3JAMb

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords 18S rRNA
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamb00
5IT9b 3J81b 5FLXb 5A2Qb 3J7A4 3J80b 5LL6f 3JAMb
chains in the Genus database with same CATH superfamily
2AYDA 2HU9A 1YI21 3CCS1 2VF1A 1YITZ 1QVGY 1QYPA 1Q811 3S1MI 1VQPZ 2JIQA 2V3VA 3TE5B 2OTJZ 1Y8CA 2JIOA 2QR1B 3GKQA 1TWAI 3CMAZ 2E2HI 1S72Z 3G4S1 3PO2I 3F3FC 3CCSZ 3HOZI 2JIPA 3NH4A 5IP9I 3S2DI 1VQ5Z 2VPWA 4BY1I 4S1TA 2Q51A 3GTQI 2RHBA 4NBHA 3CMEZ 5CM2M 3CMA1 1N2FA 3IFUA 1K8A1 1Q812 5C44I 3CCM1 2R93I 2LEXA 1X0TA 1VQ91 5IT9b 4A3MI 3KIHA 2QKDA 4MXUA 3U50C 1P9NA 1K731 2RT9A 3D2LA 3IR7A 1YJNZ 1YHQZ 3CCV1 2GU2A 2P28A 3JAMf 3CCQ1 2LFUA 3PO3I 2VPZA 5C4XI 1X3ZA 1VQL1 2RIQA 2JUBA 4DGLA 2VUMI 5T64A 3CC7Z 4A3LI 3CCMZ 3I55Z 2E7ZA 3CCL1 1N8R1 1Q862 4E2XA 4RVGA 3CCEZ 4EWCA 1W2BY 3S16I 2EGTA 3Q87A 3CCR1 3G6E1 1QF8A 1AA6A 3I4NI 1JJ2Z 2JIRA 2R92I 1RO2A 3PO3S 3IX0A 4DQYB 1ML8A 3S1RI 1R9TI 5T6BA 2RBLA 2YADA 4NFRA 4NBCA 3I4MI 3GTMS 1Y1VI 3CC2Z 1YJW1 1VQNZ 1DL6A 4NOZA 3H3VJ 2F4MA 3S1QI 1KD11 5D1OB 2HF1A 2V45A 3H0GI 3CCRZ 1VQ51 4MH4A 3G6EZ 1VQK1 3CCU1 4A3CI 3VB9A 1ZB8A 2NVTI 3G4SZ 3GTKI 2O53A 3HOWI 2QEXZ 3CD6Z 1WZNA 1FDOA 1Q16A 2KPIA 4NBDA 1Q7Y2 1VQM1 2NVXI 1VQ8Z 5FLMI 4RV9A 4A93I 3FKII 3FQQA 1YHQ1 4XX2A 3CCVZ 2RPRA 1N8R2 3EEDA 1I50I 1M902 3J80f 3D6WA 3RZOI 2E2II 3CXCY 2JA7I 1VQ81 4E30A 4BBRI 1WJ2A 1VQ41 3CC21 1USPA 2V8KA 3J81b 1WIIA 4BXXI 3EERA 1VQ4Z 2E9HA 2E2JI 2GTIA 2NAPA 1Q7Y1 1M1K1 4HGYA 1YIT1 1KC81 1VQLZ 5AN9F 4MRIA 1VQOZ 1VQKZ 1RO4A 2QRCB 2R6MA 4RVHA 5D1OA 3GTOI 1ZB9A 1RO0A 2JR6A 1S721 2Q4ZA 3S17I 5FLXb 2YU9I 4CL1A 1TWGI 3NH5A 3GTMI 4NBFA 4QTUA 2AKLA 3I56Z 4A3KI 3VMHA 2NVQI 3MZKB 2Y0SA 2M6NA 2QREB 2DE6A 3G711 3CC4Z 2JA6I 3NFZA 4MONA 4NB9A 3CCJ1 2F4OA 3OW2Y 3IF8A 3HOYI 1KRLA 4NBAA 3CPWZ 3T4NB 4RVFA 3I551 3BG0B 4E2YA 1JWHC 5IP7I 1USPB 3F3PC 4NBBA 1VQP1 