1VQ4Z

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4Z00
1YJ9Z 1VQ51 1N8R1 3G4S1 3CC71 3CCR1 2OTJZ 1KQSY 2QEX1 3I55Z 3CCQZ 1VQMZ 3CCL1 1VQPZ 3G71Z 3CCE1 1YJW1 1KD11 3CPWY 1QVGY 2QA4Z 3CC2Z 1K8A2 1K9M2 3G6EZ 3CXCZ 1YJ91 3I56Z 3CD61 3CCVZ 1KQSZ 3CCQ1 1VQM1 1K732 3G711 1JJ2Y 3CPWZ 2QA41 3G6E1 1KD12 3CCUZ 3CMAZ 1NJI2 1VQ7Z 1M1K2 1VQOZ 1S72Z 3CCV1 3OW2Y 3CCMZ 1VQKZ 1KC81 1W2BY 1Q811 1YJNZ 1Q821 1Q7Y1 3CC4Z 3CMEZ 1VQNZ 2OTJ1 1JJ2Z 3I551 1YHQZ 1N8R2 3CMA1 1VQP1 1VQ71 1VQ6Z 1QVFY 3CC21 1QVGZ 3CCM1 1VQLZ 3CC7Z 1VQK1 2OTLZ 1YJN1 1Q861 3CC41 1VQ9Z 3I561 3CME1 1KC82 3CCLZ 1YIJZ 1VQ4Z 1VQN1 1Q812 1YI2Z 1M901 1YHQ1 1Q7Y2 3CCJZ 1YITZ 1VQ61 3CXCY 1QVFZ 1VQ8Z 3CCSZ 1VQL1 1K731 3CCU1 2OTL1 3CD6Z 1VQO1 1VQ91 1YIJ1 1VQ5Z 1VQ41 1S721 1YI21 1Q862 3G4SZ 3OW2Z 3CCRZ 3CCJ1 1NJI1 1YIT1 2QEXZ 1W2BZ 1M1K1 1M902 1K8A1 1K9M1 3CCEZ 1YJWZ 1Q822 1VQ81 3CCS1
chains in the Genus database with same CATH superfamily
1RO4A 1YUAA 2R7ZI 1YJ9Z 1R9TI 3NDIA 4A3EI 2OOYB 3NH4A 3VMHA 2GU2A 3G4S1 3IFUA 3FQMA 4HGZA 2RIQA 3S17I 3EERA 1USPA 4NBAA 2QEX1 4MD8A 2Q51A 4RVDA 3CCL1 1VQPZ 1WZNA 2R6MA 3VMGA 1AA6A 1QVGY 2QA4Z 1JWHC 3CC2Z 1K9M2 3G6EZ 4A3FI 2KI7B 3CXCZ 2WB1A 2QR1B 3CD61 2DE7A 4A3JI 1RQFA 5FLXb 3JAMb 5D1PA 3HOYI 2O4HA 4NOZA 1DL6A 2KPIA 3FQQA 2V8IA 4A93I 3FKII 1KD12 1X0TA 3IF8A 4X6AI 1M1K2 1KRLA 1ML8A 2QLVB 1ZH1A 2K5RA 3OW2Y 1KC81 4BBRI 3BG0B 1Q7Y1 3CMEZ 2NVXI 3S2HI 1VQNZ 2JA5I 3IR7A 5LL6f 4NBGA 2HU9A 3GTMS 2VF1A 1Q16A 3CCM1 1VQK1 3T4NB 5IP7I 2JS4A 5C3EI 4E31A 5IT9f 1Y8CA 2JIPA 3CCLZ 3D6WA 2P3YA 1M901 1VLAA 2Q4ZA 3K7AI 2I3CA 3D9XA 3PO3I 2IV2X 3D2LA 2RT9A 2AYDA 3CD6Z 3CCSZ 3EEDA 1VQO1 1VQ91 1YIJ1 4XX2A 1VQ41 5T6BA 1S721 1Q862 3S1MI 3CCRZ 3CCJ1 3CQZI 1NJI1 2LFUA 3NFZA 4NBFA 1YIT1 4MXUA 2NAPA 1K9M1 4RVHA 1PFTA 3CCEZ 5CM2M 2VPWA 1Y1VS 2W03A 4MD9A 4CL1A 2VPYA 1VQ51 3H0GI 1Z01A 1Z02A 3CC71 1I50I 3F3FC 1RO0A 1Z03A 1LQLA 2PM9A 1QF8A 1P9NA 3G71Z 1KD11 2O53A 3IX0A 2E2HI 3GTKI 4QTTA 4S1TA 3CCVZ 4TNUA 1RO2A 3S2DI 3CCQ1 1VQM1 3NH5A 4AYBA 3HOVI 2RBLA 2JA6I 4NBDA 1JJ2Y 1K83I 1NUIA 3KIFA 3CMAZ 1NJI2 2DE5A 4NB8A 1TWGI 1VQOZ 1WCMI 