3JAMb

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
81
structure length
81
Chain Sequence
VLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 7
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3jamb00
3JAMb 5IT9b 5LL6f 5A2Qb 3J81b 3J7A4 3J80b 5FLXb
chains in the Genus database with same CATH superfamily
2GTHA 3VB9A 1AA6A 1K9M2 3G4S1 4E30A 3G71Z 2IZ4A 4MONA 3J81b 2OTJZ 1PFTA 4MRIA 4A3MI 1VQ8Z 2V8IA 1TFIA 3HOVI 3EERA 3TDHB 1K8A2 3CCJ1 1Y8CA 5A2Qf 2Q4ZA 2F4OA 5D1OB 3T4NB 2JIOA 3I55Z 2OOYB 2LFUA 2K5RA 3CC21 2VPYA 4NBCA 2QREB 4A3II 1VQPZ 2YU9I 1VQ71 4NFRA 4A3DI 4NBHA 4MD9A 1VQKZ 3IR7A 3CXCZ 2YADA 2J6AA 4RV9A 2JA6I 2PK7A 3S16I 2VPWA 1FDIA 1NUIA 2AKLA 5D1PA 1USPB 2Q51A 3VMGA 1YJN1 2V45A 1Q811 1R9TI 4A93I 4NBDA 3CCVZ 1Z02A 1VQ4Z 3RZDI 2JIRA 1QXFA 2QRCB 4RS4A 3CC71 2IZ3A 3CCL1 1RQFA 3S15I 3F3FC 4MD8A 3CCS1 1QVFZ 2JIMA 2E2HI 1RNIA 3HOYI 4TNUA 1Q812 4DK1A 1YJ9Z 5IT9b 3QWUA 2R6MA 3J7A4 4EWCA 3CCQ1 1I50I 2I3CA 5D1OA 3GKQA 3PO3S 4E2YA 1JWHC 4NB9A 3RZOI 3M4OI 1Y1VI 2DE6A 3GTOI 2JUBA 3Q87A 2WAQA 3GTMI 1TWAI 1VQO1 1YITZ 4DQYB 2RBLA 2NVXI 1TWCI 3HKZA 2EGTA 4NBAA 5FLXf 1SFOI 3CCMZ 3CPWZ 1VQ9Z 3IFUA 3CME1 1YHQZ 2E2II 1USPA 2HF1A 1VQ51 3GTQI 5C4JI 1JJ2Z 1S721 5C3EI 2JA5I 2JIPA 3OW2Y 1YIJZ 3CC4Z 3I4MI 2KPIA 1VQLZ 1K731 4A3GI 2GTIA 1P9NA 1ZB9A 1VQNZ 3CD6Z 3I07A 3G711 3TE5B 1YI2Z 1VQ81 4CL1A 4A3LI 2OOXB 3H3VJ 1K732 1DL6A 2NVQI 4E2ZA 2OTL1 2PM9A 2R92I 1Q821 3I56Z 2JS4A 2KI7B 1TWGI 3P5JB 3G4SZ 1Q16A 4BY1I 4BXXI 1RLYA 3D6WA 3CCR1 3G6E1 5CM2M 2F4MA 1RO0A 1Q822 2RIQA 3NH8A 2VUMI 3CMA1 1YUAA 1WCMI 3CCJZ 2H85A 1VQM1 1VQ61 2R93I 3VTNA 1X3ZA 2VF1A 3CC2Z 2GU2A 5LL6f 5A2Qb 4BBSI 2WB1A 4E32A 5FLMI 1VQ7Z 2W04A 2VUGA 4E2WA 1YJ91 3MZKB 1KQSZ 1KC81 2Y0SA 2DE5A 4BBRI 2M6NA 2AYDA 3HOZI 3S1MI 3S2DI 2E9HA 3CXCY 5T64A 3IF8A 4Y7NI 2JMOA 2QR1B 2E2JI 3NH5A 3K7AI 1YJNZ 3S14I 1RO4A 2VPXA 2W03A 4A3FI 3JAMf 