2OTJ1 3TDHB 2K5RA 2V8IA 3OW2Z 5A2Qf 1YI2Z 1NJI1 3GTJI 1M901 4E31A 2OZKA 3P5JB 1SIWA 4A3II 2O4HA 2JMOA 3CCUZ 2VPYA 4HGZA 3D9XA 2ZAEB 1KC82 2H85A 1TWCI 1RNIA 4NBGA 1WW9A 2IZ4A 1YJWZ 1K732 1L1OC 3J80b 1Z03A 4Y52I 1YUAA 1VQMZ 3MZLB 3J7A4 1QXFA 1FDIA 2G2KA 3MONA 5LL6f 3M4OI 1VQ71 1TWHI 3GCFA 4QTTA 4A3GI 3NDIA 2JA8I 3HOUI 4E32A 3CPWY 1Z01A 4NH1C 4E33A 3S15I 1K9M1 1NUIA 4BBSI 2OOYB 1NP6A 4E2ZA 1Y1WI 1Q861 2OOXB 3LUSA 1TFIA 2OTL1 2QA41 3S1NI 1VQ61 1QVGZ 3HOVI 3CQZI 2IZ3A 2QA4Z 4RS4A 4NBEA 1Q822 2JS4A 3HOXI 3CCQZ 4A3DI 4TNUA 1RLYA 5A2Qb 4E2WA 3S14I 1TWFI 1LQLA 1YJN1 1QVFY 1Z02A 2I3CA 3GTPI 3CCJZ 1VQO1 1ZH1A 3CCE1 3VMGA 2W04A 4DK1A 2V8JA 4A3FI 1Y1VS 1RQFA 1KD12 1KQSZ 2BJOA 1SFOI 3NDJA 2VUGA 3RZDI 3S2HI 3KIFA 2M48A 3CME1 4AYBA 4Y7NI 1I6HI 2QLVB 4MD7A 4X6AI 3GTGI 4MD9A 3CXCZ 4MD8A 1VLAA 3G71Z 3CC41 1K83I 3I07A 5FLXf 2LIYA 3JAMb 1VQ9Z 3GTLI 2VPXA 1VQ7Z 1YJ91 4A3BI 2JNYA 1YIJ1 3CCLZ 4BY7I 1S7MA 3QWUA 2QEX1 3CD61 1YIJZ 2OTLZ 1JJ2Y 2R7ZI 1VQ6Z 2KI7B 5IT9f 2DE7A 3NH8A 1PFTA 5T67A 3BG1B 3VTNA 1WCMI 1W2BZ 2PM9A 3J81f 2IV2X 5C3EI 3FQMA 1K8A2 2B63I 2QRDB 2WB1A 5C4JI 4HH4A 2JIMA 1KQSY 1X3WA 3HKZA 2P3YA 4A3EI 2J6AA 1Q821 1VQN1 3ESWA 3M3YI 1M1K2 2PK7A 4A3JI 3CC71 2PMZA 2NVYI 3I561 5D1PA 4RVDA 4NB8A 3VMIA 2K3RA 3K7AI 2GTHA 1YJ9Z 2DE5A 2WAQA 1QVFZ 1NJI2 2W03A 1K9M2 2JA5I 1YUKA 1I3QI
chains in the Genus database with same CATH topology
2HU9A 1YI21 3CCS1 2VF1A 1YITZ 1QVGY 1QYPA 1Q811 3S1MI 1VQPZ 3TE5B 2OTJZ 2QR1B 3GKQA 1TWAI 3CMAZ 2E2HI 1S72Z 3G4S1 3PO2I 3F3FC 3CCSZ 3HOZI 3NH4A 5IP9I 3S2DI 1VQ5Z 4BY1I 4S1TA 2Q51A 3GTQI 2RHBA 4NBHA 3CMEZ 5CM2M 3CMA1 1N2FA 3IFUA 1K8A1 1Q812 5C44I 3CCM1 2R93I 1X0TA 1VQ91 5IT9b 4A3MI 3KIHA 2QKDA 4MXUA 3U50C 1P9NA 1K731 2RT9A 1YJNZ 1YHQZ 3CCV1 2GU2A 2P28A 3JAMf 2LFUA 3CCQ1 3PO3I 5C4XI 1X3ZA 1VQL1 2RIQA 2JUBA 4DGLA 2VUMI 5T64A 3CC7Z 4A3LI 3CCMZ 3I55Z 3CCL1 1N8R1 