1S72Z 2R93I 2JIOA 1RLYA 4HGYA 1YJNZ 3U50C 3BG1B 4A3II 2OTJ1 1JJ2Z 2JR6A 2IZ4A 3MONA 3Q87A 4BY7I 4RS4A 3F3PC 1VQ71 4NBHA 1QVFY 2RPRA 2JUBA 1QVGZ 3VB9A 2OTLZ 1USPB 3VMIA 3CC7Z 3I07A 1Q861 3CC41 3I561 1YHQ1 2JIQA 1VQ61 3GTLI 2DE6A 1QVFZ 2LIYA 3GTQI 4BBSI 1VQ8Z 1VQL1 1K731 3RZOI 3HOUI 2JMOA 2QRCB 3J80f 1YI21 5T64A 3G4SZ 3OW2Z 1TWHI 4RVGA 2V8KA 2QEXZ 5C4XI 5FLMI 2QREB 3RZDI 2NVQI 3M4OI 1TWFI 1Y1WI 4E30A 4E33A 2PK7A 5IP9I 1SIWA 1N8R1 4E2WA 1QYPA 2OTJZ 3TE5B 3QWUA 1YJW1 3S1QI 2PMZA 4NH1C 4A3MI 3CPWY 2WAQA 3J7A4 3ESWA 2JA7I 2J6AA 1YJ91 3PO2I 2GTIA 3I56Z 4MONA 3GTGI 2V3VA 1I6HI 3M3YI 1K732 5D1OA 1L1OC 3JAMf 3CPWZ 2QA41 4A3BI 1X3WA 4RVFA 3G6E1 2R92I 4NBCA 2JIRA 4QTUA 3CCMZ 1VQKZ 1W2BY 1X3ZA 2VPZA 2M6NA 2B63I 1Q821 2OOXB 5AN9F 3H3VJ 3TDHB 3J80b 3I551 1N8R2 3S16I 3KIHA 1SFOI 1RNIA 1ZB9A 4E32A 5IT9b 1TWCI 5T67A 5C4JI 2H85A 2YADA 3I4NI 4DQYB 2JA8I 1VQ9Z 3CME1 1YIJZ 4BXXI 1VQ4Z 1VQN1 1Q812 1QXFA 3CCJZ 1YITZ 4A3CI 3VTNA 3CXCY 2EGTA 2Y0SA 3HOWI 3CCU1 2RHBA 2V8JA 3MZLB 4MH4A 4NBEA 4NB9A 1VQ5Z 2VUGA 3J81f 2QKDA 3GTOI 4MD7A 2P28A 3GTMI 3NH8A 3S1NI 3NDJA 2VPXA 1Q822 3CCS1 3S15I 2E9HA 1TFIA 3I4MI 4Y7NI 2BJOA 2LEXA 3CCR1 1KQSY 5A2Qf 3I55Z 3CCQZ 1VQMZ 4HH4A 3CCE1 2YU9I 2IZ3A 2JIMA 1K8A2 3S14I 5C44I 2W04A 4A3LI 4A3GI 3GTJI 1TWAI 1KQSZ 1FDIA 3MZKB 2OZKA 4NBBA 3G711 2F4OA 2E2JI 4E2YA 3S1RI 2NVTI 4DK1A 1Y1VI 3CCUZ 1FDOA 3HKZA 1VQ7Z 2GTHA 3CCV1 1Q811 2NVYI 3CC4Z 4A3DI 4NFRA 1WJ2A 1WW9A 4BY1I 4RV9A 1YHQZ 3J81b 2M48A 3CMA1 1I3QI 1VQP1 2ZAEB 1VQ6Z 2K3RA 2JNYA 4E2ZA 2G2KA 5FLXf 3CC21 1VQLZ 1S7MA 1YJN1 2QRDB 2V45A 1KC82 3GCFA 1NP6A 3PO3S 1YI2Z 1N2FA 1ZB8A 1Q7Y2 4EWCA 4E2XA 3HOZI 2E2II 5A2Qb 2F4MA 2E7ZA 4MRIA 2OTL1 1WIIA 4A3KI 3GTPI 3HOXI 2AKLA 4DGLA 2VUMI 5D1OB 3GKQA 4Y52I 1YUKA 2HF1A 3P5JB 1W2BZ 1M1K1 1M902 1K8A1 1YJWZ 1VQ81 3LUSA
chains in the Genus database with same CATH topology