2O4HA 2QA4Z 4NOZA 3CCLZ 3CC7Z 1S7MA 3J80f 4HGZA 1YJW1 1KC82 4BY7I 5T67A 1QVGZ 1W2BZ 3CCSZ 3KIHA 3NH4A 3CCM1 1M1K1 2JA8I 5C44I 1QVFY 4RVFA 4E31A 2QEX1 3CCE1 3CCQZ 1WZNA 1NJI1 3S1QI 4NBBA 1QF8A 1FDOA 1ZB8A 3GTJI 3PO2I 1Q861 4MH4A 3CC41 3EEDA 3IX0A 1M901 2LIYA 3D2LA 1M1K2 4NB8A 2O53A 1VQOZ 2ZAEB 4A3EI 2DE7A 3NDIA 4RVDA 1I3QI 2K3RA 3J81f 1NJI2 3S1NI 2RHBA 2OTJ1 3CMEZ 5FLXb 3S2HI 3CPWY 1M902 1ZH1A 1VQ5Z 1S72Z 2P28A 3I551 3GCFA 3PO3I 2E7ZA 2PMZA 1JJ2Y 1VQP1 3LUSA 3H0GI 3I4NI 3MONA 3CCUZ 2NAPA 2B63I 3HOUI 1X0TA 2VPZA 4X6AI 4QTTA 2IV2X 2JR6A 1VQK1 3GTKI 2OZKA 2NVYI 1YUKA 1Y1VS 1K83I 2V8JA 3CCV1 2OTLZ 1VQ41 3GTMS 3GTLI 2R7ZI 2V8KA 3U50C 5C4XI 3FKII 4NBGA 5IT9f 3KIFA 4MXUA 5T6BA 2V3VA 3GTGI 4A3KI 1WIIA 3CCRZ 4NBEA 4HH4A 3G6EZ 5IP9I 1QYPA 2JNYA 2RT9A 3CMAZ 1Z01A 2JIQA 1VQMZ 1VQ6Z 5AN9F 2HU9A 2QLVB 4QTUA 2NVTI 4Y52I 4A3CI 1TWHI 2QKDA 2QA41 2M48A 3NFZA 1TWFI 3S1RI 1I6HI 1YIT1 2P3YA 3F3PC 1KRLA 1ML8A 4A3BI 4MD7A 4NH1C 4DGLA 3M3YI 1VQ91 4A3JI 2QRDB 1YHQ1 1Z03A 1LQLA 1Y1WI 1VLAA 1N8R1 3CQZI 2RPRA 1X3WA 3FQQA 3MZLB 3OW2Z 1KQSY 4RVHA 3HOWI 2LEXA 3VMHA 4S1TA 2G2KA 1YIJ1 4RVGA 1VQL1 3GTPI 1RO2A 1Q7Y1 4AYBA 3FQMA 1VQN1 3S17I 1YJWZ 3JAMb 3NDJA 3CD61 1N8R2 3BG1B 4HGYA 3J80b 1KD11 1YI21 1QVGY 1W2BY 4E33A 5IP7I 2QEXZ 3CCEZ 3D9XA 1Q862 1WJ2A 4E2XA 1N2FA 2BJOA 3ESWA 1SIWA 1K9M1 1Q7Y2 3HOXI 1NP6A 2JA7I 4NBFA 1WW9A 1L1OC 1K8A1 1KD12 3I561 4XX2A 3CCU1 3BG0B 3VMIA
chains in the Genus database with same CATH topology
2GTHA 3VB9A 1K9M2 3G4S1 4E30A 3G71Z 2IZ4A 4MONA 3J81b 2OTJZ 1PFTA 4MRIA 4A3MI 1VQ8Z 2V8IA 1TFIA 3HOVI 3EERA 3TDHB 1K8A2 3CCJ1 5A2Qf 2Q4ZA 2F4OA 5D1OB 3T4NB 3I55Z 2OOYB 2LFUA 2K5RA 3CC21 4NBCA 2QREB 4A3II 1VQPZ 2YU9I 1VQ71 4NFRA 4A3DI 4NBHA 4MD9A 1VQKZ 3CXCZ 2YADA 2J6AA 4RV9A 2JA6I 2PK7A 3S16I 1NUIA 2AKLA 5D1PA 1USPB 2Q51A 3VMGA 1YJN1 1Q811 1R9TI 4A93I 4NBDA 3CCVZ 1Z02A 1VQ4Z 3RZDI 2QRCB 4RS4A 