1VQ4Z

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4Z00
3CC7Z 3I56Z 3OW2Z 3CCRZ 1S72Z 3CCL1 2OTJZ 1VQ71 1Q812 1VQK1 2OTLZ 1VQPZ 1YIJZ 1M902 1VQ61 3CD61 1YJW1 3I55Z 3CCQ1 1VQO1 3CXCY 1QVGY 1QVFY 1VQ9Z 1VQ5Z 1YJNZ 1VQL1 1KD11 3G4SZ 1Q821 3I561 3CCU1 1KQSY 1Q7Y2 1YIJ1 3CCVZ 1K732 3CCS1 3CCLZ 2OTJ1 2QEX1 1VQKZ 3CMAZ 2QA41 3CC71 1N8R2 3I551 1M1K1 1JJ2Y 3CCR1 1K8A2 3CCJZ 1Q861 3CPWY 1NJI1 1K9M1 3CCQZ 3CCE1 3CC41 1YJN1 1KQSZ 3CCM1 1JJ2Z 3CMA1 1YHQZ 1VQ51 1KC82 3G6E1 1YJ91 3G4S1 3CC2Z 2QEXZ 2QA4Z 3G711 1YIT1 3CCEZ 1VQ41 3CCJ1 3CME1 1VQ81 1YI21 3CPWZ 1NJI2 1VQMZ 1VQNZ 1YHQ1 1Q862 1VQP1 1QVFZ 3CXCZ 1QVGZ 3G71Z 1YITZ 1K9M2 1VQOZ 1W2BY 3CC4Z 1KD12 3CMEZ 1YJWZ 3CCMZ 3OW2Y 1VQ4Z 1YI2Z 1Q811 1VQLZ 1VQ7Z 3CC21 1VQN1 1VQ8Z 3G6EZ 1YJ9Z 1VQ91 1S721 1Q7Y1 1W2BZ 1VQM1 1KC81 2OTL1 1N8R1 1M1K2 1M901 1VQ6Z 1Q822 3CD6Z 3CCUZ 3CCV1 3CCSZ 1K731 1K8A1
chains in the Genus database with same CATH superfamily
3I4MI 3GKQA 2DE6A 1PFTA 3IR7A 2WAQA 3OW2Z 1VQ71 1Q812 3HOYI 1VQK1 3IF8A 1K83I 1YIJZ 2NVQI 1Q16A 3PO3S 3CCQ1 2F4OA 1ML8A 2W04A 1TWAI 1R9TI 1VQ9Z 1VQ5Z 1VQL1 2V3VA 1KD11 2NVXI 2V8KA 3CCU1 2RIQA 3S16I 2YU9I 1YIJ1 3CCVZ 2OOYB 3EEDA 3ESWA 1VQKZ 3CMAZ 3S1QI 3CC71 3S1MI 5FLXf 1M1K1 2E9HA 2LEXA 2K3RA 5T6BA 3CCR1 3CCJZ 2LIYA 1SIWA 2V8JA 3CPWY 1ZB9A 3VB9A 2KI7B 1NJI1 2EGTA 2Q4ZA 4E31A 1Z03A 2VUGA 1YJN1 4E2YA 5A2Qf 3CMA1 3PO2I 1I6HI 5D1PA 3TDHB 1YJ91 4A3CI 3NH5A 2QKDA 2QA4Z 1N2FA 1TWCI 4A3GI 1VQ41 4A3LI 4S1TA 3J7A4 3CME1 3S14I 2I3CA 5FLXb 4E2XA 2JIRA 4MD7A 2E2JI 4BXXI 1VQP1 2NVTI 4A93I 1RNIA 3CMEZ 4HGYA 3GCFA 3NH4A 3OW2Y 1VQ4Z 3CC21 3G6EZ 1YUKA 5FLMI 5IP9I 4A3FI 3IFUA 1N8R1 3U50C 4E30A 5D1OA 3CCSZ 2JIQA 3VTNA 3J80b 2G2KA 2V8IA 4A3JI 3FQMA 3H0GI 1YJW1 1X0TA 2OZKA 4MD9A 2M48A 1VQO1 3CXCY 3F3FC 1QVGY 2VF1A 1QVFY 1USPB 3GTLI 4MXUA 