1RO4A 1YUAA 2R7ZI 1YJ9Z 1R9TI 3NDIA 4A3EI 2OOYB 3NH4A 3VMHA 2GU2A 3G4S1 3IFUA 3FQMA 4HGZA 2RIQA 3S17I 3EERA 1USPA 4NBAA 2QEX1 4MD8A 2Q51A 4RVDA 3CCL1 1VQPZ 2R6MA 3VMGA 1QVGY 2QA4Z 1JWHC 3CC2Z 1K9M2 3G6EZ 4A3FI 2KI7B 3CXCZ 2WB1A 2QR1B 3CD61 2DE7A 4A3JI 1RQFA 5FLXb 3JAMb 5D1PA 3HOYI 2O4HA 4NOZA 1DL6A 2KPIA 3FQQA 2V8IA 4A93I 3FKII 1KD12 1X0TA 3IF8A 4X6AI 1M1K2 1KRLA 1ML8A 2QLVB 1ZH1A 2K5RA 3OW2Y 1KC81 4BBRI 3BG0B 1Q7Y1 3CMEZ 2NVXI 3S2HI 1VQNZ 2JA5I 5LL6f 4NBGA 2HU9A 3GTMS 2VF1A 3CCM1 1VQK1 3T4NB 5IP7I 2JS4A 5C3EI 4E31A 5IT9f 3CCLZ 3D6WA 2P3YA 1M901 1VLAA 2Q4ZA 3K7AI 2I3CA 3D9XA 3PO3I 2RT9A 3CD6Z 3CCSZ 3EEDA 1VQO1 1VQ91 1YIJ1 4XX2A 1VQ41 5T6BA 1S721 1Q862 3S1MI 3CCRZ 3CCJ1 3CQZI 1NJI1 2LFUA 3NFZA 4NBFA 1YIT1 4MXUA 1K9M1 4RVHA 1PFTA 3CCEZ 5CM2M 1Y1VS 2W03A 4MD9A 4CL1A 1VQ51 3H0GI 1Z01A 1Z02A 3CC71 1I50I 3F3FC 1RO0A 1Z03A 1LQLA 2PM9A 1QF8A 1P9NA 3G71Z 1KD11 2O53A 3IX0A 2E2HI 3GTKI 4QTTA 4S1TA 3CCVZ 4TNUA 1RO2A 3S2DI 3CCQ1 1VQM1 3NH5A 4AYBA 3HOVI 2RBLA 2JA6I 4NBDA 1JJ2Y 1K83I 1NUIA 3KIFA 3CMAZ 1NJI2 2DE5A 4NB8A 1TWGI 1VQOZ 1WCMI 1S72Z 2R93I 4HGYA 1RLYA 1YJNZ 3U50C 3BG1B 4A3II 2OTJ1 1JJ2Z 2JR6A 2IZ4A 3MONA 3Q87A 4BY7I 4RS4A 3F3PC 1VQ71 4NBHA 1QVFY 2RPRA 2JUBA 1QVGZ 3VB9A 2OTLZ 1USPB 3VMIA 3CC7Z 3I07A 1Q861 3CC41 3I561 1YHQ1 1VQ61 3GTLI 2DE6A 1QVFZ 2LIYA 3GTQI 4BBSI 1VQ8Z 1VQL1 1K731 3RZOI 3HOUI 2JMOA 2QRCB 3J80f 1YI21 5T64A 3G4SZ 3OW2Z 1TWHI 4RVGA 2V8KA 2QEXZ 5C4XI 5FLMI 2QREB 3RZDI 2NVQI 3M4OI 1TWFI 1Y1WI 4E30A 4E33A 2PK7A 5IP9I 1N8R1 4E2WA 1QYPA 2OTJZ 3TE5B 3QWUA 1YJW1 3S1QI 2PMZA 4NH1C 4A3MI 3CPWY 2WAQA 3J7A4 3ESWA 2JA7I 2J6AA 1YJ91 3PO2I 2GTIA 3I56Z 4MONA 3GTGI 1I6HI 3M3YI 1K732 5D1OA 1L1OC 3JAMf 3CPWZ 2QA41 4A3BI 1X3WA 4RVFA 3G6E1 2R92I 4NBCA 4QTUA 3CCMZ 1VQKZ 1W2BY 1X3ZA 2M6NA 2B63I 1Q821 2OOXB 5AN9F 3H3VJ 3TDHB 3J80b 3I551 1N8R2 3S16I 3KIHA 1SFOI 1RNIA 1ZB9A 4E32A 5IT9b 1TWCI 5T67A 5C4JI 2H85A 2YADA 3I4NI 4DQYB 2JA8I 1VQ9Z 3CME1 1YIJZ 4BXXI 1VQ4Z 1VQN1 1Q812 3CCJZ 1YITZ 4A3CI 3VTNA 3CXCY 2EGTA 2Y0SA 3HOWI 3CCU1 2RHBA 2V8JA 3MZLB 4MH4A 4NBEA 4NB9A 1VQ5Z 2VUGA 3J81f 2QKDA 3GTOI 4MD7A 2P28A 3GTMI 3NH8A 3S1NI 3NDJA 1Q822 3CCS1 3S15I 2E9HA 1TFIA 3I4MI 4Y7NI 2BJOA 3CCR1 1KQSY 5A2Qf 3I55Z 3CCQZ 1VQMZ 4HH4A 3CCE1 2YU9I 2IZ3A 1K8A2 3S14I 5C44I 2W04A 4A3LI 4A3GI 3GTJI 1TWAI 1KQSZ 3MZKB 2OZKA 4NBBA 3G711 2F4OA 2E2JI 4E2YA 