3JAMb

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
b'VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamb00
3J80b 3J81b 3JAMb 3J7A4 5FLXb 5A2Qb 5LL6f 5IT9b
chains in the Genus database with same CATH superfamily
4NB9A 1TWAI 2V8IA 1Y1WI 3I561 1KC82 3CCRZ 2G2KA 1WIIA 3CCR1 2GTHA 3CCJ1 3CXCY 3GTOI 2V45A 3NH4A 1VQM1 2IZ3A 3CC2Z 3TE5B 1USPA 3D6WA 3LUSA 3TDHB 2NVXI 2QEXZ 1YUAA 3GTGI 4NBAA 2E7ZA 5LL6f 3RZOI 1Q862 4EWCA 1QF8A 3I4MI 2RIQA 3EERA 2V3VA 1R9TI 1Q7Y2 3I07A 4A3MI 1YJ9Z 1TWFI 1W2BY 1QVGY 1I50I 3S15I 3GCFA 1VQ6Z 3G71Z 3S2HI 1K9M1 4RV9A 1VQLZ 1VQOZ 3HOYI 3M3YI 1YIT1 1YJWZ 3GTMS 1N2FA 2QKDA 1X0TA 3PO2I 1YJW1 1Q861 4BY1I 2JMOA 2OTJZ 2O53A 4MONA 4MD9A 4MXUA 2HU9A 5C4JI 2E2JI 1NP6A 4E2XA 1VQK1 4MD8A 3HOZI 4A3KI 1KRLA 2R92I 4HGYA 1LQLA 2J6AA 2JS4A 3F3PC 3S16I 3CCLZ 2WAQA 3H0GI 5D1OB 3NDIA 2QRDB 4NB8A 4NBBA 2R93I 1JWHC 4E2WA 1USPB 1QXFA 2RT9A 4A93I 2P3YA 4MH4A 3I4NI 3K7AI 1VQ8Z 1KQSZ 1P9NA 2LIYA 2OZKA 4RVHA 3S1MI 1TFIA 3VMHA 4DGLA 1YI21 3FQMA 5IT9b 1TWHI 2JA5I 4BY7I 2WB1A 1ZB8A 5C4XI 4A3II 1YIJ1 2I3CA 3IX0A 1PFTA 3GTQI 3CCSZ 4AYBA 2LFUA 1VQPZ 1SIWA 2E2HI 3GTMI 4E31A 3CC4Z 3CCM1 2OTL1 2JIPA 3CC41 1W2BZ 1QVGZ 1VQNZ 1TWGI 1QYPA 2O4HA 3CCJZ 4E32A 1VQN1 3MZKB 1VQMZ 4Y7NI 5D1OA 1FDOA 2JUBA 2OOXB 1Q16A 3BG0B 2VPXA 1K9M2 3J81f 2R6MA 1WCMI 1K732 2P28A 1VQ41 5IP9I 1KD12 3GTPI 2NAPA 2YADA 1X3WA 3S14I 2LEXA 3CD61 2QR1B 1K83I 1RQFA 3CCE1 1Y1VI 2VPWA 5IT9f 1RO2A 2JA6I 1Z03A 3J80f 1VQ5Z 1YHQZ 1L1OC 2JIQA 1VQ51 4RVDA 1YHQ1 1Y8CA 3IFUA 2PK7A 3S17I 2F4OA 2JIOA 3G4S1 2E9HA 5FLXb 3PO3S 1YITZ 1K731 2H85A 2YU9I 1YUKA 3NFZA 2K3RA 2NVYI 3I551 1Z02A 1KD11 1FDIA 4RVFA 5A2Qb 1NUIA 2IZ4A 3JAMf 2QLVB 1VQ9Z 1VQ91 2QA41 3CCUZ 2W04A 3IF8A 1RLYA 5T67A 3CCU1 1VQKZ 5FLMI 2DE7A 3HOWI 3BG1B 3RZDI 1N8R1 1YJNZ 1S721 3CMA1 2V8KA 4NBDA 1YJN1 4NOZA 3CQZI 1RNIA 1S7MA 3S2DI 3T4NB 4A3LI 1VLAA 2EGTA 