1VQ4Z

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4Z00
1VQMZ 3CCMZ 3I561 1VQ41 1N8R1 1YI2Z 1YHQ1 1NJI1 1YITZ 1VQ5Z 1JJ2Y 3CME1 2OTL1 1VQ9Z 1KD11 3CCRZ 1KQSZ 1VQO1 3CCQZ 3CCLZ 3G711 1Q821 3I55Z 1YIJZ 1Q7Y1 1M1K2 3CMAZ 1KQSY 3OW2Z 3CCJZ 1K732 1M902 1VQP1 1VQL1 2OTJZ 1K8A2 3CPWZ 1S72Z 1VQ71 1VQKZ 2QA4Z 3CCEZ 1JJ2Z 3CCU1 3CPWY 3CC21 1YJW1 3CCSZ 3G6EZ 1K9M2 1M1K1 1VQ4Z 1VQN1 1K731 2QEX1 1M901 1QVFY 1VQK1 1VQM1 3CMEZ 3CCM1 3CC7Z 1K8A1 2OTLZ 3G4S1 1Q812 1VQ6Z 1YI21 3CC41 1YIT1 1VQ51 3G71Z 1VQ91 1YJN1 3CCR1 3CCQ1 3CCL1 3CCVZ 1Q862 1K9M1 3I551 1YIJ1 3CMA1 1QVFZ 1VQ7Z 3CCJ1 1YJ91 1QVGZ 1VQ8Z 2OTJ1 3CD61 3CCUZ 3I56Z 1Q811 2QA41 1YJWZ 1YHQZ 1QVGY 1W2BZ 1KC82 3CXCZ 1VQOZ 2QEXZ 3CCS1 1Q861 3G6E1 3G4SZ 1W2BY 3CXCY 1VQPZ 3CC4Z 1VQLZ 3CC71 1YJNZ 1N8R2 1VQ61 1NJI2 1KC81 1KD12 1S721 3CC2Z 1YJ9Z 3CCE1 3CCV1 1Q822 3CD6Z 1Q7Y2 1VQNZ 3OW2Y 1VQ81
chains in the Genus database with same CATH superfamily
4E2XA 2JR6A 1P9NA 2GTIA 3I561 3D9XA 2O53A 4NBFA 1NJI1 2E2II 2H85A 2JS4A 3CME1 2PM9A 1Z01A 1KRLA 2OOYB 4A93I 2V8KA 3G711 2B63I 4NBBA 3D6WA 1YIJZ 1Q7Y1 3S2HI 3J80b 3CMAZ 1VQL1 2GU2A 3CPWZ 1R9TI 1USPB 1S72Z 1USPA 1X0TA 1FDOA 2QA4Z 3P5JB 2E9HA 3CPWY 4NH1C 3CCSZ 3G6EZ 4RVHA 2O4HA 2YADA 2JA7I 1K731 2E7ZA 1L1OC 2OTLZ 3G4S1 3NH4A 1WCMI 2QR1B 4MXUA 4NB9A 1FDIA 2QLVB 2VPZA 2KI7B 4A3BI 2V8JA 2F4OA 3J81b 2AKLA 3NH8A 5D1OB 1K9M1 5A2Qb 2V45A 1X3WA 3MONA 5D1OA 1YIJ1 3CMA1 1VQ7Z 2P3YA 1AA6A 1VQ8Z 2JIMA 4A3II 1Q811 2QA41 1YJWZ 3I4NI 3NDJA 2PMZA 3JAMf 3IF8A 1KC82 1ZH1A 3GTPI 3KIFA 4A3LI 4E2YA 3CCS1 3RZDI 3G6E1 1YUAA 1Z02A 3QWUA 2V8IA 1YJNZ 2R92I 4E31A 2HF1A 5IP9I 2JA8I 1NJI2 3S1MI 3FQQA 3GCFA 3S16I 1YJ9Z 3HOYI 3VMGA 2K3RA 2VPWA 1Q7Y2 1VQ81 3GTJI 1VQKZ 3CCMZ 1JWHC 3IR7A 3RZOI 2DE7A 1TWGI 1JJ2Y 2EGTA 2IV2X 1KQSZ 3CCLZ 1Q821 2JA5I 3I55Z 1X3ZA 2M48A 1KQSY 3OW2Z 1K732 4NFRA 1WJ2A 2OTJZ 3S1RI 3HOVI 4E2WA 3CCEZ 2ZAEB 2OZKA 4NBGA 3JAMb 2NAPA 1K9M2 1M1K1 1VQ4Z 1K83I 2QEX1 2P28A 4MD9A 1M901 2RIQA 3FQMA 1QVFY 1VQK1 2RT9A 3CCM1 3NFZA 4A3JI 1QXFA 4EWCA 3TDHB 1Q812 1VQ6Z 3S14I 3BG0B 3CC41 4MRIA 2R93I 3VMHA 4DGLA 3NDIA 5C3EI 3CCL1 