3CC71 2IZ3A 3CCL1 1RQFA 3S15I 3F3FC 4MD8A 3CCS1 1QVFZ 2E2HI 1RNIA 3HOYI 4TNUA 1Q812 4DK1A 1YJ9Z 5IT9b 3QWUA 2R6MA 3J7A4 4EWCA 3CCQ1 1I50I 2I3CA 5D1OA 3GKQA 3PO3S 4E2YA 1JWHC 4NB9A 3RZOI 3M4OI 1Y1VI 2DE6A 3GTOI 2JUBA 3Q87A 2WAQA 3GTMI 1TWAI 1VQO1 1YITZ 4DQYB 2RBLA 2NVXI 1TWCI 3HKZA 2EGTA 4NBAA 5FLXf 1SFOI 3CCMZ 3CPWZ 1VQ9Z 3IFUA 3CME1 1YHQZ 2E2II 1USPA 2HF1A 1VQ51 3GTQI 5C4JI 1JJ2Z 1S721 5C3EI 2JA5I 3OW2Y 1YIJZ 3CC4Z 3I4MI 2KPIA 1VQLZ 1K731 4A3GI 2GTIA 1P9NA 1ZB9A 1VQNZ 3CD6Z 3I07A 3G711 3TE5B 1YI2Z 1VQ81 4CL1A 4A3LI 2OOXB 3H3VJ 1K732 1DL6A 2NVQI 4E2ZA 2OTL1 2PM9A 2R92I 1Q821 3I56Z 2JS4A 2KI7B 1TWGI 3P5JB 3G4SZ 4BY1I 4BXXI 1RLYA 3D6WA 3CCR1 3G6E1 5CM2M 2F4MA 1RO0A 1Q822 2RIQA 3NH8A 2VUMI 3CMA1 1YUAA 1WCMI 3CCJZ 2H85A 1VQM1 1VQ61 2R93I 3VTNA 1X3ZA 2VF1A 2GU2A 5LL6f 5A2Qb 3CC2Z 4BBSI 2WB1A 4E32A 5FLMI 1VQ7Z 2W04A 2VUGA 4E2WA 1YJ91 3MZKB 1KQSZ 1KC81 2Y0SA 2DE5A 4BBRI 2M6NA 3HOZI 3S1MI 3S2DI 2E9HA 3CXCY 5T64A 3IF8A 4Y7NI 2JMOA 2QR1B 2E2JI 3NH5A 3K7AI 1YJNZ 3S14I 1RO4A 2W03A 4A3FI 3JAMf 2O4HA 2QA4Z 4NOZA 3CCLZ 3CC7Z 1S7MA 3J80f 4HGZA 1YJW1 1KC82 4BY7I 5T67A 1QVGZ 1W2BZ 3CCSZ 3KIHA 3NH4A 3CCM1 1M1K1 2JA8I 5C44I 1QVFY 4RVFA 4E31A 2QEX1 3CCE1 3CCQZ 1NJI1 3S1QI 4NBBA 1QF8A 1ZB8A 3GTJI 3PO2I 1Q861 4MH4A 3CC41 3EEDA 3IX0A 1M901 2LIYA 1M1K2 4NB8A 2O53A 1VQOZ 2ZAEB 4A3EI 2DE7A 3NDIA 4RVDA 1I3QI 2K3RA 3J81f 1NJI2 3S1NI 2RHBA 2OTJ1 3CMEZ 5FLXb 3S2HI 3CPWY 1M902 1ZH1A 1VQ5Z 1S72Z 2P28A 3I551 3GCFA 3PO3I 2PMZA 1JJ2Y 1VQP1 3LUSA 3H0GI 3I4NI 3MONA 3CCUZ 2B63I 3HOUI 1X0TA 4X6AI 4QTTA 2JR6A 1VQK1 3GTKI 2OZKA 2NVYI 1YUKA 1Y1VS 1K83I 2V8JA 3CCV1 2OTLZ 1VQ41 3GTMS 3GTLI 2R7ZI 2V8KA 3U50C 5C4XI 3FKII 4NBGA 5IT9f 3KIFA 4MXUA 5T6BA 3GTGI 4A3KI 1WIIA 3CCRZ 4NBEA 4HH4A 3G6EZ 5IP9I 1QYPA 2JNYA 2RT9A 3CMAZ 1Z01A 1VQMZ 1VQ6Z 5AN9F 2HU9A 2QLVB 4QTUA 2NVTI 4Y52I 4A3CI 1TWHI 2QKDA 2QA41 2M48A 3NFZA 1TWFI 3S1RI 