4E33A 3GKQA 4A3JI 4BBSI 1YI2Z 1JJ2Y 2RBLA 2RPRA 2JR6A 3VMIA 1YIJZ 4BXXI 3G6E1 5FLXf 4A3GI 3CPWZ 2PMZA 1SFOI 3VMGA 3GTLI 2DE6A 4E2ZA 3HOUI 4MRIA 4MD7A 2M6NA 3QWUA 3M4OI 5D1PA 4NBHA 3PO3I 3HKZA 3CCMZ 2OTLZ 4NH1C 1M901 4HGZA 2VPZA 2K5RA 4NFRA 5CM2M 5AN9F 4A3CI 3NH8A 3U50C 2QREB 2GU2A 2JA8I 3HOVI 2QRCB 2M48A 2PM9A 2DE5A 4QTUA 1ZB9A 3HOXI 3CPWY 1VQ4Z 1X3ZA 4NBFA 1Q822 1Z01A 2V8JA 4Y52I 2KPIA 1ZH1A 3KIFA 3ESWA 3FQQA 1WW9A 2JA7I 3P5JB 3MONA 3NH5A 3CD6Z 3CCEZ 4A3EI 3FKII 3CC21 5IP7I 1VQ7Z 2JIMA 1VQ71 2R7ZI 2RHBA 2QEX1 3MZLB 1NJI1 1N8R2 2F4MA 3G4SZ 1QVFY 1RO4A 3NDJA 4RVGA 3I55Z 3KIHA 1Q821 2ZAEB 1M1K2 1RO0A 2Y0SA 2IV2X 1YJ91 4NBGA 4HH4A 3Q87A 1KC81 1Q812 3VB9A 2JNYA 2QA4Z 3H3VJ 4CL1A 2VF1A 3OW2Z 3S1QI 1JJ2Z 1VQ61 2JIRA 3G711 3GTKI 2Q4ZA 2W03A 3VTNA 2BJOA 3CMEZ 1DL6A 3CME1 1VQL1 3S1NI 1VQO1 4RS4A 4X6AI 2AYDA 1S72Z 3CMAZ 4NBCA 2HF1A 5T6BA 4E30A 4E2YA 3CCQZ 2B63I 3CCQ1 2OTJ1 1K8A2 2Q51A 1Q7Y1 4TNUA 1M1K1 4BBRI 4DK1A 4QTTA 2VUMI 1AA6A 4A3FI 1Q811 1M902 3EEDA 2VPYA 2AKLA 3OW2Y 3D2LA 4NBEA 3F3FC 3D9XA 2KI7B 3J81b 3CCL1 3G6EZ 1WZNA 3IR7A 2E2II 4DQYB 2GTIA 1Y1VS 3CCVZ 4XX2A 1VQ81 1K8A1 5A2Qf 3CCV1 1I6HI 3S1RI 2NVQI 1TWCI 5C3EI 1WJ2A 3CXCZ 4A3DI 3J80b 5C44I 3CC7Z 2OOYB 4S1TA 1ML8A 2VUGA 3CC71 4A3BI 2NVTI 1NJI2 1I3QI 3CCS1 3GTJI 1QVFZ 3J7A4 1VQP1 5T64A 1KQSY 3JAMb 3I56Z
chains in the Genus database with same CATH topology
4NB9A 1TWAI 2V8IA 1Y1WI 3I561 1KC82 3CCRZ 2G2KA 1WIIA 3CCR1 2GTHA 3CCJ1 3CXCY 3GTOI 3NH4A 1VQM1 2IZ3A 3CC2Z 3TE5B 1USPA 3D6WA 3LUSA 3TDHB 2NVXI 2QEXZ 1YUAA 3GTGI 4NBAA 5LL6f 3RZOI 1Q862 4EWCA 1QF8A 3I4MI 2RIQA 3EERA 1R9TI 1Q7Y2 3I07A 4A3MI 1YJ9Z 1TWFI 1W2BY 1QVGY 1I50I 3S15I 3GCFA 1VQ6Z 3G71Z 3S2HI 1K9M1 4RV9A 1VQLZ 1VQOZ 3HOYI 3M3YI 1YIT1 1YJWZ 3GTMS 1N2FA 2QKDA 1X0TA 3PO2I 1YJW1 1Q861 4BY1I 2JMOA 2OTJZ 2O53A 4MONA 4MD9A 4MXUA 2HU9A 5C4JI 2E2JI 1NP6A 4E2XA 1VQK1 