5T67A 3GTKI 2Q51A 1QF8A 1ML8A 3I551 1RO2A 1QVGZ 2VUGA 2OTJ1 2OOXB 3CD61 3CCUZ 4NOZA 2E2HI 1QVGY 1TWAI 1W2BZ 2BJOA 2NVYI 3CXCZ 3HOUI 1VQOZ 3BG1B 1NUIA 1RO4A 1W2BY 5AN9F 1WZNA 3CXCY 1YUKA 5T6BA 2QRCB 1RO0A 1VQ61 3S17I 4HGZA 4NBHA 1S721 4TNUA 4Y7NI 5T64A 3CQZI 1Q822 3MZKB 4QTUA 1VQNZ 3KIHA 4NBCA 4S1TA 3GTOI 4A3MI 5FLXf 1N8R1 2K5RA 2JA6I 2VF1A 1YITZ 1VQ5Z 5D1PA 2OTL1 1VQ9Z 1DL6A 3S1NI 2JMOA 3HKZA 2NVXI 1Y1WI 2PK7A 1VQO1 4MD8A 5C4JI 3CCQZ 4Y52I 3F3PC 1M1K2 4RVGA 3CCJZ 2Y0SA 1M902 1RQFA 3FKII 3U50C 1VQ71 4A3KI 3NH5A 1JJ2Z 3M3YI 4NBEA 5C44I 3HOXI 2W03A 3ESWA 3VTNA 1WIIA 3M4OI 1YJW1 2JIQA 4DK1A 3GTQI 1VQN1 2AYDA 3CMEZ 1K8A1 2DE6A 3HOWI 2RBLA 1YIT1 1VQ51 2HU9A 3G71Z 1TWHI 1TWCI 3IFUA 1VQ91 1TFIA 1YJN1 2LFUA 2DE5A 3D2LA 3S2DI 3CCQ1 3F3FC 3I07A 1S7MA 3CCVZ 1N2FA 3TE5B 4A3GI 1QVFZ 2NVQI 3CCJ1 4E32A 1YJ91 1ZB9A 5FLXb 1TWFI 4RS4A 3J81f 2VUMI 2JIRA 2VPYA 1YHQZ 3S15I 5IT9f 4XX2A 3T4NB 1LQLA 1Q861 4NBAA 1I3QI 3G4SZ 3GTGI 2IZ3A 2QRDB 4AYBA 1VQPZ 3MZLB 4A3CI 1I50I 4A3DI 2LIYA 1N8R2 1PFTA 5IP7I 1QYPA 3CC2Z 2IZ4A 3CCE1 3PO3S 3LUSA 4E2ZA 3CCV1 2J6AA 4NBDA 3S1QI 2JNYA 3J7A4 4RVFA 2G2KA 1VQMZ 5C4XI 2M6NA 1VQ41 1Q16A 1YI2Z 1YHQ1 4DQYB 1RNIA 2I3CA 4BBSI 1KD11 3CCRZ 1Y1VS 2R6MA 5FLMI 5CM2M 4CL1A 4E30A 2JUBA 3HOZI 1VQP1 4NB8A 1K8A2 2YU9I 2R7ZI 4HH4A 3PO3I 3I4MI 3CCU1 5IT9b 3CC21 4RVDA 2JIOA 2W04A 2KPIA 4MD7A 2RHBA 3IX0A 1NP6A 3K7AI 1RLYA 1I6HI 1Z03A 2JIPA 3Q87A 3GTMS 2E2JI 2WB1A 1WW9A 2NVTI 1VQM1 3CC7Z 1SFOI 1Y1VI 3H0GI 4RV9A 1YI21 4BY1I 3GTLI 3CCR1 4MH4A 4A3FI 2LEXA 1Q862 4X6AI 3J80f 4A3EI 2QREB 1SIWA 2F4MA 4QTTA 3PO2I 3I56Z 3H3VJ 4BXXI 2GTHA 4E33A 3GTMI 3VB9A 2QEXZ 4BY7I 2QKDA 2VPXA 4MONA 3EEDA 3CC4Z 1VQLZ 2Q4ZA 3CC71 3EERA 1VLAA 1KC81 1KD12 2WAQA 1Y8CA 3VMIA 5LL6f 3GKQA 2V3VA 4HGYA 4BBRI 5A2Qf 3CD6Z 2RPRA 1ZB8A 3OW2Y
chains in the Genus database with same CATH topology