3S1RI 2NVTI 4DK1A 1Y1VI 3CCUZ 3HKZA 1VQ7Z 2GTHA 3CCV1 1Q811 2NVYI 3CC4Z 4A3DI 4NFRA 1WW9A 4BY1I 4RV9A 1YHQZ 3J81b 2M48A 3CMA1 1I3QI 1VQP1 2ZAEB 1VQ6Z 2K3RA 2JNYA 4E2ZA 2G2KA 5FLXf 3CC21 1VQLZ 1S7MA 1YJN1 2QRDB 1KC82 3GCFA 1NP6A 3PO3S 1YI2Z 1N2FA 1ZB8A 1Q7Y2 4EWCA 4E2XA 3HOZI 2E2II 5A2Qb 2F4MA 4MRIA 2OTL1 1WIIA 4A3KI 3GTPI 3HOXI 2AKLA 4DGLA 2VUMI 5D1OB 3GKQA 4Y52I 1YUKA 2HF1A 3P5JB 1W2BZ 1M1K1 1M902 1K8A1 1YJWZ 1VQ81 3LUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  1VQ5 1;  1N8R 1;  3G4S 1;  3CC7 1;  3CCR 1;  2OTJ Z;  1KQS Y;  2QEX 1;  3I55 Z;  3CCQ Z;  1VQM Z;  3CCL 1;  1VQP Z;  3G71 Z;  3CCE 1;  1YJW 1;  1KD1 1;  3CPW Y;  1QVG Y;  2QA4 Z;  3CC2 Z;  1K8A 2;  1K9M 2;  3G6E Z;  3CXC Z;  1YJ9 1;  3I56 Z;  3CD6 1;  3CCV Z;  1KQS Z;  3CCQ 1;  1VQM 1;  1K73 2;  3G71 1;  1JJ2 Y;  3CPW Z;  2QA4 1;  3G6E 1;  1KD1 2;  3CCU Z;  3CMA Z;  1NJI 2;  1VQ7 Z;  1M1K 2;  1VQO Z;  1S72 Z;  3CCV 1;  3OW2 Y;  3CCM Z;  1VQK Z;  1KC8 1;  1W2B Y;  1Q81 1;  1YJN Z;  1Q82 1;  1Q7Y 1;  3CC4 Z;  3CME Z;  1VQN Z;  2OTJ 1;  1JJ2 Z;  3I55 1;  1YHQ Z;  1N8R 2;  3CMA 1;  1VQP 1;  1VQ7 1;  1VQ6 Z;  1QVF Y;  3CC2 1;  1QVG Z;  3CCM 1;  1VQL Z;  3CC7 Z;  1VQK 1;  2OTL Z;  1YJN 1;  1Q86 1;  3CC4 1;  1VQ9 Z;  3I56 1;  3CME 1;  1KC8 2;  3CCL Z;  1YIJ Z;  1VQ4 Z;  1VQN 1;  1Q81 2;  1YI2 Z;  1M90 1;  1YHQ 1;  1Q7Y 2;  3CCJ Z;  1YIT Z;  1VQ6 1;  3CXC Y;  1QVF Z;  1VQ8 Z;  3CCS Z;  1VQL 1;  1K73 1;  3CCU 1;  2OTL 1;  3CD6 Z;  1VQO 1;  1VQ9 1;  1YIJ 1;  1VQ5 Z;  1VQ4 1;  1S72 1;  1YI2 1;  1Q86 2;  3G4S Z;  3OW2 Z;  3CCR Z;  3CCJ 1;  1NJI 1;  1YIT 1;  2QEX Z;  1W2B Z;  1M1K 1;  1M90 2;  1K8A 1;  1K9M 1;  3CCE Z;  1YJW Z;  1Q82 2;  1VQ8 1;  3CCS 1; 
#chains in the Genus database with same CATH topology
 1RO4 A;  1YUA A;  2R7Z I;  1YJ9 Z;  1R9T I;  3NDI A;  4A3E I;  2OOY B;  3NH4 A;  3VMH A;  2GU2 A;  3G4S 1;  3IFU A;  3FQM A;  4HGZ A;  2RIQ A;  3S17 I;  3EER A;  1USP A;  4NBA A;  2QEX 1;  4MD8 A;  2Q51 A;  4RVD A;  3CCL 1;  1VQP Z;  1WZN A;  2R6M A;  3VMG A;  1AA6 A;  1QVG Y;  2QA4 Z;  1JWH C;  3CC2 Z;  1K9M 2;  3G6E