4MD8A 3HOZI 4A3KI 1KRLA 2R92I 4HGYA 1LQLA 2J6AA 2JS4A 3F3PC 3S16I 3CCLZ 2WAQA 3H0GI 5D1OB 3NDIA 2QRDB 4NB8A 4NBBA 2R93I 1JWHC 4E2WA 1USPB 2RT9A 4A93I 2P3YA 4MH4A 3I4NI 3K7AI 1VQ8Z 1KQSZ 1P9NA 2LIYA 2OZKA 4RVHA 3S1MI 1TFIA 3VMHA 4DGLA 1YI21 3FQMA 5IT9b 1TWHI 2JA5I 4BY7I 2WB1A 1ZB8A 5C4XI 4A3II 1YIJ1 2I3CA 3IX0A 1PFTA 3GTQI 3CCSZ 4AYBA 2LFUA 1VQPZ 2E2HI 3GTMI 4E31A 3CC4Z 3CCM1 2OTL1 3CC41 1W2BZ 1QVGZ 1VQNZ 1TWGI 1QYPA 2O4HA 3CCJZ 4E32A 1VQN1 3MZKB 1VQMZ 4Y7NI 5D1OA 2JUBA 2OOXB 3BG0B 1K9M2 3J81f 2R6MA 1WCMI 1K732 2P28A 1VQ41 5IP9I 1KD12 3GTPI 2YADA 1X3WA 3S14I 3CD61 2QR1B 1K83I 1RQFA 3CCE1 1Y1VI 5IT9f 1RO2A 2JA6I 1Z03A 3J80f 1VQ5Z 1YHQZ 1L1OC 1VQ51 4RVDA 1YHQ1 3IFUA 2PK7A 3S17I 2F4OA 3G4S1 2E9HA 5FLXb 3PO3S 1YITZ 1K731 2H85A 2YU9I 1YUKA 3NFZA 2K3RA 2NVYI 3I551 1Z02A 1KD11 4RVFA 5A2Qb 1NUIA 2IZ4A 3JAMf 2QLVB 1VQ9Z 1VQ91 2QA41 3CCUZ 2W04A 3IF8A 1RLYA 5T67A 3CCU1 1VQKZ 5FLMI 2DE7A 3HOWI 3BG1B 3RZDI 1N8R1 1YJNZ 1S721 3CMA1 2V8KA 4NBDA 1YJN1 4NOZA 3CQZI 1RNIA 1S7MA 3S2DI 3T4NB 4A3LI 1VLAA 2EGTA 4E33A 3GKQA 4A3JI 4BBSI 1YI2Z 1JJ2Y 2RBLA 2RPRA 2JR6A 3VMIA 1YIJZ 4BXXI 3G6E1 5FLXf 4A3GI 3CPWZ 2PMZA 1SFOI 3VMGA 3GTLI 2DE6A 4E2ZA 3HOUI 4MRIA 4MD7A 2M6NA 3QWUA 3M4OI 5D1PA 4NBHA 3PO3I 3HKZA 3CCMZ 2OTLZ 4NH1C 1M901 4HGZA 2K5RA 4NFRA 5CM2M 5AN9F 4A3CI 3NH8A 3U50C 2QREB 2GU2A 2JA8I 3HOVI 2QRCB 2M48A 2PM9A 2DE5A 4QTUA 1ZB9A 3HOXI 3CPWY 1VQ4Z 1X3ZA 4NBFA 1Q822 1Z01A 2V8JA 4Y52I 2KPIA 1ZH1A 3KIFA 3ESWA 3FQQA 1WW9A 2JA7I 3P5JB 3MONA 3NH5A 3CD6Z 3CCEZ 4A3EI 3FKII 3CC21 5IP7I 1VQ7Z 1VQ71 2R7ZI 2RHBA 2QEX1 3MZLB 1NJI1 1N8R2 2F4MA 3G4SZ 1QVFY 1RO4A 3NDJA 4RVGA 3I55Z 3KIHA 1Q821 2ZAEB 1M1K2 1RO0A 2Y0SA 1YJ91 4NBGA 4HH4A 3Q87A 1KC81 1Q812 3VB9A 2JNYA 2QA4Z 3H3VJ 4CL1A 2VF1A 3OW2Z 3S1QI 1JJ2Z 1VQ61 3G711 3GTKI 2Q4ZA 2W03A 3VTNA 2BJOA 3CMEZ 1DL6A 3CME1 1VQL1 3S1NI 1VQO1 4RS4A 4X6AI 1S72Z 3CMAZ 