4E2XA 2JR6A 1P9NA 2GTIA 3I561 3D9XA 2O53A 4NBFA 1NJI1 2E2II 2H85A 2JS4A 3CME1 2PM9A 1Z01A 1KRLA 2OOYB 4A93I 2V8KA 3G711 2B63I 4NBBA 3D6WA 1YIJZ 1Q7Y1 3S2HI 3J80b 3CMAZ 1VQL1 2GU2A 3CPWZ 1R9TI 1USPB 1S72Z 1USPA 1X0TA 2QA4Z 3P5JB 2E9HA 3CPWY 4NH1C 3CCSZ 3G6EZ 4RVHA 2O4HA 2YADA 2JA7I 1K731 1L1OC 2OTLZ 3G4S1 3NH4A 1WCMI 2QR1B 4MXUA 4NB9A 2QLVB 4A3BI 2KI7B 2V8JA 2F4OA 3J81b 2AKLA 3NH8A 5D1OB 1K9M1 5A2Qb 5D1OA 1X3WA 3MONA 1YIJ1 3CMA1 1VQ7Z 2P3YA 1VQ8Z 4A3II 1Q811 2QA41 1YJWZ 3I4NI 3NDJA 2PMZA 3JAMf 3IF8A 1KC82 1ZH1A 3GTPI 3KIFA 4A3LI 4E2YA 3CCS1 3RZDI 3G6E1 1YUAA 1Z02A 3QWUA 2V8IA 1YJNZ 2R92I 4E31A 2HF1A 5IP9I 2JA8I 1NJI2 3S1MI 3FQQA 3GCFA 3S16I 1YJ9Z 3HOYI 3VMGA 2K3RA 1Q7Y2 1VQ81 3GTJI 1VQKZ 3CCMZ 1JWHC 3RZOI 2DE7A 1TWGI 1JJ2Y 2EGTA 1KQSZ 3CCLZ 1Q821 2JA5I 3I55Z 1X3ZA 2M48A 1KQSY 3OW2Z 1K732 4NFRA 2OTJZ 3S1RI 3HOVI 4E2WA 3CCEZ 2ZAEB 2OZKA 4NBGA 3JAMb 1K9M2 1M1K1 1VQ4Z 1K83I 2QEX1 2P28A 4MD9A 1M901 2RIQA 3FQMA 1QVFY 1VQK1 2RT9A 3CCM1 3NFZA 4A3JI 4EWCA 3TDHB 1Q812 1VQ6Z 3S14I 3BG0B 3CC41 4MRIA 2R93I 3VMHA 4DGLA 3NDIA 5C3EI 3CCL1 5T67A 3GTKI 2Q51A 1QF8A 1ML8A 3I551 1RO2A 1QVGZ 2VUGA 2OTJ1 2OOXB 3CD61 3CCUZ 4NOZA 2E2HI 1QVGY 1TWAI 1W2BZ 2BJOA 2NVYI 3CXCZ 3HOUI 1VQOZ 3BG1B 1NUIA 1RO4A 1W2BY 5AN9F 3CXCY 1YUKA 5T6BA 2QRCB 1RO0A 1VQ61 3S17I 4HGZA 4NBHA 1S721 4TNUA 4Y7NI 5T64A 3CQZI 1Q822 3MZKB 4QTUA 1VQNZ 3KIHA 4NBCA 4S1TA 3GTOI 4A3MI 5FLXf 1N8R1 2K5RA 2JA6I 2VF1A 1YITZ 1VQ5Z 5D1PA 2OTL1 1VQ9Z 1DL6A 3S1NI 2JMOA 3HKZA 2NVXI 1Y1WI 2PK7A 1VQO1 4MD8A 5C4JI 3CCQZ 4Y52I 3F3PC 1M1K2 4RVGA 3CCJZ 2Y0SA 1M902 1RQFA 3FKII 3U50C 1VQ71 4A3KI 3NH5A 1JJ2Z 3M3YI 4NBEA 5C44I 3HOXI 2W03A 3ESWA 3VTNA 1WIIA 3M4OI 1YJW1 4DK1A 3GTQI 1VQN1 3CMEZ 1K8A1 2DE6A 3HOWI 2RBLA 1YIT1 1VQ51 2HU9A 3G71Z 1TWHI 1TWCI 3IFUA 1VQ91 1TFIA 1YJN1 2LFUA 2DE5A 3S2DI 3CCQ1 3F3FC 3I07A 1S7MA 3CCVZ 1N2FA 3TE5B 4A3GI 1QVFZ 2NVQI 3CCJ1 4E32A 1YJ91 1ZB9A 5FLXb 1TWFI 4RS4A 3J81f 2VUMI 1YHQZ 3S15I 5IT9f 4XX2A 3T4NB 1LQLA 1Q861 4NBAA 1I3QI 3G4SZ 3GTGI 2IZ3A 2QRDB 4AYBA 1VQPZ 3MZLB 4A3CI 1I50I 4A3DI 2LIYA 1N8R2 1PFTA 5IP7I 1QYPA 3CC2Z 2IZ4A 3CCE1 3PO3S 3LUSA 4E2ZA 3CCV1 2J6AA 4NBDA 3S1QI 2JNYA 3J7A4 4RVFA 2G2KA 1VQMZ 5C4XI 2M6NA 1VQ41 1YI2Z 1YHQ1 4DQYB 1RNIA 2I3CA 4BBSI 1KD11 3CCRZ 1Y1VS 2R6MA 5FLMI 5CM2M 4CL1A 4E30A 2JUBA 3HOZI 1VQP1 4NB8A 1K8A2 2YU9I 2R7ZI 4HH4A 3PO3I 3I4MI 