Z;  4A3F I;  2KI7 B;  3CXC Z;  2WB1 A;  2QR1 B;  3CD6 1;  2DE7 A;  4A3J I;  1RQF A;  5FLX b;  3JAM b;  5D1P A;  3HOY I;  2O4H A;  4NOZ A;  1DL6 A;  2KPI A;  3FQQ A;  2V8I A;  4A93 I;  3FKI I;  1KD1 2;  1X0T A;  3IF8 A;  4X6A I;  1M1K 2;  1KRL A;  1ML8 A;  2QLV B;  1ZH1 A;  2K5R A;  3OW2 Y;  1KC8 1;  4BBR I;  3BG0 B;  1Q7Y 1;  3CME Z;  2NVX I;  3S2H I;  1VQN Z;  2JA5 I;  3IR7 A;  5LL6 f;  4NBG A;  2HU9 A;  3GTM S;  2VF1 A;  1Q16 A;  3CCM 1;  1VQK 1;  3T4N B;  5IP7 I;  2JS4 A;  5C3E I;  4E31 A;  5IT9 f;  1Y8C A;  2JIP A;  3CCL Z;  3D6W A;  2P3Y A;  1M90 1;  1VLA A;  2Q4Z A;  3K7A I;  2I3C A;  3D9X A;  3PO3 I;  2IV2 X;  3D2L A;  2RT9 A;  2AYD A;  3CD6 Z;  3CCS Z;  3EED A;  1VQO 1;  1VQ9 1;  1YIJ 1;  4XX2 A;  1VQ4 1;  5T6B A;  1S72 1;  1Q86 2;  3S1M I;  3CCR Z;  3CCJ 1;  3CQZ I;  1NJI 1;  2LFU A;  3NFZ A;  4NBF A;  1YIT 1;  4MXU A;  2NAP A;  1K9M 1;  4RVH A;  1PFT A;  3CCE Z;  5CM2 M;  2VPW A;  1Y1V S;  2W03 A;  4MD9 A;  4CL1 A;  2VPY A;  1VQ5 1;  3H0G I;  1Z01 A;  1Z02 A;  3CC7 1;  1I50 I;  3F3F C;  1RO0 A;  1Z03 A;  1LQL A;  2PM9 A;  1QF8 A;  1P9N A;  3G71 Z;  1KD1 1;  2O53 A;  3IX0 A;  2E2H I;  3GTK I;  4QTT A;  4S1T A;  3CCV Z;  4TNU A;  1RO2 A;  3S2D I;  3CCQ 1;  1VQM 1;  3NH5 A;  4AYB A;  3HOV I;  2RBL A;  2JA6 I;  4NBD A;  1JJ2 Y;  1K83 I;  1NUI A;  3KIF A;  3CMA Z;  1NJI 2;  2DE5 A;  4NB8 A;  1TWG I;  1VQO Z;  1WCM I;  1S72 Z;  2R93 I;  2JIO A;  1RLY A;  4HGY A;  1YJN Z;  3U50 C;  3BG1 B;  4A3I I;  2OTJ 1;  1JJ2 Z;  2JR6 A;  2IZ4 A;  3MON A;  3Q87 A;  4BY7 I;  4RS4 A;  3F3P C;  1VQ7 1;  4NBH A;  1QVF Y;  2RPR A;  2JUB A;  1QVG Z;  3VB9 A;  2OTL Z;  1USP B;  3VMI A;  3CC7 Z;  3I07 A;  1Q86 1;  3CC4 1;  3I56 1;  1YHQ 1;  2JIQ A;  1VQ6 1;  3GTL I;  2DE6 A;  1QVF Z;  2LIY A;  3GTQ I;  4BBS I;  1VQ8 Z;  1VQL 1;  1K73 1;  3RZO I;  3HOU I;  2JMO A;  2QRC B;  3J80 f;  1YI2 1;  5T64 A;  3G4S Z;  3OW2 Z;  1TWH I;  4RVG A;  2V8K A;  2QEX Z;  5C4X I;  5FLM I;  2QRE B;  3RZD I;  2NVQ I;  3M4O I;  1TWF I;  1Y1W I;  4E30 A;  4E33 A;  2PK7 A;  5IP9 I;  1SIW A;  1N8R 1;  4E2W A;  1QYP A;  2OTJ Z;  3TE5 B;  3QWU A;  1YJW 1;  3S1Q I;  2PMZ A;  4NH1 C;  4A3M I;  3CPW Y;  2WAQ A;  3J7A 4;  3ESW A;  2JA7 I;  2J6A A;  1YJ9 1;  3PO2 I;  2GTI A;  3I56 Z;  4MON A;  3GTG I;  2V3V A;  1I6H I;  3M3Y I;  1K73 2;  5D1O A;  1L1O C;  3JAM f;  3CPW Z;  2QA4 1;  4A3B I;  1X3W A;  4RVF A;  3G6E 1;  2R92 I;  4NBC A;  2JIR A;  4QTU A;  3CCM Z;  1VQK Z;  1W2B Y;  1X3Z A;  2VPZ A;  2M6N A;  2B63 I;  1Q82 1;  2OOX B;  5AN9 F;  3H3V J;  3TDH B;  3J80 b;  3I55 1;  1N8R 2;  3S16 I;  3KIH A;  1SFO I;  1RNI A;  1ZB9 A;  4E32 A;  5IT9 b;  1TWC I;  5T67 A;  5C4J I;  2H85 A;  2YAD A;  3I4N I;  4DQY B;  2JA8 I;  1VQ9 Z;  3CME 1;  1YIJ Z;  4BXX I;  1VQ4 Z;  1VQN 1;  1Q81 2;  1QXF A;  3CCJ Z;  1YIT Z;  4A3C I;  3VTN A;  3CXC Y;  2EGT A;  2Y0S A;  3HOW I;  3CCU 1;  2RHB A;  2V8J A;  3MZL B;  4MH4 A;  4NBE A;  4NB9 A;  1VQ5 Z;  2VUG A;  3J81 f;  2QKD A;  3GTO I;  4MD7 A;  2P28 A;  3GTM I;  3NH8 A;  3S1N I;  3NDJ A;  2VPX A;  1Q82 2;  3CCS 1;  3S15 I;  2E9H A;  1TFI A;  3I4M I;  4Y7N I;  2BJO A;  2LEX A;  3CCR 1;  1KQS Y;  5A2Q f;  3I55 Z;  3CCQ Z;  1VQM Z;  4HH4 A;  3CCE 1;  2YU9 I;  2IZ3 A;  2JIM A;  1K8A 2;  3S14 I;  5C44 I;  2W04 A;  4A3L I;  4A3G I;  3GTJ I;  1TWA I;  1KQS Z;  1FDI A;  3MZK B;  2OZK A;  4NBB A;  3G71 1;  2F4O A;  2E2J I;  4E2Y A;  3S1R I;  2NVT I;  4DK1 A;  1Y1V I;  3CCU Z;  1FDO A;  3HKZ A;  1VQ7 Z;  2GTH A;  3CCV 1;  1Q81 1;  2NVY I;  3CC4 Z;  4A3D I;  4NFR A;  1WJ2 A;  1WW9 A;  4BY1 I;  4RV9 A;  1YHQ Z;  3J81 b;  2M48 A;  3CMA 1;  1I3Q I;  1VQP 1;  2ZAE B;  1VQ6 Z;  2K3R A;  2JNY A;  4E2Z A;  2G2K A;  5FLX f;  3CC2 1;  1VQL Z;  1S7M A;  1YJN 1;  2QRD B;  2V45 A;  1KC8 2;  3GCF A;  1NP6 A;  3PO3 S;  1YI2 Z;  1N2F A;  1ZB8 A;  1Q7Y 2;  4EWC A;  4E2X A;  3HOZ I;  2E2I I;  5A2Q b;  2F4M A;  2E7Z A;  4MRI A;  2OTL 1;  1WII A;  4A3K I;  3GTP I;  3HOX I;  2AKL A;  4DGL A;  2VUM I;  5D1O B;  3GKQ A;  4Y52 I;  1YUK A;  2HF1 A;  3P5J B;  1W2B Z;  1M1K 1;  1M90 2;  1K8A 1;  1YJW Z;  1VQ8 1;  3LUS A; 
#chains in the Genus database with same CATH homology