4NBCA 2HF1A 5T6BA 4E30A 4E2YA 3CCQZ 2B63I 3CCQ1 2OTJ1 1K8A2 2Q51A 1Q7Y1 4TNUA 1M1K1 4BBRI 4DK1A 4QTTA 2VUMI 4A3FI 1Q811 1M902 3EEDA 2AKLA 3OW2Y 4NBEA 3F3FC 3D9XA 2KI7B 3J81b 3CCL1 3G6EZ 2E2II 4DQYB 2GTIA 1Y1VS 3CCVZ 4XX2A 1VQ81 1K8A1 5A2Qf 3CCV1 1I6HI 3S1RI 2NVQI 1TWCI 5C3EI 3CXCZ 4A3DI 3J80b 5C44I 3CC7Z 2OOYB 4S1TA 1ML8A 2VUGA 3CC71 4A3BI 2NVTI 1NJI2 1I3QI 3CCS1 3GTJI 1QVFZ 3J7A4 1VQP1 5T64A 1KQSY 3JAMb 3I56Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 b;  3J81 b;  3JAM b;  3J7A 4;  5FLX b;  5A2Q b;  5LL6 f;  5IT9 b; 
#chains in the Genus database with same CATH topology
 4NB9 A;  1TWA I;  2V8I A;  1Y1W I;  3I56 1;  1KC8 2;  3CCR Z;  2G2K A;  1WII A;  3CCR 1;  2GTH A;  3CCJ 1;  3CXC Y;  3GTO I;  2V45 A;  3NH4 A;  1VQM 1;  2IZ3 A;  3CC2 Z;  3TE5 B;  1USP A;  3D6W A;  3LUS A;  3TDH B;  2NVX I;  2QEX Z;  1YUA A;  3GTG I;  4NBA A;  2E7Z A;  5LL6 f;  3RZO I;  1Q86 2;  4EWC A;  1QF8 A;  3I4M I;  2RIQ A;  3EER A;  2V3V A;  1R9T I;  1Q7Y 2;  3I07 A;  4A3M I;  1YJ9 Z;  1TWF I;  1W2B Y;  1QVG Y;  1I50 I;  3S15 I;  3GCF A;  1VQ6 Z;  3G71 Z;  3S2H I;  1K9M 1;  4RV9 A;  1VQL Z;  1VQO Z;  3HOY I;  3M3Y I;  1YIT 1;  1YJW Z;  3GTM S;  1N2F A;  2QKD A;  1X0T A;  3PO2 I;  1YJW 1;  1Q86 1;  4BY1 I;  2JMO A;  2OTJ Z;  2O53 A;  4MON A;  4MD9 A;  4MXU A;  2HU9 A;  5C4J I;  2E2J I;  1NP6 A;  4E2X A;  1VQK 1;  4MD8 A;  3HOZ I;  4A3K I;  1KRL A;  2R92 I;  4HGY A;  1LQL A;  2J6A A;  2JS4 A;  3F3P C;  3S16 I;  3CCL Z;  2WAQ A;  3H0G I;  5D1O B;  3NDI A;  2QRD B;  4NB8 A;  4NBB A;  2R93 I;  1JWH C;  4E2W A;  1USP B;  1QXF A;  2RT9 A;  4A93 I;  2P3Y A;  4MH4 A;  3I4N I;  3K7A I;  1VQ8 Z;  1KQS Z;  1P9N A;  2LIY A;  2OZK A;  4RVH A;  3S1M I;  1TFI A;  3VMH A;  4DGL A;  1YI2 1;  3FQM A;  5IT9 b;  1TWH I;  2JA5 I;  4BY7 I;  2WB1 A;  1ZB8 A;  5C4X I;  4A3I I;  1YIJ 1;  2I3C A;  3IX0 A;  