1Q862 4E2XA 4RVGA 3CCEZ 4EWCA 1W2BY 3S16I 2EGTA 3Q87A 3CCR1 3G6E1 1QF8A 3I4NI 1JJ2Z 2R92I 1RO2A 3PO3S 3IX0A 4DQYB 1ML8A 3S1RI 1R9TI 5T6BA 2RBLA 2YADA 4NFRA 4NBCA 3I4MI 3GTMS 1Y1VI 3CC2Z 1YJW1 1VQNZ 1DL6A 4NOZA 3H3VJ 2F4MA 3S1QI 1KD11 5D1OB 2HF1A 3H0GI 3CCRZ 1VQ51 4MH4A 3G6EZ 1VQK1 3CCU1 4A3CI 3VB9A 1ZB8A 2NVTI 3G4SZ 3GTKI 2O53A 3HOWI 2QEXZ 3CD6Z 4NBDA 2KPIA 1Q7Y2 1VQM1 2NVXI 1VQ8Z 5FLMI 4RV9A 4A93I 3FKII 3FQQA 1YHQ1 4XX2A 3CCVZ 2RPRA 1N8R2 3EEDA 1I50I 1M902 3J80f 3D6WA 3RZOI 2E2II 3CXCY 2JA7I 1VQ81 4E30A 4BBRI 1VQ41 3CC21 1USPA 2V8KA 3J81b 1WIIA 4BXXI 3EERA 1VQ4Z 2E9HA 2E2JI 2GTIA 1Q7Y1 1M1K1 4HGYA 1YIT1 1KC81 1VQLZ 5AN9F 4MRIA 1VQOZ 1VQKZ 1RO4A 2QRCB 2R6MA 4RVHA 5D1OA 3GTOI 1ZB9A 1RO0A 2JR6A 1S721 2Q4ZA 3S17I 5FLXb 2YU9I 4CL1A 1TWGI 3NH5A 3GTMI 4NBFA 4QTUA 2AKLA 3I56Z 4A3KI 3VMHA 2NVQI 3MZKB 2Y0SA 2M6NA 2QREB 2DE6A 3G711 3CC4Z 2JA6I 3NFZA 4MONA 4NB9A 3CCJ1 2F4OA 3OW2Y 3IF8A 3HOYI 1KRLA 4NBAA 3CPWZ 3T4NB 4RVFA 3I551 3BG0B 4E2YA 1JWHC 5IP7I 1USPB 3F3PC 4NBBA 1VQP1 2OTJ1 3TDHB 2K5RA 2V8IA 3OW2Z 5A2Qf 1YI2Z 1NJI1 3GTJI 1M901 4E31A 2OZKA 3P5JB 4A3II 2O4HA 2JMOA 3CCUZ 4HGZA 3D9XA 2ZAEB 1KC82 2H85A 1TWCI 1RNIA 4NBGA 1WW9A 2IZ4A 1YJWZ 1K732 1L1OC 3J80b 1Z03A 4Y52I 1YUAA 1VQMZ 3MZLB 3J7A4 2G2KA 3MONA 5LL6f 3M4OI 1VQ71 1TWHI 3GCFA 4QTTA 4A3GI 3NDIA 2JA8I 3HOUI 4E32A 3CPWY 1Z01A 4NH1C 4E33A 3S15I 1K9M1 1NUIA 4BBSI 2OOYB 1NP6A 4E2ZA 1Y1WI 1Q861 2OOXB 3LUSA 1TFIA 2OTL1 2QA41 3S1NI 1VQ61 1QVGZ 3HOVI 3CQZI 2IZ3A 2QA4Z 4RS4A 4NBEA 1Q822 2JS4A 3HOXI 3CCQZ 4A3DI 4TNUA 1RLYA 5A2Qb 4E2WA 3S14I 1TWFI 1LQLA 1YJN1 1QVFY 1Z02A 2I3CA 3GTPI 3CCJZ 1VQO1 1ZH1A 3CCE1 3VMGA 2W04A 4DK1A 2V8JA 4A3FI 1Y1VS 1RQFA 1KD12 1KQSZ 2BJOA 1SFOI 3NDJA 2VUGA 3RZDI 3S2HI 3KIFA 2M48A 3CME1 4AYBA 4Y7NI 1I6HI 2QLVB 4MD7A 4X6AI 3GTGI 4MD9A 3CXCZ 4MD8A 1VLAA 3G71Z 3CC41 1K83I 3I07A 5FLXf 2LIYA 3JAMb 1VQ9Z 3GTLI 