 1RO4 A;  1YUA A;  2R7Z I;  1YJ9 Z;  1R9T I;  3NDI A;  4A3E I;  2OOY B;  3NH4 A;  3VMH A;  2GU2 A;  3G4S 1;  3IFU A;  3FQM A;  4HGZ A;  2RIQ A;  3S17 I;  3EER A;  1USP A;  4NBA A;  2QEX 1;  4MD8 A;  2Q51 A;  4RVD A;  3CCL 1;  1VQP Z;  2R6M A;  3VMG A;  1QVG Y;  2QA4 Z;  1JWH C;  3CC2 Z;  1K9M 2;  3G6E Z;  4A3F I;  2KI7 B;  3CXC Z;  2WB1 A;  2QR1 B;  3CD6 1;  2DE7 A;  4A3J I;  1RQF A;  5FLX b;  3JAM b;  5D1P A;  3HOY I;  2O4H A;  4NOZ A;  1DL6 A;  2KPI A;  3FQQ A;  2V8I A;  4A93 I;  3FKI I;  1KD1 2;  1X0T A;  3IF8 A;  4X6A I;  1M1K 2;  1KRL A;  1ML8 A;  2QLV B;  1ZH1 A;  2K5R A;  3OW2 Y;  1KC8 1;  4BBR I;  3BG0 B;  1Q7Y 1;  3CME Z;  2NVX I;  3S2H I;  1VQN Z;  2JA5 I;  5LL6 f;  4NBG A;  2HU9 A;  3GTM S;  2VF1 A;  3CCM 1;  1VQK 1;  3T4N B;  5IP7 I;  2JS4 A;  5C3E I;  4E31 A;  5IT9 f;  3CCL Z;  3D6W A;  2P3Y A;  1M90 1;  1VLA A;  2Q4Z A;  3K7A I;  2I3C A;  3D9X A;  3PO3 I;  2RT9 A;  3CD6 Z;  3CCS Z;  3EED A;  1VQO 1;  1VQ9 1;  1YIJ 1;  4XX2 A;  1VQ4 1;  5T6B A;  1S72 1;  1Q86 2;  3S1M I;  3CCR Z;  3CCJ 1;  3CQZ I;  1NJI 1;  2LFU A;  3NFZ A;  4NBF A;  1YIT 1;  4MXU A;  1K9M 1;  4RVH A;  1PFT A;  3CCE Z;  5CM2 M;  1Y1V S;  2W03 A;  4MD9 A;  4CL1 A;  1VQ5 1;  3H0G I;  1Z01 A;  1Z02 A;  3CC7 1;  1I50 I;  3F3F C;  1RO0 A;  1Z03 A;  1LQL A;  2PM9 A;  1QF8 A;  1P9N A;  3G71 Z;  1KD1 1;  2O53 A;  3IX0 A;  2E2H I;  3GTK I;  4QTT A;  4S1T A;  3CCV Z;  4TNU A;  1RO2 A;  3S2D I;  3CCQ 1;  1VQM 1;  3NH5 A;  4AYB A;  3HOV I;  2RBL A;  2JA6 I;  4NBD A;  1JJ2 Y;  1K83 I;  1NUI A;  3KIF A;  3CMA Z;  1NJI 2;  2DE5 A;  4NB8 A;  1TWG I;  1VQO Z;  1WCM I;  1S72 Z;  2R93 I;  4HGY A;  1RLY A;  1YJN Z;  3U50 C;  3BG1 B;  4A3I I;  2OTJ 1;  1JJ2 Z;  2JR6 A;  2IZ4 A;  3MON A;  3Q87 A;  4BY7 I;  4RS4 A;  3F3P C;  1VQ7 1;  4NBH A;  1QVF Y;  2RPR A;  2JUB A;  1QVG Z;  3VB9 A;  2OTL Z;  1USP B;  3VMI A;  3CC7 Z;  3I07 A;  1Q86 1;  3CC4 1;  3I56 1;  1YHQ 1;  1VQ6 1;  3GTL I;  2DE6 A;  1QVF Z;  2LIY A;  3GTQ I;  4BBS I;  1VQ8 Z;  1VQL 1;  1K73 1;  3RZO I;  3HOU I;  2JMO A;  2QRC B;  3J80 f;  1YI2 1;  5T64 A;  3G4S Z;  3OW2 Z;  1TWH I;  4RVG A;  2V8K