1PFT A;  3GTQ I;  3CCS Z;  4AYB A;  2LFU A;  1VQP Z;  1SIW A;  2E2H I;  3GTM I;  4E31 A;  3CC4 Z;  3CCM 1;  2OTL 1;  2JIP A;  3CC4 1;  1W2B Z;  1QVG Z;  1VQN Z;  1TWG I;  1QYP A;  2O4H A;  3CCJ Z;  4E32 A;  1VQN 1;  3MZK B;  1VQM Z;  4Y7N I;  5D1O A;  1FDO A;  2JUB A;  2OOX B;  1Q16 A;  3BG0 B;  2VPX A;  1K9M 2;  3J81 f;  2R6M A;  1WCM I;  1K73 2;  2P28 A;  1VQ4 1;  5IP9 I;  1KD1 2;  3GTP I;  2NAP A;  2YAD A;  1X3W A;  3S14 I;  2LEX A;  3CD6 1;  2QR1 B;  1K83 I;  1RQF A;  3CCE 1;  1Y1V I;  2VPW A;  5IT9 f;  1RO2 A;  2JA6 I;  1Z03 A;  3J80 f;  1VQ5 Z;  1YHQ Z;  1L1O C;  2JIQ A;  1VQ5 1;  4RVD A;  1YHQ 1;  1Y8C A;  3IFU A;  2PK7 A;  3S17 I;  2F4O A;  2JIO A;  3G4S 1;  2E9H A;  5FLX b;  3PO3 S;  1YIT Z;  1K73 1;  2H85 A;  2YU9 I;  1YUK A;  3NFZ A;  2K3R A;  2NVY I;  3I55 1;  1Z02 A;  1KD1 1;  1FDI A;  4RVF A;  5A2Q b;  1NUI A;  2IZ4 A;  3JAM f;  2QLV B;  1VQ9 Z;  1VQ9 1;  2QA4 1;  3CCU Z;  2W04 A;  3IF8 A;  1RLY A;  5T67 A;  3CCU 1;  1VQK Z;  5FLM I;  2DE7 A;  3HOW I;  3BG1 B;  3RZD I;  1N8R 1;  1YJN Z;  1S72 1;  3CMA 1;  2V8K A;  4NBD A;  1YJN 1;  4NOZ A;  3CQZ I;  1RNI A;  1S7M A;  3S2D I;  3T4N B;  4A3L I;  1VLA A;  2EGT A;  4E33 A;  3GKQ A;  4A3J I;  4BBS I;  1YI2 Z;  1JJ2 Y;  2RBL A;  2RPR A;  2JR6 A;  3VMI A;  1YIJ Z;  4BXX I;  3G6E 1;  5FLX f;  4A3G I;  3CPW Z;  2PMZ A;  1SFO I;  3VMG A;  3GTL I;  2DE6 A;  4E2Z A;  3HOU I;  4MRI A;  4MD7 A;  2M6N A;  3QWU A;  3M4O I;  5D1P A;  4NBH A;  3PO3 I;  3HKZ A;  3CCM Z;  2OTL Z;  4NH1 C;  1M90 1;  4HGZ A;  2VPZ A;  2K5R A;  4NFR A;  5CM2 M;  5AN9 F;  4A3C I;  3NH8 A;  3U50 C;  2QRE B;  2GU2 A;  2JA8 I;  3HOV I;  2QRC B;  2M48 A;  2PM9 A;  2DE5 A;  4QTU A;  1ZB9 A;  3HOX I;  3CPW Y;  1VQ4 Z;  1X3Z A;  4NBF A;  1Q82 2;  1Z01 A;  2V8J A;  4Y52 I;  2KPI A;  1ZH1 A;  3KIF A;  3ESW A;  3FQQ A;  1WW9 A;  2JA7 I;  3P5J B;  