1VQ7Z 1YJ91 4A3BI 2JNYA 1YIJ1 3CCLZ 4BY7I 1S7MA 3QWUA 2QEX1 3CD61 1YIJZ 2OTLZ 1JJ2Y 2R7ZI 1VQ6Z 2KI7B 5IT9f 2DE7A 3NH8A 1PFTA 5T67A 3BG1B 3VTNA 1WCMI 1W2BZ 2PM9A 3J81f 5C3EI 3FQMA 1K8A2 2B63I 2QRDB 2WB1A 5C4JI 4HH4A 1KQSY 1X3WA 3HKZA 2P3YA 4A3EI 2J6AA 1Q821 1VQN1 3ESWA 3M3YI 1M1K2 2PK7A 4A3JI 3CC71 2PMZA 2NVYI 3I561 5D1PA 4RVDA 4NB8A 3VMIA 2K3RA 3K7AI 2GTHA 1YJ9Z 2DE5A 2WAQA 1QVFZ 1NJI2 2W03A 1K9M2 2JA5I 1YUKA 1I3QI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 b;  3J81 b;  5FLX b;  5A2Q b;  3J7A 4;  3J80 b;  5LL6 f;  3JAM b; 
#chains in the Genus database with same CATH topology
 2AYD A;  2HU9 A;  1YI2 1;  3CCS 1;  2VF1 A;  1YIT Z;  1QVG Y;  1QYP A;  1Q81 1;  3S1M I;  1VQP Z;  2JIQ A;  2V3V A;  3TE5 B;  2OTJ Z;  1Y8C A;  2JIO A;  2QR1 B;  3GKQ A;  1TWA I;  3CMA Z;  2E2H I;  1S72 Z;  3G4S 1;  3PO2 I;  3F3F C;  3CCS Z;  3HOZ I;  2JIP A;  3NH4 A;  5IP9 I;  3S2D I;  1VQ5 Z;  2VPW A;  4BY1 I;  4S1T A;  2Q51 A;  3GTQ I;  2RHB A;  4NBH A;  3CME Z;  5CM2 M;  3CMA 1;  1N2F A;  3IFU A;  1K8A 1;  1Q81 2;  5C44 I;  3CCM 1;  2R93 I;  2LEX A;  1X0T A;  1VQ9 1;  5IT9 b;  4A3M I;  3KIH A;  2QKD A;  4MXU A;  3U50 C;  1P9N A;  1K73 1;  2RT9 A;  3D2L A;  3IR7 A;  1YJN Z;  1YHQ Z;  3CCV 1;  2GU2 A;  2P28 A;  3JAM f;  3CCQ 1;  2LFU A;  3PO3 I;  2VPZ A;  5C4X I;  1X3Z A;  1VQL 1;  2RIQ A;  2JUB A;  4DGL A;  2VUM I;  5T64 A;  3CC7 Z;  4A3L I;  3CCM Z;  3I55 Z;  2E7Z A;  3CCL 1;  1N8R 1;  1Q86 2;  4E2X A;  4RVG A;  3CCE Z;  4EWC A;  1W2B Y;  3S16 I;  2EGT A;  3Q87 A;  3CCR 1;  3G6E 1;  1QF8 A;  1AA6 A;  3I4N I;  1JJ2 Z;  2JIR A;  2R92 I;  1RO2 A;  3PO3 S;  3IX0 A;  4DQY B;  1ML8 A;  3S1R I;  1R9T I;  5T6B A;  2RBL A;  2YAD A;  4NFR A;  4NBC A;  3I4M I;  3GTM S;  1Y1V I;  3CC2 Z;  1YJW 1;  1VQN Z;  1DL6 A;  4NOZ A;  3H3V J;  2F4M A;  3S1Q I;  1KD1 1;  5D1O B;  2HF1 A;  2V45 A;  3H0G