3CCU1 5IT9b 3CC21 4RVDA 2W04A 2KPIA 4MD7A 2RHBA 3IX0A 1NP6A 3K7AI 1RLYA 1I6HI 1Z03A 3Q87A 3GTMS 2E2JI 2WB1A 1WW9A 2NVTI 1VQM1 3CC7Z 1SFOI 1Y1VI 3H0GI 4RV9A 1YI21 4BY1I 3GTLI 3CCR1 4MH4A 4A3FI 1Q862 4X6AI 3J80f 4A3EI 2QREB 2F4MA 4QTTA 3PO2I 3I56Z 3H3VJ 4BXXI 2GTHA 4E33A 3GTMI 3VB9A 2QEXZ 4BY7I 2QKDA 4MONA 3EEDA 3CC4Z 1VQLZ 2Q4ZA 3CC71 3EERA 1VLAA 1KC81 1KD12 2WAQA 3VMIA 5LL6f 3GKQA 4HGYA 4BBRI 5A2Qf 3CD6Z 2RPRA 1ZB8A 3OW2Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM Z;  3CCM Z;  3I56 1;  1VQ4 1;  1N8R 1;  1YI2 Z;  1YHQ 1;  1NJI 1;  1YIT Z;  1VQ5 Z;  1JJ2 Y;  3CME 1;  2OTL 1;  1VQ9 Z;  1KD1 1;  3CCR Z;  1KQS Z;  1VQO 1;  3CCQ Z;  3CCL Z;  3G71 1;  1Q82 1;  3I55 Z;  1YIJ Z;  1Q7Y 1;  1M1K 2;  3CMA Z;  1KQS Y;  3OW2 Z;  3CCJ Z;  1K73 2;  1M90 2;  1VQP 1;  1VQL 1;  2OTJ Z;  1K8A 2;  3CPW Z;  1S72 Z;  1VQ7 1;  1VQK Z;  2QA4 Z;  3CCE Z;  1JJ2 Z;  3CCU 1;  3CPW Y;  3CC2 1;  1YJW 1;  3CCS Z;  3G6E Z;  1K9M 2;  1M1K 1;  1VQ4 Z;  1VQN 1;  1K73 1;  2QEX 1;  1M90 1;  1QVF Y;  1VQK 1;  1VQM 1;  3CME Z;  3CCM 1;  3CC7 Z;  1K8A 1;  2OTL Z;  3G4S 1;  1Q81 2;  1VQ6 Z;  1YI2 1;  3CC4 1;  1YIT 1;  1VQ5 1;  3G71 Z;  1VQ9 1;  1YJN 1;  3CCR 1;  3CCQ 1;  3CCL 1;  3CCV Z;  1Q86 2;  1K9M 1;  3I55 1;  1YIJ 1;  3CMA 1;  1QVF Z;  1VQ7 Z;  3CCJ 1;  1YJ9 1;  1QVG Z;  1VQ8 Z;  2OTJ 1;  3CD6 1;  3CCU Z;  3I56 Z;  1Q81 1;  2QA4 1;  1YJW Z;  1YHQ Z;  1QVG Y;  1W2B Z;  1KC8 2;  3CXC Z;  1VQO Z;  2QEX Z;  3CCS 1;  1Q86 1;  3G6E 1;  3G4S Z;  1W2B Y;  3CXC Y;  1VQP Z;  3CC4 Z;  1VQL Z;  3CC7 1;  1YJN Z;  1N8R 2;  1VQ6 1;  1NJI 2;  1KC8 1;  1KD1 2;  1S72 1;  3CC2 Z;  1YJ9 Z;  3CCE 1;  3CCV 1;  1Q82 2;  3CD6 Z;  1Q7Y 2;  1VQN Z;  3OW2 Y;  1VQ8 1; 
#chains in the Genus database with same CATH topology
 4E2X A;  2JR6 A;  1P9N A;  2GTI A;  3I56 1;  3D9X A;  2O53 A;  4NBF A;  1NJI 1;  2E2I I;  2H85 A;  2JS4 A;  3CME 1;  2PM9 A;  1Z01 A;  1KRL A;  2OOY B;  4A93 I;  2V8K A;  3G71 1;  2B63 I;  4NBB A;  3D6W A;  1YIJ Z;  1Q7Y 1;  3S2H I;  3J80 b;  3CMA Z;  1VQL 1;  2GU2 A;  3CPW Z;  1R9T I;  1USP B;  1S72 Z;  1USP A;  1X0T