3MON A;  3NH5 A;  3CD6 Z;  3CCE Z;  4A3E I;  3FKI I;  3CC2 1;  5IP7 I;  1VQ7 Z;  2JIM A;  1VQ7 1;  2R7Z I;  2RHB A;  2QEX 1;  3MZL B;  1NJI 1;  1N8R 2;  2F4M A;  3G4S Z;  1QVF Y;  1RO4 A;  3NDJ A;  4RVG A;  3I55 Z;  3KIH A;  1Q82 1;  2ZAE B;  1M1K 2;  1RO0 A;  2Y0S A;  2IV2 X;  1YJ9 1;  4NBG A;  4HH4 A;  3Q87 A;  1KC8 1;  1Q81 2;  3VB9 A;  2JNY A;  2QA4 Z;  3H3V J;  4CL1 A;  2VF1 A;  3OW2 Z;  3S1Q I;  1JJ2 Z;  1VQ6 1;  2JIR A;  3G71 1;  3GTK I;  2Q4Z A;  2W03 A;  3VTN A;  2BJO A;  3CME Z;  1DL6 A;  3CME 1;  1VQL 1;  3S1N I;  1VQO 1;  4RS4 A;  4X6A I;  2AYD A;  1S72 Z;  3CMA Z;  4NBC A;  2HF1 A;  5T6B A;  4E30 A;  4E2Y A;  3CCQ Z;  2B63 I;  3CCQ 1;  2OTJ 1;  1K8A 2;  2Q51 A;  1Q7Y 1;  4TNU A;  1M1K 1;  4BBR I;  4DK1 A;  4QTT A;  2VUM I;  1AA6 A;  4A3F I;  1Q81 1;  1M90 2;  3EED A;  2VPY A;  2AKL A;  3OW2 Y;  3D2L A;  4NBE A;  3F3F C;  3D9X A;  2KI7 B;  3J81 b;  3CCL 1;  3G6E Z;  1WZN A;  3IR7 A;  2E2I I;  4DQY B;  2GTI A;  1Y1V S;  3CCV Z;  4XX2 A;  1VQ8 1;  1K8A 1;  5A2Q f;  3CCV 1;  1I6H I;  3S1R I;  2NVQ I;  1TWC I;  5C3E I;  1WJ2 A;  3CXC Z;  4A3D I;  3J80 b;  5C44 I;  3CC7 Z;  2OOY B;  4S1T A;  1ML8 A;  2VUG A;  3CC7 1;  4A3B I;  2NVT I;  1NJI 2;  1I3Q I;  3CCS 1;  3GTJ I;  1QVF Z;  3J7A 4;  1VQP 1;  5T64 A;  1KQS Y;  3JAM b;  3I56 Z; 
#chains in the Genus database with same CATH homology
 4NB9 A;  1TWA I;  2V8I A;  1Y1W I;  3I56 1;  1KC8 2;  3CCR Z;  2G2K A;  1WII A;  3CCR 1;  2GTH A;  3CCJ 1;  3CXC Y;  3GTO I;  3NH4 A;  1VQM 1;  2IZ3 A;  3CC2 Z;  3TE5 B;  1USP A;  3D6W A;  3LUS A;  3TDH B;  2NVX I;  2QEX Z;  1YUA A;  3GTG I;  4NBA A;  5LL6 f;  3RZO I;  1Q86 2;  4EWC A;  1QF8 A;  3I4M I;  2RIQ A;  3EER A;  1R9T I;  1Q7Y 2;  3I07 A;  4A3M I;  1YJ9 Z;  1TWF I;  1W2B Y;  1QVG Y;  1I50 I;  3S15 I;  3GCF A;  1VQ6 Z;  3G71 Z;  3S2H I;  1K9M 1;  4RV9 A;  1VQL Z;  