I;  3CCR Z;  1VQ5 1;  4MH4 A;  3G6E Z;  1VQK 1;  3CCU 1;  4A3C I;  3VB9 A;  1ZB8 A;  2NVT I;  3G4S Z;  3GTK I;  2O53 A;  3HOW I;  2QEX Z;  3CD6 Z;  1WZN A;  1FDO A;  1Q16 A;  2KPI A;  4NBD A;  1Q7Y 2;  1VQM 1;  2NVX I;  1VQ8 Z;  5FLM I;  4RV9 A;  4A93 I;  3FKI I;  3FQQ A;  1YHQ 1;  4XX2 A;  3CCV Z;  2RPR A;  1N8R 2;  3EED A;  1I50 I;  1M90 2;  3J80 f;  3D6W A;  3RZO I;  2E2I I;  3CXC Y;  2JA7 I;  1VQ8 1;  4E30 A;  4BBR I;  1WJ2 A;  1VQ4 1;  3CC2 1;  1USP A;  2V8K A;  3J81 b;  1WII A;  4BXX I;  3EER A;  1VQ4 Z;  2E9H A;  2E2J I;  2GTI A;  2NAP A;  1Q7Y 1;  1M1K 1;  4HGY A;  1YIT 1;  1KC8 1;  1VQL Z;  5AN9 F;  4MRI A;  1VQO Z;  1VQK Z;  1RO4 A;  2QRC B;  2R6M A;  4RVH A;  5D1O A;  3GTO I;  1ZB9 A;  1RO0 A;  2JR6 A;  1S72 1;  2Q4Z A;  3S17 I;  5FLX b;  2YU9 I;  4CL1 A;  1TWG I;  3NH5 A;  3GTM I;  4NBF A;  4QTU A;  2AKL A;  3I56 Z;  4A3K I;  3VMH A;  2NVQ I;  3MZK B;  2Y0S A;  2M6N A;  2QRE B;  2DE6 A;  3G71 1;  3CC4 Z;  2JA6 I;  3NFZ A;  4MON A;  4NB9 A;  3CCJ 1;  2F4O A;  3OW2 Y;  3IF8 A;  3HOY I;  1KRL A;  4NBA A;  3CPW Z;  3T4N B;  4RVF A;  3I55 1;  3BG0 B;  4E2Y A;  1JWH C;  5IP7 I;  1USP B;  3F3P C;  4NBB A;  1VQP 1;  2OTJ 1;  3TDH B;  2K5R A;  2V8I A;  3OW2 Z;  5A2Q f;  1YI2 Z;  1NJI 1;  3GTJ I;  1M90 1;  4E31 A;  2OZK A;  3P5J B;  1SIW A;  4A3I I;  2O4H A;  2JMO A;  3CCU Z;  2VPY A;  4HGZ A;  3D9X A;  2ZAE B;  1KC8 2;  2H85 A;  1TWC I;  1RNI A;  4NBG A;  1WW9 A;  2IZ4 A;  1YJW Z;  1K73 2;  1L1O C;  3J80 b;  1Z03 A;  4Y52 I;  1YUA A;  1VQM Z;  3MZL B;  3J7A 4;  1QXF A;  1FDI A;  2G2K A;  3MON A;  5LL6 f;  3M4O I;  1VQ7 1;  1TWH I;  3GCF A;  4QTT A;  4A3G I;  3NDI A;  2JA8 I;  3HOU I;  4E32 A;  3CPW Y;  1Z01 A;  4NH1 C;  4E33 A;  3S15 I;  1K9M 1;  1NUI A;  4BBS I;  2OOY B;  1NP6 A;  4E2Z A;  1Y1W I;  1Q86 1;  2OOX B;  3LUS A;  1TFI A;  2OTL 1;  2QA4 1;  3S1N