A;  1FDO A;  2QA4 Z;  3P5J B;  2E9H A;  3CPW Y;  4NH1 C;  3CCS Z;  3G6E Z;  4RVH A;  2O4H A;  2YAD A;  2JA7 I;  1K73 1;  2E7Z A;  1L1O C;  2OTL Z;  3G4S 1;  3NH4 A;  1WCM I;  2QR1 B;  4MXU A;  4NB9 A;  1FDI A;  2QLV B;  2VPZ A;  2KI7 B;  4A3B I;  2V8J A;  2F4O A;  3J81 b;  2AKL A;  3NH8 A;  5D1O B;  1K9M 1;  5A2Q b;  2V45 A;  1X3W A;  3MON A;  5D1O A;  1YIJ 1;  3CMA 1;  1VQ7 Z;  2P3Y A;  1AA6 A;  1VQ8 Z;  2JIM A;  4A3I I;  1Q81 1;  2QA4 1;  1YJW Z;  3I4N I;  3NDJ A;  2PMZ A;  3JAM f;  3IF8 A;  1KC8 2;  1ZH1 A;  3GTP I;  3KIF A;  4A3L I;  4E2Y A;  3CCS 1;  3RZD I;  3G6E 1;  1YUA A;  1Z02 A;  3QWU A;  2V8I A;  1YJN Z;  2R92 I;  4E31 A;  2HF1 A;  5IP9 I;  2JA8 I;  1NJI 2;  3S1M I;  3FQQ A;  3GCF A;  3S16 I;  1YJ9 Z;  3HOY I;  3VMG A;  2K3R A;  2VPW A;  1Q7Y 2;  1VQ8 1;  3GTJ I;  1VQK Z;  3CCM Z;  1JWH C;  3IR7 A;  3RZO I;  2DE7 A;  1TWG I;  1JJ2 Y;  2EGT A;  2IV2 X;  1KQS Z;  3CCL Z;  1Q82 1;  2JA5 I;  3I55 Z;  1X3Z A;  2M48 A;  1KQS Y;  3OW2 Z;  1K73 2;  4NFR A;  1WJ2 A;  2OTJ Z;  3S1R I;  3HOV I;  4E2W A;  3CCE Z;  2ZAE B;  2OZK A;  4NBG A;  3JAM b;  2NAP A;  1K9M 2;  1M1K 1;  1VQ4 Z;  1K83 I;  2QEX 1;  2P28 A;  4MD9 A;  1M90 1;  2RIQ A;  3FQM A;  1QVF Y;  1VQK 1;  2RT9 A;  3CCM 1;  3NFZ A;  4A3J I;  1QXF A;  4EWC A;  3TDH B;  1Q81 2;  1VQ6 Z;  3S14 I;  3BG0 B;  3CC4 1;  4MRI A;  2R93 I;  3VMH A;  4DGL A;  3NDI A;  5C3E I;  3CCL 1;  5T67 A;  3GTK I;  2Q51 A;  1QF8 A;  1ML8 A;  3I55 1;  1RO2 A;  1QVG Z;  2VUG A;  2OTJ 1;  2OOX B;  3CD6 1;  3CCU Z;  4NOZ A;  2E2H I;  1QVG Y;  1TWA I;  1W2B Z;  2BJO A;  2NVY I;  3CXC Z;  3HOU I;  1VQO Z;  3BG1 B;  1NUI A;  1RO4 A;  1W2B Y;  5AN9 F;  1WZN A;  3CXC Y;  1YUK A;  5T6B A;  2QRC B;  1RO0 A;  1VQ6 1;  3S17 I;  4HGZ A;  4NBH A;  1S72 1;  4TNU A;  4Y7N I;  5T64 A;  3CQZ I;  1Q82 2;  3MZK B;  4QTU A;  1VQN Z;  3KIH A;  4NBC A;  4S1T A;  3GTO I;  4A3M I;  5FLX f;  1N8R 1;  2K5R A;  2JA6 I;  2VF1 A;  1YIT Z;  1VQ5 Z;  5D1P A;  2OTL 1;  1VQ9 Z;  1DL6 A;  3S1N I;  2JMO A;  3HKZ A;  2NVX I;  1Y1W I;  2PK7 A;  1VQO 1;  4MD8 A;  5C4J I;  3CCQ Z;  