1VQO Z;  3HOY I;  3M3Y I;  1YIT 1;  1YJW Z;  3GTM S;  1N2F A;  2QKD A;  1X0T A;  3PO2 I;  1YJW 1;  1Q86 1;  4BY1 I;  2JMO A;  2OTJ Z;  2O53 A;  4MON A;  4MD9 A;  4MXU A;  2HU9 A;  5C4J I;  2E2J I;  1NP6 A;  4E2X A;  1VQK 1;  4MD8 A;  3HOZ I;  4A3K I;  1KRL A;  2R92 I;  4HGY A;  1LQL A;  2J6A A;  2JS4 A;  3F3P C;  3S16 I;  3CCL Z;  2WAQ A;  3H0G I;  5D1O B;  3NDI A;  2QRD B;  4NB8 A;  4NBB A;  2R93 I;  1JWH C;  4E2W A;  1USP B;  2RT9 A;  4A93 I;  2P3Y A;  4MH4 A;  3I4N I;  3K7A I;  1VQ8 Z;  1KQS Z;  1P9N A;  2LIY A;  2OZK A;  4RVH A;  3S1M I;  1TFI A;  3VMH A;  4DGL A;  1YI2 1;  3FQM A;  5IT9 b;  1TWH I;  2JA5 I;  4BY7 I;  2WB1 A;  1ZB8 A;  5C4X I;  4A3I I;  1YIJ 1;  2I3C A;  3IX0 A;  1PFT A;  3GTQ I;  3CCS Z;  4AYB A;  2LFU A;  1VQP Z;  2E2H I;  3GTM I;  4E31 A;  3CC4 Z;  3CCM 1;  2OTL 1;  3CC4 1;  1W2B Z;  1QVG Z;  1VQN Z;  1TWG I;  1QYP A;  2O4H A;  3CCJ Z;  4E32 A;  1VQN 1;  3MZK B;  1VQM Z;  4Y7N I;  5D1O A;  2JUB A;  2OOX B;  3BG0 B;  1K9M 2;  3J81 f;  2R6M A;  1WCM I;  1K73 2;  2P28 A;  1VQ4 1;  5IP9 I;  1KD1 2;  3GTP I;  2YAD A;  1X3W A;  3S14 I;  3CD6 1;  2QR1 B;  1K83 I;  1RQF A;  3CCE 1;  1Y1V I;  5IT9 f;  1RO2 A;  2JA6 I;  1Z03 A;  3J80 f;  1VQ5 Z;  1YHQ Z;  1L1O C;  1VQ5 1;  4RVD A;  1YHQ 1;  3IFU A;  2PK7 A;  3S17 I;  2F4O A;  3G4S 1;  2E9H A;  5FLX b;  3PO3 S;  1YIT Z;  1K73 1;  2H85 A;  2YU9 I;  1YUK A;  3NFZ A;  2K3R A;  2NVY I;  3I55 1;  1Z02 A;  1KD1 1;  4RVF A;  5A2Q b;  1NUI A;  2IZ4 A;  3JAM f;  2QLV B;  1VQ9 Z;  1VQ9 1;  2QA4 1;  3CCU Z;  2W04 A;  3IF8 A;  1RLY A;  5T67 A;  3CCU 1;  1VQK Z;  5FLM I;  2DE7 A;  3HOW I;  3BG1 B;  3RZD I;  1N8R 1;  1YJN Z;  1S72 1;  3CMA 1;  2V8K A;  4NBD A;  1YJN 1;  4NOZ A;  3CQZ I;  1RNI A;  1S7M A;  3S2D I;  3T4N B;  4A3L I;  1VLA A;  2EGT A;  4E33 A;  3GKQ A;  4A3J I;  4BBS I;  1YI2 Z;  1JJ2 Y;  2RBL A;  2RPR