ8 1;  5IP9 I;  3IX0 A;  3U50 C;  1Y1V I;  4E31 A;  4NOZ A;  2JNY A;  3CCJ Z;  2OTL 1;  3CMA Z;  2PK7 A;  4E2X A;  4A3J I;  4A3D I;  4NBH A;  4MD7 A;  3HOV I;  1YIT Z;  2QRD B;  2HF1 A;  4TNU A;  1W2B Z;  3I4M I;  2E9H A;  4NBG A;  1ZB9 A;  1JJ2 Y;  2RHB A;  3M4O I;  4BY7 I;  1K8A 2;  1ML8 A;  5IT9 f;  3J80 b;  2RIQ A;  4A3E I;  1W2B Y;  1Y1W I;  1VQL 1;  1K83 I;  1VQ7 Z;  3RZO I;  1YUA A;  2RBL A;  3F3F C;  4QTT A;  1YJW Z;  4RVF A;  5C4J I;  1R9T I;  1YUK A;  3CXC Z;  3PO2 I;  2GTH A;  3G6E Z;  1VQ8 Z;  1X3Z A;  3CXC Y;  4BY1 I;  1Q82 2;  2WAQ A;  4DK1 A;  2OTL Z;  3G71 1;  3GTG I;  3CC2 1;  3CCV 1;  3D9X A;  2QRC B;  2WB1 A;  3HOX I;  3NFZ A;  5D1O A;  4Y7N I;  2QR1 B;  2PMZ A;  2QA4 Z;  3S1R I;  1VQP 1;  1TWH I;  1RO4 A;  1X3W A;  1K8A 1;  2QRE B;  1YI2 Z;  3J81 f;  1VQ4 Z;  3HOZ I;  3P5J B;  5LL6 f;  3H0G I;  4RV9 A;  1VLA A;  3VMI A;  3I55 1;  1VQM Z;  3OW2 Y;  2NVX I;  2P3Y A;  1N8R 2;  1N2F A;  4MD9 A;  4MH4 A;  3VMG A;  2VF1 A;  5T6B A;  2BJO A;  2NVY I;  2Q4Z A;  3CCQ Z;  1Y1V S;  4E2Y A;  4NBB A;  2RPR A;  1Z02 A;  3NH8 A;  1Q82 1;  2KI7 B;  3BG0 B;  3I07 A;  3G71 Z;  1S72 1;  3CCV Z;  4QTU A;  3S16 I;  3GTQ I;  1QVF Z;  1VQ9 Z;  4MRI A;  4E33 A;  3CME Z;  3CC4 1;  2R6M A;  3MZK B;  1VQP Z;  4XX2 A;  1KC8 1;  1QVF Y;  1WCM I;  3RZD I;  2V8I A;  2NVQ I;  3F3P C;  3S1N I;  4A3C I;  4NFR A;  3GCF A;  1QVG Z;  3I55 Z;  1N8R 1;  1TWA I;  1K73 1;  1KQS Z;  1RO0 A;  1I50 I;  1QF8 A;  1JJ2 Z;  1P9N A;  2O4H A;  5T64 A;  1YHQ 1;  3H3V J;  1VQ6 1;  3KIH A;  1QVG Y;  4EWC A;  3CCL 1;  1KQS Y;  4MD8 A;  2E2H I;  1Z03 A;  1SFO I;  2JMO A;  2GU2 A;  2M6N A;  2Y0S A;  3CCE 1;  1VQK Z;  2JA8 I;  1I3Q I;  3FQM A;  3GTK I;  5FLX f;  2QLV B;  1I6H I;  2KPI A;  2LFU A;  2EGT A;  2IZ3 A;  4A3G I;  3GTP I;  3QWU A;  2JA6 I;  5FLM I;  1USP B;  1VQ5 Z;  2QEX Z;  3CCS 1;  3CC7 1;  1NUI A;  2YAD A;  3BG1 B;  3IFU A;  2NVT I;  4E30 A;  1NJI 1;  3S1M I;  4RVH A;  4MXU A;  1YIJ 1;  4NB9 A;  3S2D I;  3I4N I;  2IZ4 A;  1YJ9 1;  5T67 A;  1LQL A;  3OW2 Z;  2JA7 I;  2E2I I;  3NDJ A;  3CCE Z;  3G4S 1;  1KC8 2;  2OOX B;  1M90 1;  5D1P A;  5A2Q f;  4NBE A;  1VQL Z;  3CCR 1;  1Q81 1;  3CCU 1;  3J81 b;  1K73 2;  3I56 1;  4A3I I;  4HGZ A;  4A3L I;  4NB8 A;  4BXX I;  5IP7 I;  2DE7 A;  1K9M 1;  3ESW A;  3CCS Z;  1KD1 2;  3GKQ A;  4HGY A;  2AKL A;  3CC7 Z;  4RS4 A;  3D6W A;  4S1T A;  3CMA 1;  5D1O B;  3CC2 Z;  2LIY A;  3MZL B;  3HOW I;  3NDI A;  2H85 A;  1YIT 1;  3FKI I;  1YIJ Z;  4NBC A;  1JWH C;  3S17 I;  5C44 I;  1YJ9 Z;  4HH4 A;  3VB9 A;  3JAM f;  1RO2 A;  3MON A;  2JR6 A;  3G4S Z;  2JUB A;  4CL1 A;  4BBS I;  2OZK A;  2VUG A;  2PM9 A;  3CCM 1;  1TWC I;  3T4N B;  2V8K A;  1DL6 A;  4E2W A;  3I56 Z;  1YJW 1;  2R7Z I;  1NJI 2;  3FQQ A;  5C4X I;  1M1K 1;  3GTJ I;  3CPW Y;  1VQO 1;  2R92 I;  2DE5 A;  1KD1 1;  1Q7Y 1;  2YU9 I;  4NBA A;  3G6E 1;  2ZAE B;  2Q51 A;  4RVG A;  3HKZ A;  1M90 2;  4A3K I;  3HOU I;  2GTI A;  1QYP A;  1S72 Z;  1Q81 2;  4MON A;  2B63 I;  2QA4 1;  2F4O A;  5IT9 b;  3EER A;  3J80 f;  1VQN 1;  5FLX b;  3CC4 Z;  2J6A A;  1YI2 1;  4E32 A;  1VQ4 1;  3S1Q I;  1TWG I;  5C3E I;  3VTN A;  4DGL A;  5CM2 M;  1K9M 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...