I;  1VQ6 1;  1QVG Z;  3HOV I;  3CQZ I;  2IZ3 A;  2QA4 Z;  4RS4 A;  4NBE A;  1Q82 2;  2JS4 A;  3HOX I;  3CCQ Z;  4A3D I;  4TNU A;  1RLY A;  5A2Q b;  4E2W A;  3S14 I;  1TWF I;  1LQL A;  1YJN 1;  1QVF Y;  1Z02 A;  2I3C A;  3GTP I;  3CCJ Z;  1VQO 1;  1ZH1 A;  3CCE 1;  3VMG A;  2W04 A;  4DK1 A;  2V8J A;  4A3F I;  1Y1V S;  1RQF A;  1KD1 2;  1KQS Z;  2BJO A;  1SFO I;  3NDJ A;  2VUG A;  3RZD I;  3S2H I;  3KIF A;  2M48 A;  3CME 1;  4AYB A;  4Y7N I;  1I6H I;  2QLV B;  4MD7 A;  4X6A I;  3GTG I;  4MD9 A;  3CXC Z;  4MD8 A;  1VLA A;  3G71 Z;  3CC4 1;  1K83 I;  3I07 A;  5FLX f;  2LIY A;  3JAM b;  1VQ9 Z;  3GTL I;  2VPX A;  1VQ7 Z;  1YJ9 1;  4A3B I;  2JNY A;  1YIJ 1;  3CCL Z;  4BY7 I;  1S7M A;  3QWU A;  2QEX 1;  3CD6 1;  1YIJ Z;  2OTL Z;  1JJ2 Y;  2R7Z I;  1VQ6 Z;  2KI7 B;  5IT9 f;  2DE7 A;  3NH8 A;  1PFT A;  5T67 A;  3BG1 B;  3VTN A;  1WCM I;  1W2B Z;  2PM9 A;  3J81 f;  2IV2 X;  5C3E I;  3FQM A;  1K8A 2;  2B63 I;  2QRD B;  2WB1 A;  5C4J I;  4HH4 A;  2JIM A;  1KQS Y;  1X3W A;  3HKZ A;  2P3Y A;  4A3E I;  2J6A A;  1Q82 1;  1VQN 1;  3ESW A;  3M3Y I;  1M1K 2;  2PK7 A;  4A3J I;  3CC7 1;  2PMZ A;  2NVY I;  3I56 1;  5D1P A;  4RVD A;  4NB8 A;  3VMI A;  2K3R A;  3K7A I;  2GTH A;  1YJ9 Z;  2DE5 A;  2WAQ A;  1QVF Z;  1NJI 2;  2W03 A;  1K9M 2;  2JA5 I;  1YUK A;  1I3Q I; 
#chains in the Genus database with same CATH homology
 2HU9 A;  1YI2 1;  3CCS 1;  2VF1 A;  1YIT Z;  1QVG Y;  1QYP A;  1Q81 1;  3S1M I;  1VQP Z;  3TE5 B;  2OTJ Z;  2QR1 B;  3GKQ A;  1TWA I;  3CMA Z;  2E2H I;  1S72 Z;  3G4S 1;  3PO2 I;  3F3F C;  3CCS Z;  3HOZ I;  3NH4 A;  5IP9 I;  3S2D I;  1VQ5 Z;  4BY1 I;  4S1T A;  2Q51 A;  3GTQ I;  2RHB A;  4NBH A;  3CME Z;  5CM2 M;  3CMA 1;  1N2F A;  3IFU A;  1K8A 1;  1Q81 2;  5C44 I;  3CCM 1;  2R93 I;  1X0T A;  1VQ9 1;  5IT9 b;  4A3M I;  3KIH A;  2QKD A;  4MXU A;  3U50 C;  1P9N A;  1K73 1;  