1I6HI 1YIT1 2P3YA 3F3PC 1KRLA 1ML8A 4A3BI 4MD7A 4NH1C 4DGLA 3M3YI 1VQ91 4A3JI 2QRDB 1YHQ1 1Z03A 1LQLA 1Y1WI 1VLAA 1N8R1 3CQZI 2RPRA 1X3WA 3FQQA 3MZLB 3OW2Z 1KQSY 4RVHA 3HOWI 3VMHA 4S1TA 2G2KA 1YIJ1 4RVGA 1VQL1 3GTPI 1RO2A 1Q7Y1 4AYBA 3FQMA 1VQN1 3S17I 1YJWZ 3JAMb 3NDJA 3CD61 1N8R2 3BG1B 4HGYA 3J80b 1KD11 1YI21 1QVGY 1W2BY 4E33A 5IP7I 2QEXZ 3CCEZ 3D9XA 1Q862 4E2XA 1N2FA 2BJOA 3ESWA 1K9M1 1Q7Y2 3HOXI 1NP6A 2JA7I 4NBFA 1WW9A 1L1OC 1K8A1 1KD12 3I561 4XX2A 3CCU1 3BG0B 3VMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM b;  5IT9 b;  5LL6 f;  5A2Q b;  3J81 b;  3J7A 4;  3J80 b;  5FLX b; 
#chains in the Genus database with same CATH topology
 2GTH A;  3VB9 A;  1AA6 A;  1K9M 2;  3G4S 1;  4E30 A;  3G71 Z;  2IZ4 A;  4MON A;  3J81 b;  2OTJ Z;  1PFT A;  4MRI A;  4A3M I;  1VQ8 Z;  2V8I A;  1TFI A;  3HOV I;  3EER A;  3TDH B;  1K8A 2;  3CCJ 1;  1Y8C A;  5A2Q f;  2Q4Z A;  2F4O A;  5D1O B;  3T4N B;  2JIO A;  3I55 Z;  2OOY B;  2LFU A;  2K5R A;  3CC2 1;  2VPY A;  4NBC A;  2QRE B;  4A3I I;  1VQP Z;  2YU9 I;  1VQ7 1;  4NFR A;  4A3D I;  4NBH A;  4MD9 A;  1VQK Z;  3IR7 A;  3CXC Z;  2YAD A;  2J6A A;  4RV9 A;  2JA6 I;  2PK7 A;  3S16 I;  2VPW A;  1FDI A;  1NUI A;  2AKL A;  5D1P A;  1USP B;  2Q51 A;  3VMG A;  1YJN 1;  2V45 A;  1Q81 1;  1R9T I;  4A93 I;  4NBD A;  3CCV Z;  1Z02 A;  1VQ4 Z;  3RZD I;  2JIR A;  1QXF A;  2QRC B;  4RS4 A;  3CC7 1;  2IZ3 A;  3CCL 1;  1RQF A;  3S15 I;  3F3F C;  4MD8 A;  3CCS 1;  1QVF Z;  2JIM A;  2E2H I;  1RNI A;  3HOY I;  4TNU A;  1Q81 2;  4DK1 A;  1YJ9 Z;  5IT9 b;  3QWU A;  2R6M A;  3J7A 4;  4EWC A;  3CCQ 1;  1I50 I;  2I3C A;  5D1O A;  3GKQ A;  3PO3 S;  4E2Y A;  1JWH C;  4NB9 A;  3RZO I;  3M4O I;  1Y1V I;  2DE6 A;  3GTO I;  2JUB A;  3Q87 A;  2WAQ A;  3GTM I;  1TWA I;  1VQO 1;  1YIT Z;  4DQY B;  2RBL A;  2NVX I;  1TWC I;  3HKZ A;  2EGT A;  4NBA A;  5FLX f;  1SFO I;  3CCM Z;  3CPW Z;  1VQ9 Z;  3IFU A;  3CME 1;  1YHQ Z;  2E2I I;  1USP A;  2HF1 A;  1VQ5 1;  3GTQ I;  5C4J I;  1JJ2 Z;  1S72 1;  5C3E I;  2JA5 I;  2JIP A;  3OW2 Y;  1YIJ Z;  3CC4 Z;  3I4M I;  2KPI A;  1VQL Z;  1K73 1;  4A3G I;  2GTI A;  1P9N A;  1ZB9 A;  1VQN Z;  3CD6 Z;  3I07 A;  3G71 1;  3TE5 B;  1YI2 Z;  1VQ8 1;  4CL1 A;  4A3L I;  2OOX B;  3H3V J;  1K73 2;  1DL6 A;  2NVQ I;  4E2Z A;  2OTL 1;  2PM9 A;  2R92 I;  1Q82 1;  3I56 Z;  2JS4 A;  2KI7 B;  1TWG I;  3P5J B;  3G4S Z;  1Q16 A;  4BY1 I;  4BXX I;  1RLY A;  3D6W A;  3CCR 1;  3G6E 1;  5CM2 M;  2F4M A;  1RO0 A;  1Q82 2;  2RIQ A;  3NH8 A;  2VUM I;  3CMA 1;  1YUA A;  1WCM I;  3CCJ Z;  2H85 A;  1VQM 1;  1VQ6 1;  2R93 I;  3VTN A;  1X3Z A;  2VF1 A;  3CC2 Z;  2GU2 A;  5LL6 f;  5A2Q b;  4BBS I;  2WB1 A;  4E32 A;  5FLM I;  1VQ7 Z;  2W04 A;  2VUG A;  4E2W A;  1YJ9 1;  3MZK B;  1KQS Z;  1KC8 1;  2Y0S A;  2DE5 A;  4BBR I;  2M6N A;  2AYD A;  3HOZ I;  3S1M I;  3S2D I;  2E9H A;  3CXC Y;  5T64 A;  3IF8 A;  4Y7N I;  2JMO A;  2QR1 B;  2E2J I;  3NH5 A;  3K7A I;  1YJN Z;  3S14 I;  1RO4 A;  2VPX A;  2W03 A;  4A3F I;  3JAM f;  2O4H A;  2QA4 Z;  4NOZ A;  3CCL Z;  3CC7 Z;  1S7M A;  3J80 f;  4HGZ A;  1YJW 1;  1KC8 2;  4BY7 I;  5T67 A;  1QVG Z;  1W2B Z;  3CCS Z;  3KIH A;  3NH4 A;  3CCM 1;  1M1K 1;  2JA8 I;  5C44 I;  1QVF Y;  4RVF A;  4E31 A;  2QEX 1;  3CCE 1;  3CCQ Z;  1WZN A;  1NJI 1;  3S1Q I;  4NBB A;  1QF8 A;  1FDO A;  1ZB8 A;  3GTJ I;  3PO2 I;  1Q86 1;  4MH4 A;  3CC4 1;  3EED A;  3IX0 A;  1M90 1;  2LIY A;  3D2L A;  1M1K 2;  4NB8 A;  2O53 A;  1VQO Z;  2ZAE B;  4A3E I;  2DE7 A;  3NDI A;  4RVD A;  1I3Q I;  2K3R A;  3J81 f;  1NJI 2;  3S1N I;  2RHB A;  2OTJ 1;  3CME Z;  5FLX b;  3S2H I;  3CPW Y;  1M90 2;  1ZH1 A;  1VQ5 Z;  1S72 Z;  2P28 A;  3I55 1;  3GCF A;  3PO3 I;  2E7Z A;  2PMZ A;  1JJ2 Y;  1VQP 1;  3LUS A;  3H0G I;  3I4N I;  3MON A;  3CCU Z;  2NAP A;  