A;  2JR6 A;  3VMI A;  1YIJ Z;  4BXX I;  3G6E 1;  5FLX f;  4A3G I;  3CPW Z;  2PMZ A;  1SFO I;  3VMG A;  3GTL I;  2DE6 A;  4E2Z A;  3HOU I;  4MRI A;  4MD7 A;  2M6N A;  3QWU A;  3M4O I;  5D1P A;  4NBH A;  3PO3 I;  3HKZ A;  3CCM Z;  2OTL Z;  4NH1 C;  1M90 1;  4HGZ A;  2K5R A;  4NFR A;  5CM2 M;  5AN9 F;  4A3C I;  3NH8 A;  3U50 C;  2QRE B;  2GU2 A;  2JA8 I;  3HOV I;  2QRC B;  2M48 A;  2PM9 A;  2DE5 A;  4QTU A;  1ZB9 A;  3HOX I;  3CPW Y;  1VQ4 Z;  1X3Z A;  4NBF A;  1Q82 2;  1Z01 A;  2V8J A;  4Y52 I;  2KPI A;  1ZH1 A;  3KIF A;  3ESW A;  3FQQ A;  1WW9 A;  2JA7 I;  3P5J B;  3MON A;  3NH5 A;  3CD6 Z;  3CCE Z;  4A3E I;  3FKI I;  3CC2 1;  5IP7 I;  1VQ7 Z;  1VQ7 1;  2R7Z I;  2RHB A;  2QEX 1;  3MZL B;  1NJI 1;  1N8R 2;  2F4M A;  3G4S Z;  1QVF Y;  1RO4 A;  3NDJ A;  4RVG A;  3I55 Z;  3KIH A;  1Q82 1;  2ZAE B;  1M1K 2;  1RO0 A;  2Y0S A;  1YJ9 1;  4NBG A;  4HH4 A;  3Q87 A;  1KC8 1;  1Q81 2;  3VB9 A;  2JNY A;  2QA4 Z;  3H3V J;  4CL1 A;  2VF1 A;  3OW2 Z;  3S1Q I;  1JJ2 Z;  1VQ6 1;  3G71 1;  3GTK I;  2Q4Z A;  2W03 A;  3VTN A;  2BJO A;  3CME Z;  1DL6 A;  3CME 1;  1VQL 1;  3S1N I;  1VQO 1;  4RS4 A;  4X6A I;  1S72 Z;  3CMA Z;  4NBC A;  2HF1 A;  5T6B A;  4E30 A;  4E2Y A;  3CCQ Z;  2B63 I;  3CCQ 1;  2OTJ 1;  1K8A 2;  2Q51 A;  1Q7Y 1;  4TNU A;  1M1K 1;  4BBR I;  4DK1 A;  4QTT A;  2VUM I;  4A3F I;  1Q81 1;  1M90 2;  3EED A;  2AKL A;  3OW2 Y;  4NBE A;  3F3F C;  3D9X A;  2KI7 B;  3J81 b;  3CCL 1;  3G6E Z;  2E2I I;  4DQY B;  2GTI A;  1Y1V S;  3CCV Z;  4XX2 A;  1VQ8 1;  1K8A 1;  5A2Q f;  3CCV 1;  1I6H I;  3S1R I;  2NVQ I;  1TWC I;  5C3E I;  3CXC Z;  4A3D I;  3J80 b;  5C44 I;  3CC7 Z;  2OOY B;  4S1T A;  1ML8 A;  2VUG A;  3CC7 1;  4A3B I;  2NVT I;  1NJI 2;  1I3Q I;  3CCS 1;  3GTJ I;  1QVF Z;  3J7A 4;  1VQP 1;  5T64 A;  1KQS Y;  3JAM b;  3I56 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...