2RT9 A;  1YJN Z;  1YHQ Z;  3CCV 1;  2GU2 A;  2P28 A;  3JAM f;  2LFU A;  3CCQ 1;  3PO3 I;  5C4X I;  1X3Z A;  1VQL 1;  2RIQ A;  2JUB A;  4DGL A;  2VUM I;  5T64 A;  3CC7 Z;  4A3L I;  3CCM Z;  3I55 Z;  3CCL 1;  1N8R 1;  1Q86 2;  4E2X A;  4RVG A;  3CCE Z;  4EWC A;  1W2B Y;  3S16 I;  2EGT A;  3Q87 A;  3CCR 1;  3G6E 1;  1QF8 A;  3I4N I;  1JJ2 Z;  2R92 I;  1RO2 A;  3PO3 S;  3IX0 A;  4DQY B;  1ML8 A;  3S1R I;  1R9T I;  5T6B A;  2RBL A;  2YAD A;  4NFR A;  4NBC A;  3I4M I;  3GTM S;  1Y1V I;  3CC2 Z;  1YJW 1;  1VQN Z;  1DL6 A;  4NOZ A;  3H3V J;  2F4M A;  3S1Q I;  1KD1 1;  5D1O B;  2HF1 A;  3H0G I;  3CCR Z;  1VQ5 1;  4MH4 A;  3G6E Z;  1VQK 1;  3CCU 1;  4A3C I;  3VB9 A;  1ZB8 A;  2NVT I;  3G4S Z;  3GTK I;  2O53 A;  3HOW I;  2QEX Z;  3CD6 Z;  4NBD A;  2KPI A;  1Q7Y 2;  1VQM 1;  2NVX I;  1VQ8 Z;  5FLM I;  4RV9 A;  4A93 I;  3FKI I;  3FQQ A;  1YHQ 1;  4XX2 A;  3CCV Z;  2RPR A;  1N8R 2;  3EED A;  1I50 I;  1M90 2;  3J80 f;  3D6W A;  3RZO I;  2E2I I;  3CXC Y;  2JA7 I;  1VQ8 1;  4E30 A;  4BBR I;  1VQ4 1;  3CC2 1;  1USP A;  2V8K A;  3J81 b;  1WII A;  4BXX I;  3EER A;  1VQ4 Z;  2E9H A;  2E2J I;  2GTI A;  1Q7Y 1;  1M1K 1;  4HGY A;  1YIT 1;  1KC8 1;  1VQL Z;  5AN9 F;  4MRI A;  1VQO Z;  1VQK Z;  1RO4 A;  2QRC B;  2R6M A;  4RVH A;  5D1O A;  3GTO I;  1ZB9 A;  1RO0 A;  2JR6 A;  1S72 1;  2Q4Z A;  3S17 I;  5FLX b;  2YU9 I;  4CL1 A;  1TWG I;  3NH5 A;  3GTM I;  4NBF A;  4QTU A;  2AKL A;  3I56 Z;  4A3K I;  3VMH A;  2NVQ I;  3MZK B;  2Y0S A;  2M6N A;  2QRE B;  2DE6 A;  3G71 1;  3CC4 Z;  2JA6 I;  3NFZ A;  4MON A;  4NB9 A;  3CCJ 1;  2F4O A;  3OW2 Y;  3IF8 A;  3HOY I;  1KRL A;  4NBA A;  3CPW Z;  3T4N B;  4RVF A;  3I55 1;  3BG0 B;  4E2Y A;  1JWH C;  5IP7 I;  1USP B;  3F3P C;  4NBB A;  1VQP 1;  2OTJ 1;  3TDH B;  2K5R A;  2V8I A;  3OW2 Z;  5A2Q f;  1YI2 Z;  1NJI 1;  3GTJ I;  1M90 1;  4E31 A;  2OZK A;  3P5J