4Y52 I;  3F3P C;  1M1K 2;  4RVG A;  3CCJ Z;  2Y0S A;  1M90 2;  1RQF A;  3FKI I;  3U50 C;  1VQ7 1;  4A3K I;  3NH5 A;  1JJ2 Z;  3M3Y I;  4NBE A;  5C44 I;  3HOX I;  2W03 A;  3ESW A;  3VTN A;  1WII A;  3M4O I;  1YJW 1;  2JIQ A;  4DK1 A;  3GTQ I;  1VQN 1;  2AYD A;  3CME Z;  1K8A 1;  2DE6 A;  3HOW I;  2RBL A;  1YIT 1;  1VQ5 1;  2HU9 A;  3G71 Z;  1TWH I;  1TWC I;  3IFU A;  1VQ9 1;  1TFI A;  1YJN 1;  2LFU A;  2DE5 A;  3D2L A;  3S2D I;  3CCQ 1;  3F3F C;  3I07 A;  1S7M A;  3CCV Z;  1N2F A;  3TE5 B;  4A3G I;  1QVF Z;  2NVQ I;  3CCJ 1;  4E32 A;  1YJ9 1;  1ZB9 A;  5FLX b;  1TWF I;  4RS4 A;  3J81 f;  2VUM I;  2JIR A;  2VPY A;  1YHQ Z;  3S15 I;  5IT9 f;  4XX2 A;  3T4N B;  1LQL A;  1Q86 1;  4NBA A;  1I3Q I;  3G4S Z;  3GTG I;  2IZ3 A;  2QRD B;  4AYB A;  1VQP Z;  3MZL B;  4A3C I;  1I50 I;  4A3D I;  2LIY A;  1N8R 2;  1PFT A;  5IP7 I;  1QYP A;  3CC2 Z;  2IZ4 A;  3CCE 1;  3PO3 S;  3LUS A;  4E2Z A;  3CCV 1;  2J6A A;  4NBD A;  3S1Q I;  2JNY A;  3J7A 4;  4RVF A;  2G2K A;  1VQM Z;  5C4X I;  2M6N A;  1VQ4 1;  1Q16 A;  1YI2 Z;  1YHQ 1;  4DQY B;  1RNI A;  2I3C A;  4BBS I;  1KD1 1;  3CCR Z;  1Y1V S;  2R6M A;  5FLM I;  5CM2 M;  4CL1 A;  4E30 A;  2JUB A;  3HOZ I;  1VQP 1;  4NB8 A;  1K8A 2;  2YU9 I;  2R7Z I;  4HH4 A;  3PO3 I;  3I4M I;  3CCU 1;  5IT9 b;  3CC2 1;  4RVD A;  2JIO A;  2W04 A;  2KPI A;  4MD7 A;  2RHB A;  3IX0 A;  1NP6 A;  3K7A I;  1RLY A;  1I6H I;  1Z03 A;  2JIP A;  3Q87 A;  3GTM S;  2E2J I;  2WB1 A;  1WW9 A;  2NVT I;  1VQM 1;  3CC7 Z;  1SFO I;  1Y1V I;  3H0G I;  4RV9 A;  1YI2 1;  4BY1 I;  3GTL I;  3CCR 1;  4MH4 A;  4A3F I;  2LEX A;  1Q86 2;  4X6A I;  3J80 f;  4A3E I;  2QRE B;  1SIW A;  2F4M A;  4QTT A;  3PO2 I;  3I56 Z;  3H3V J;  4BXX I;  2GTH A;  4E33 A;  3GTM I;  3VB9 A;  2QEX Z;  4BY7 I;  2QKD A;  2VPX A;  4MON A;  3EED A;  3CC4 Z;  1VQL Z;  2Q4Z A;  3CC7 1;  3EER A;  1VLA A;  1KC8 1;  1KD1 2;  2WAQ A;  1Y8C A;  3VMI A;  5LL6 f;  3GKQ A;  2V3V A;  4HGY A;  4BBR I;  5A2Q f;  3CD6 Z;  2RPR A;  1ZB8 A;  3OW2 Y; 
#chains in the Genus database with same CATH homology