2B63 I;  3HOU I;  1X0T A;  2VPZ A;  4X6A I;  4QTT A;  2IV2 X;  2JR6 A;  1VQK 1;  3GTK I;  2OZK A;  2NVY I;  1YUK A;  1Y1V S;  1K83 I;  2V8J A;  3CCV 1;  2OTL Z;  1VQ4 1;  3GTM S;  3GTL I;  2R7Z I;  2V8K A;  3U50 C;  5C4X I;  3FKI I;  4NBG A;  5IT9 f;  3KIF A;  4MXU A;  5T6B A;  2V3V A;  3GTG I;  4A3K I;  1WII A;  3CCR Z;  4NBE A;  4HH4 A;  3G6E Z;  5IP9 I;  1QYP A;  2JNY A;  2RT9 A;  3CMA Z;  1Z01 A;  2JIQ A;  1VQM Z;  1VQ6 Z;  5AN9 F;  2HU9 A;  2QLV B;  4QTU A;  2NVT I;  4Y52 I;  4A3C I;  1TWH I;  2QKD A;  2QA4 1;  2M48 A;  3NFZ A;  1TWF I;  3S1R I;  1I6H I;  1YIT 1;  2P3Y A;  3F3P C;  1KRL A;  1ML8 A;  4A3B I;  4MD7 A;  4NH1 C;  4DGL A;  3M3Y I;  1VQ9 1;  4A3J I;  2QRD B;  1YHQ 1;  1Z03 A;  1LQL A;  1Y1W I;  1VLA A;  1N8R 1;  3CQZ I;  2RPR A;  1X3W A;  3FQQ A;  3MZL B;  3OW2 Z;  1KQS Y;  4RVH A;  3HOW I;  2LEX A;  3VMH A;  4S1T A;  2G2K A;  1YIJ 1;  4RVG A;  1VQL 1;  3GTP I;  1RO2 A;  1Q7Y 1;  4AYB A;  3FQM A;  1VQN 1;  3S17 I;  1YJW Z;  3JAM b;  3NDJ A;  3CD6 1;  1N8R 2;  3BG1 B;  4HGY A;  3J80 b;  1KD1 1;  1YI2 1;  1QVG Y;  1W2B Y;  4E33 A;  5IP7 I;  2QEX Z;  3CCE Z;  3D9X A;  1Q86 2;  1WJ2 A;  4E2X A;  1N2F A;  2BJO A;  3ESW A;  1SIW A;  1K9M 1;  1Q7Y 2;  3HOX I;  1NP6 A;  2JA7 I;  4NBF A;  1WW9 A;  1L1O C;  1K8A 1;  1KD1 2;  3I56 1;  4XX2 A;  3CCU 1;  3BG0 B;  3VMI A; 
#chains in the Genus database with same CATH homology
 2GTH A;  3VB9 A;  1K9M 2;  3G4S 1;  4E30 A;  3G71 Z;  2IZ4 A;  4MON A;  3J81 b;  2OTJ Z;  1PFT A;  4MRI A;  4A3M I;  1VQ8 Z;  2V8I A;  1TFI A;  3HOV I;  3EER A;  3TDH B;  1K8A 2;  3CCJ 1;  5A2Q f;  2Q4Z A;  2F4O A;  5D1O B;  3T4N B;  3I55 Z;  2OOY B;  2LFU A;  2K5R A;  3CC2 1;  4NBC A;  2QRE B;  4A3I I;  1VQP Z;  2YU9 I;  1VQ7 1;  4NFR A;  4A3D I;  4NBH A;  4MD9 A;  1VQK Z;  3CXC Z;  2YAD A;  2J6A A;  4RV9 A;  2JA6 I;  2PK7 A;  3S16 I;  1NUI A;  2AKL