B;  4A3I I;  2O4H A;  2JMO A;  3CCU Z;  4HGZ A;  3D9X A;  2ZAE B;  1KC8 2;  2H85 A;  1TWC I;  1RNI A;  4NBG A;  1WW9 A;  2IZ4 A;  1YJW Z;  1K73 2;  1L1O C;  3J80 b;  1Z03 A;  4Y52 I;  1YUA A;  1VQM Z;  3MZL B;  3J7A 4;  2G2K A;  3MON A;  5LL6 f;  3M4O I;  1VQ7 1;  1TWH I;  3GCF A;  4QTT A;  4A3G I;  3NDI A;  2JA8 I;  3HOU I;  4E32 A;  3CPW Y;  1Z01 A;  4NH1 C;  4E33 A;  3S15 I;  1K9M 1;  1NUI A;  4BBS I;  2OOY B;  1NP6 A;  4E2Z A;  1Y1W I;  1Q86 1;  2OOX B;  3LUS A;  1TFI A;  2OTL 1;  2QA4 1;  3S1N I;  1VQ6 1;  1QVG Z;  3HOV I;  3CQZ I;  2IZ3 A;  2QA4 Z;  4RS4 A;  4NBE A;  1Q82 2;  2JS4 A;  3HOX I;  3CCQ Z;  4A3D I;  4TNU A;  1RLY A;  5A2Q b;  4E2W A;  3S14 I;  1TWF I;  1LQL A;  1YJN 1;  1QVF Y;  1Z02 A;  2I3C A;  3GTP I;  3CCJ Z;  1VQO 1;  1ZH1 A;  3CCE 1;  3VMG A;  2W04 A;  4DK1 A;  2V8J A;  4A3F I;  1Y1V S;  1RQF A;  1KD1 2;  1KQS Z;  2BJO A;  1SFO I;  3NDJ A;  2VUG A;  3RZD I;  3S2H I;  3KIF A;  2M48 A;  3CME 1;  4AYB A;  4Y7N I;  1I6H I;  2QLV B;  4MD7 A;  4X6A I;  3GTG I;  4MD9 A;  3CXC Z;  4MD8 A;  1VLA A;  3G71 Z;  3CC4 1;  1K83 I;  3I07 A;  5FLX f;  2LIY A;  3JAM b;  1VQ9 Z;  3GTL I;  1VQ7 Z;  1YJ9 1;  4A3B I;  2JNY A;  1YIJ 1;  3CCL Z;  4BY7 I;  1S7M A;  3QWU A;  2QEX 1;  3CD6 1;  1YIJ Z;  2OTL Z;  1JJ2 Y;  2R7Z I;  1VQ6 Z;  2KI7 B;  5IT9 f;  2DE7 A;  3NH8 A;  1PFT A;  5T67 A;  3BG1 B;  3VTN A;  1WCM I;  1W2B Z;  2PM9 A;  3J81 f;  5C3E I;  3FQM A;  1K8A 2;  2B63 I;  2QRD B;  2WB1 A;  5C4J I;  4HH4 A;  1KQS Y;  1X3W A;  3HKZ A;  2P3Y A;  4A3E I;  2J6A A;  1Q82 1;  1VQN 1;  3ESW A;  3M3Y I;  1M1K 2;  2PK7 A;  4A3J I;  3CC7 1;  2PMZ A;  2NVY I;  3I56 1;  5D1P A;  4RVD A;  4NB8 A;  3VMI A;  2K3R A;  3K7A I;  2GTH A;  1YJ9 Z;  2DE5 A;  2WAQ A;  1QVF Z;  1NJI 2;  2W03 A;  1K9M 2;  2JA5 I;  1YUK A;  1I3Q I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...