 4E2X A;  2JR6 A;  1P9N A;  2GTI A;  3I56 1;  3D9X A;  2O53 A;  4NBF A;  1NJI 1;  2E2I I;  2H85 A;  2JS4 A;  3CME 1;  2PM9 A;  1Z01 A;  1KRL A;  2OOY B;  4A93 I;  2V8K A;  3G71 1;  2B63 I;  4NBB A;  3D6W A;  1YIJ Z;  1Q7Y 1;  3S2H I;  3J80 b;  3CMA Z;  1VQL 1;  2GU2 A;  3CPW Z;  1R9T I;  1USP B;  1S72 Z;  1USP A;  1X0T A;  2QA4 Z;  3P5J B;  2E9H A;  3CPW Y;  4NH1 C;  3CCS Z;  3G6E Z;  4RVH A;  2O4H A;  2YAD A;  2JA7 I;  1K73 1;  1L1O C;  2OTL Z;  3G4S 1;  3NH4 A;  1WCM I;  2QR1 B;  4MXU A;  4NB9 A;  2QLV B;  4A3B I;  2KI7 B;  2V8J A;  2F4O A;  3J81 b;  2AKL A;  3NH8 A;  5D1O B;  1K9M 1;  5A2Q b;  5D1O A;  1X3W A;  3MON A;  1YIJ 1;  3CMA 1;  1VQ7 Z;  2P3Y A;  1VQ8 Z;  4A3I I;  1Q81 1;  2QA4 1;  1YJW Z;  3I4N I;  3NDJ A;  2PMZ A;  3JAM f;  3IF8 A;  1KC8 2;  1ZH1 A;  3GTP I;  3KIF A;  4A3L I;  4E2Y A;  3CCS 1;  3RZD I;  3G6E 1;  1YUA A;  1Z02 A;  3QWU A;  2V8I A;  1YJN Z;  2R92 I;  4E31 A;  2HF1 A;  5IP9 I;  2JA8 I;  1NJI 2;  3S1M I;  3FQQ A;  3GCF A;  3S16 I;  1YJ9 Z;  3HOY I;  3VMG A;  2K3R A;  1Q7Y 2;  1VQ8 1;  3GTJ I;  1VQK Z;  3CCM Z;  1JWH C;  3RZO I;  2DE7 A;  1TWG I;  1JJ2 Y;  2EGT A;  1KQS Z;  3CCL Z;  1Q82 1;  2JA5 I;  3I55 Z;  1X3Z A;  2M48 A;  1KQS Y;  3OW2 Z;  1K73 2;  4NFR A;  2OTJ Z;  3S1R I;  3HOV I;  4E2W A;  3CCE Z;  2ZAE B;  2OZK A;  4NBG A;  3JAM b;  1K9M 2;  1M1K 1;  1VQ4 Z;  1K83 I;  2QEX 1;  2P28 A;  4MD9 A;  1M90 1;  2RIQ A;  3FQM A;  1QVF Y;  1VQK 1;  2RT9 A;  3CCM 1;  3NFZ A;  4A3J I;  4EWC A;  3TDH B;  1Q81 2;  1VQ6 Z;  3S14 I;  3BG0 B;  3CC4 1;  4MRI A;  2R93 I;  3VMH A;  4DGL A;  3NDI A;  5C3E I;  3CCL 1;  5T67 A;  3GTK I;  2Q51 A;  1QF8 A;  1ML8 A;  3I55 1;  1RO2 A;  1QVG Z;  2VUG A;  2OTJ 1;  2OOX B;  3CD6 1;  3CCU Z;  4NOZ A;  2E2H I;  1QVG Y;  1TWA I;  1W2B Z;  2BJO A;  2NVY I;  3CXC Z;  3HOU I;  1VQO Z;  3BG1 B;  1NUI A;  1RO4 A;  1W2B Y;  5AN9 F;  3CXC Y;  1YUK A;  5T6B A;  2QRC B;  1RO0 A;  1VQ6 1;  3S17 I;  4HGZ A;  4NBH A;  1S72 1;  4TNU A;  4Y7N I;  5T64 A;  3CQZ I;  1Q82 2;  3MZK B;  4QTU A;  1VQN Z;  3KIH A;  4NBC A;  4S1T A;  3GTO I;  4A3M I;  5FLX f;  1N8R 1;  2K5R A;  2JA6 I;  