A;  5D1P A;  1USP B;  2Q51 A;  3VMG A;  1YJN 1;  1Q81 1;  1R9T I;  4A93 I;  4NBD A;  3CCV Z;  1Z02 A;  1VQ4 Z;  3RZD I;  2QRC B;  4RS4 A;  3CC7 1;  2IZ3 A;  3CCL 1;  1RQF A;  3S15 I;  3F3F C;  4MD8 A;  3CCS 1;  1QVF Z;  2E2H I;  1RNI A;  3HOY I;  4TNU A;  1Q81 2;  4DK1 A;  1YJ9 Z;  5IT9 b;  3QWU A;  2R6M A;  3J7A 4;  4EWC A;  3CCQ 1;  1I50 I;  2I3C A;  5D1O A;  3GKQ A;  3PO3 S;  4E2Y A;  1JWH C;  4NB9 A;  3RZO I;  3M4O I;  1Y1V I;  2DE6 A;  3GTO I;  2JUB A;  3Q87 A;  2WAQ A;  3GTM I;  1TWA I;  1VQO 1;  1YIT Z;  4DQY B;  2RBL A;  2NVX I;  1TWC I;  3HKZ A;  2EGT A;  4NBA A;  5FLX f;  1SFO I;  3CCM Z;  3CPW Z;  1VQ9 Z;  3IFU A;  3CME 1;  1YHQ Z;  2E2I I;  1USP A;  2HF1 A;  1VQ5 1;  3GTQ I;  5C4J I;  1JJ2 Z;  1S72 1;  5C3E I;  2JA5 I;  3OW2 Y;  1YIJ Z;  3CC4 Z;  3I4M I;  2KPI A;  1VQL Z;  1K73 1;  4A3G I;  2GTI A;  1P9N A;  1ZB9 A;  1VQN Z;  3CD6 Z;  3I07 A;  3G71 1;  3TE5 B;  1YI2 Z;  1VQ8 1;  4CL1 A;  4A3L I;  2OOX B;  3H3V J;  1K73 2;  1DL6 A;  2NVQ I;  4E2Z A;  2OTL 1;  2PM9 A;  2R92 I;  1Q82 1;  3I56 Z;  2JS4 A;  2KI7 B;  1TWG I;  3P5J B;  3G4S Z;  4BY1 I;  4BXX I;  1RLY A;  3D6W A;  3CCR 1;  3G6E 1;  5CM2 M;  2F4M A;  1RO0 A;  1Q82 2;  2RIQ A;  3NH8 A;  2VUM I;  3CMA 1;  1YUA A;  1WCM I;  3CCJ Z;  2H85 A;  1VQM 1;  1VQ6 1;  2R93 I;  3VTN A;  1X3Z A;  2VF1 A;  2GU2 A;  5LL6 f;  5A2Q b;  3CC2 Z;  4BBS I;  2WB1 A;  4E32 A;  5FLM I;  1VQ7 Z;  2W04 A;  2VUG A;  4E2W A;  1YJ9 1;  3MZK B;  1KQS Z;  1KC8 1;  2Y0S A;  2DE5 A;  4BBR I;  2M6N A;  3HOZ I;  3S1M I;  3S2D I;  2E9H A;  3CXC Y;  5T64 A;  3IF8 A;  4Y7N I;  2JMO A;  2QR1 B;  2E2J I;  3NH5 A;  3K7A I;  1YJN Z;  3S14 I;  1RO4 A;  2W03 A;  4A3F I;  3JAM f;  2O4H A;  2QA4 Z;  4NOZ A;  3CCL Z;  3CC7 Z;  1S7M A;  3J80 f;  4HGZ A;  1YJW 1;  1KC8 2;  4BY7 I;  5T67 A;  1QVG Z;  1W2B Z;  3CCS Z;  3KIH A;  3NH4 A;  3CCM 1;  1M1K 1;  