A;  2QEX Z;  5C4X I;  5FLM I;  2QRE B;  3RZD I;  2NVQ I;  3M4O I;  1TWF I;  1Y1W I;  4E30 A;  4E33 A;  2PK7 A;  5IP9 I;  1N8R 1;  4E2W A;  1QYP A;  2OTJ Z;  3TE5 B;  3QWU A;  1YJW 1;  3S1Q I;  2PMZ A;  4NH1 C;  4A3M I;  3CPW Y;  2WAQ A;  3J7A 4;  3ESW A;  2JA7 I;  2J6A A;  1YJ9 1;  3PO2 I;  2GTI A;  3I56 Z;  4MON A;  3GTG I;  1I6H I;  3M3Y I;  1K73 2;  5D1O A;  1L1O C;  3JAM f;  3CPW Z;  2QA4 1;  4A3B I;  1X3W A;  4RVF A;  3G6E 1;  2R92 I;  4NBC A;  4QTU A;  3CCM Z;  1VQK Z;  1W2B Y;  1X3Z A;  2M6N A;  2B63 I;  1Q82 1;  2OOX B;  5AN9 F;  3H3V J;  3TDH B;  3J80 b;  3I55 1;  1N8R 2;  3S16 I;  3KIH A;  1SFO I;  1RNI A;  1ZB9 A;  4E32 A;  5IT9 b;  1TWC I;  5T67 A;  5C4J I;  2H85 A;  2YAD A;  3I4N I;  4DQY B;  2JA8 I;  1VQ9 Z;  3CME 1;  1YIJ Z;  4BXX I;  1VQ4 Z;  1VQN 1;  1Q81 2;  3CCJ Z;  1YIT Z;  4A3C I;  3VTN A;  3CXC Y;  2EGT A;  2Y0S A;  3HOW I;  3CCU 1;  2RHB A;  2V8J A;  3MZL B;  4MH4 A;  4NBE A;  4NB9 A;  1VQ5 Z;  2VUG A;  3J81 f;  2QKD A;  3GTO I;  4MD7 A;  2P28 A;  3GTM I;  3NH8 A;  3S1N I;  3NDJ A;  1Q82 2;  3CCS 1;  3S15 I;  2E9H A;  1TFI A;  3I4M I;  4Y7N I;  2BJO A;  3CCR 1;  1KQS Y;  5A2Q f;  3I55 Z;  3CCQ Z;  1VQM Z;  4HH4 A;  3CCE 1;  2YU9 I;  2IZ3 A;  1K8A 2;  3S14 I;  5C44 I;  2W04 A;  4A3L I;  4A3G I;  3GTJ I;  1TWA I;  1KQS Z;  3MZK B;  2OZK A;  4NBB A;  3G71 1;  2F4O A;  2E2J I;  4E2Y A;  3S1R I;  2NVT I;  4DK1 A;  1Y1V I;  3CCU Z;  3HKZ A;  1VQ7 Z;  2GTH A;  3CCV 1;  1Q81 1;  2NVY I;  3CC4 Z;  4A3D I;  4NFR A;  1WW9 A;  4BY1 I;  4RV9 A;  1YHQ Z;  3J81 b;  2M48 A;  3CMA 1;  1I3Q I;  1VQP 1;  2ZAE B;  1VQ6 Z;  2K3R A;  2JNY A;  4E2Z A;  2G2K A;  5FLX f;  3CC2 1;  1VQL Z;  1S7M A;  1YJN 1;  2QRD B;  1KC8 2;  3GCF A;  1NP6 A;  3PO3 S;  1YI2 Z;  1N2F A;  1ZB8 A;  1Q7Y 2;  4EWC A;  4E2X A;  3HOZ I;  2E2I I;  5A2Q b;  2F4M A;  4MRI A;  2OTL 1;  1WII A;  4A3K I;  3GTP I;  3HOX I;  2AKL A;  4DGL A;  2VUM I;  5D1O B;  3GKQ A;  4Y52 I;  1YUK A;  2HF1 A;  3P5J B;  1W2B Z;  1M1K 1;  1M90 2;  1K8A 1;  1YJW Z;  1VQ8 1;  3LUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...