2VF1 A;  1YIT Z;  1VQ5 Z;  5D1P A;  2OTL 1;  1VQ9 Z;  1DL6 A;  3S1N I;  2JMO A;  3HKZ A;  2NVX I;  1Y1W I;  2PK7 A;  1VQO 1;  4MD8 A;  5C4J I;  3CCQ Z;  4Y52 I;  3F3P C;  1M1K 2;  4RVG A;  3CCJ Z;  2Y0S A;  1M90 2;  1RQF A;  3FKI I;  3U50 C;  1VQ7 1;  4A3K I;  3NH5 A;  1JJ2 Z;  3M3Y I;  4NBE A;  5C44 I;  3HOX I;  2W03 A;  3ESW A;  3VTN A;  1WII A;  3M4O I;  1YJW 1;  4DK1 A;  3GTQ I;  1VQN 1;  3CME Z;  1K8A 1;  2DE6 A;  3HOW I;  2RBL A;  1YIT 1;  1VQ5 1;  2HU9 A;  3G71 Z;  1TWH I;  1TWC I;  3IFU A;  1VQ9 1;  1TFI A;  1YJN 1;  2LFU A;  2DE5 A;  3S2D I;  3CCQ 1;  3F3F C;  3I07 A;  1S7M A;  3CCV Z;  1N2F A;  3TE5 B;  4A3G I;  1QVF Z;  2NVQ I;  3CCJ 1;  4E32 A;  1YJ9 1;  1ZB9 A;  5FLX b;  1TWF I;  4RS4 A;  3J81 f;  2VUM I;  1YHQ Z;  3S15 I;  5IT9 f;  4XX2 A;  3T4N B;  1LQL A;  1Q86 1;  4NBA A;  1I3Q I;  3G4S Z;  3GTG I;  2IZ3 A;  2QRD B;  4AYB A;  1VQP Z;  3MZL B;  4A3C I;  1I50 I;  4A3D I;  2LIY A;  1N8R 2;  1PFT A;  5IP7 I;  1QYP A;  3CC2 Z;  2IZ4 A;  3CCE 1;  3PO3 S;  3LUS A;  4E2Z A;  3CCV 1;  2J6A A;  4NBD A;  3S1Q I;  2JNY A;  3J7A 4;  4RVF A;  2G2K A;  1VQM Z;  5C4X I;  2M6N A;  1VQ4 1;  1YI2 Z;  1YHQ 1;  4DQY B;  1RNI A;  2I3C A;  4BBS I;  1KD1 1;  3CCR Z;  1Y1V S;  2R6M A;  5FLM I;  5CM2 M;  4CL1 A;  4E30 A;  2JUB A;  3HOZ I;  1VQP 1;  4NB8 A;  1K8A 2;  2YU9 I;  2R7Z I;  4HH4 A;  3PO3 I;  3I4M I;  3CCU 1;  5IT9 b;  3CC2 1;  4RVD A;  2W04 A;  2KPI A;  4MD7 A;  2RHB A;  3IX0 A;  1NP6 A;  3K7A I;  1RLY A;  1I6H I;  1Z03 A;  3Q87 A;  3GTM S;  2E2J I;  2WB1 A;  1WW9 A;  2NVT I;  1VQM 1;  3CC7 Z;  1SFO I;  1Y1V I;  3H0G I;  4RV9 A;  1YI2 1;  4BY1 I;  3GTL I;  3CCR 1;  4MH4 A;  4A3F I;  1Q86 2;  4X6A I;  3J80 f;  4A3E I;  2QRE B;  2F4M A;  4QTT A;  3PO2 I;  3I56 Z;  3H3V J;  4BXX I;  2GTH A;  4E33 A;  3GTM I;  3VB9 A;  2QEX Z;  4BY7 I;  2QKD A;  4MON A;  3EED A;  3CC4 Z;  1VQL Z;  2Q4Z A;  3CC7 1;  3EER A;  1VLA A;  1KC8 1;  1KD1 2;  2WAQ A;  3VMI A;  5LL6 f;  3GKQ A;  4HGY A;  4BBR I;  5A2Q f;  3CD6 Z;  2RPR A;  1ZB8 A;  3OW2 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...