2JA8 I;  5C44 I;  1QVF Y;  4RVF A;  4E31 A;  2QEX 1;  3CCE 1;  3CCQ Z;  1NJI 1;  3S1Q I;  4NBB A;  1QF8 A;  1ZB8 A;  3GTJ I;  3PO2 I;  1Q86 1;  4MH4 A;  3CC4 1;  3EED A;  3IX0 A;  1M90 1;  2LIY A;  1M1K 2;  4NB8 A;  2O53 A;  1VQO Z;  2ZAE B;  4A3E I;  2DE7 A;  3NDI A;  4RVD A;  1I3Q I;  2K3R A;  3J81 f;  1NJI 2;  3S1N I;  2RHB A;  2OTJ 1;  3CME Z;  5FLX b;  3S2H I;  3CPW Y;  1M90 2;  1ZH1 A;  1VQ5 Z;  1S72 Z;  2P28 A;  3I55 1;  3GCF A;  3PO3 I;  2PMZ A;  1JJ2 Y;  1VQP 1;  3LUS A;  3H0G I;  3I4N I;  3MON A;  3CCU Z;  2B63 I;  3HOU I;  1X0T A;  4X6A I;  4QTT A;  2JR6 A;  1VQK 1;  3GTK I;  2OZK A;  2NVY I;  1YUK A;  1Y1V S;  1K83 I;  2V8J A;  3CCV 1;  2OTL Z;  1VQ4 1;  3GTM S;  3GTL I;  2R7Z I;  2V8K A;  3U50 C;  5C4X I;  3FKI I;  4NBG A;  5IT9 f;  3KIF A;  4MXU A;  5T6B A;  3GTG I;  4A3K I;  1WII A;  3CCR Z;  4NBE A;  4HH4 A;  3G6E Z;  5IP9 I;  1QYP A;  2JNY A;  2RT9 A;  3CMA Z;  1Z01 A;  1VQM Z;  1VQ6 Z;  5AN9 F;  2HU9 A;  2QLV B;  4QTU A;  2NVT I;  4Y52 I;  4A3C I;  1TWH I;  2QKD A;  2QA4 1;  2M48 A;  3NFZ A;  1TWF I;  3S1R I;  1I6H I;  1YIT 1;  2P3Y A;  3F3P C;  1KRL A;  1ML8 A;  4A3B I;  4MD7 A;  4NH1 C;  4DGL A;  3M3Y I;  1VQ9 1;  4A3J I;  2QRD B;  1YHQ 1;  1Z03 A;  1LQL A;  1Y1W I;  1VLA A;  1N8R 1;  3CQZ I;  2RPR A;  1X3W A;  3FQQ A;  3MZL B;  3OW2 Z;  1KQS Y;  4RVH A;  3HOW I;  3VMH A;  4S1T A;  2G2K A;  1YIJ 1;  4RVG A;  1VQL 1;  3GTP I;  1RO2 A;  1Q7Y 1;  4AYB A;  3FQM A;  1VQN 1;  3S17 I;  1YJW Z;  3JAM b;  3NDJ A;  3CD6 1;  1N8R 2;  3BG1 B;  4HGY A;  3J80 b;  1KD1 1;  1YI2 1;  1QVG Y;  1W2B Y;  4E33 A;  5IP7 I;  2QEX Z;  3CCE Z;  3D9X A;  1Q86 2;  4E2X A;  1N2F A;  2BJO A;  3ESW A;  1K9M 1;  1Q7Y 2;  3HOX I;  1NP6 A;  2JA7 I;  4NBF A;  1WW9 A;  1L1O C;  1K8A 1;  1KD1 2;  3I56 1;  4XX2 A;  3CCU 1;  3BG0 B;  3VMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...