1LQLA 4BBSI 3LUSA 3NDJA 3G4SZ 5LL6f 2IZ4A 4DQYB 2VPWA 1TWHI 1Q7Y2 3S15I 1K732 3HOVI 4BY1I 1N8R2 3D2LA 1JJ2Y 2JIMA 2PK7A 3T4NB 1WIIA 4NBGA 3HOXI 2DE7A 1WW9A 3NH8A 1FDIA 3CCQZ 2B63I 4DK1A 3GTKI 3J81f 1KQSZ 1JJ2Z 1RLYA 1VQ51 1KC82 1Z01A 2QEXZ 4NB9A 1YIT1 4NBAA 4MONA 3M3YI 1FDOA 2IV2X 2QRCB 1VQ81 4E2WA 3D9XA 4E2ZA 2RBLA 2YADA 3S1NI 3NFZA 2AKLA 2W03A 1TWGI 1YITZ 2VPYA 2HU9A 1WJ2A 3QWUA 1W2BY 2Q51A 4RVDA 3BG1B 1VQ8Z 1QF8A 4A3EI 1YJ9Z 1VQ91 1KC81 2J6AA 4A3II 3RZDI 1WCMI 2KPIA 1M901 1NUIA 2RPRA 3CD6Z 3CCUZ 3CCV1 1S7MA 3HOUI 2NAPA 3J80f 2JIPA 1K731 3M4OI 4E32A 3CC7Z 3MZKB 2VPZA 3CCRZ 3RZOI 2LFUA 3CCL1 2JR6A 1VQPZ 5C4XI 3FQQA 3CD61 3NDIA 3H3VJ 3I55Z 2R7ZI 4NBBA 2E2HI 3P5JB 1TWFI 4QTTA 1YJNZ 2R93I 3S2DI 1Q821 2IZ3A 2GU2A 4NBEA 1KQSY 1QYPA 4XX2A 4BBRI 2VUMI 4NOZA 3CCLZ 4NB8A 3GTMI 1AA6A 5IT9b 2QA41 2R6MA 5T64A 3I551 2VPXA 2E2II 2O4HA 4HH4A 1JWHC 3GTOI 1Q861 1KRLA 1RO4A 2HF1A 2NVYI 3I4NI 1K9M1 3K7AI 4NFRA 4A3KI 1P9NA 2BJOA 4RV9A 3CCE1 3GTQI 4RVGA 3CC41 3EERA 1X3ZA 3CCM1 1YHQZ 2R92I 3G4S1 2E7ZA 1ZH1A 2OOXB 3CC2Z 2PM9A 3G711 3CCEZ 3CCJ1 1Y8CA 3VMHA 2JA7I 2DE5A 3I07A 3S2HI 1QXFA 2RHBA 3CPWZ 3HKZA 5IT9f 1VQMZ 4MD8A 2JA6I 1YHQ1 4RS4A 1Q862 4Y52I 4A3BI 2P28A 1Y1VI 1Z02A 3G71Z 3MZLB 2QREB 3Q87A 4E33A 3MONA 1Y1VS 2V45A 1YJWZ 1VQLZ 3S17I 4AYBA 1S721 3GTGI 1W2BZ 1VQM1 2OTL1 1VQ6Z 1Q822 3FKII 3GTJI 1K8A1 4BY7I 4MH4A 3JAMb 5T67A 3I56Z 2H85A 1I3QI 3JAMf 2Y0SA 1S72Z 2OTJZ 2OTLZ 1TFIA 1M902 1RQFA 3F3PC 1VQ61 2F4MA 5C4JI 2JA8I 3BG0B 4A3DI 3HOWI 5CM2M 2WB1A 3S1RI 2JS4A 5C44I 2PMZA 4Y7NI 2GTHA 3I561 3CQZI 1Y1WI 1I50I 2K5RA 2QLVB 3CCS1 2OTJ1 2QEX1 3GTMS 3IX0A 1NP6A 4NBHA 2JUBA 3KIFA 3J81b 4MRIA 1K8A2 5IP7I 4TNUA 1YUAA 5C3EI 2O53A 1SFOI 3KIHA 3VMGA 2JMOA 5AN9F 3G6E1 4X6AI 2RT9A 5A2Qb 2P3YA 1X3WA 4NBFA 1RO0A 2QRDB 5D1OB 3D6WA 3PO3I 4NH1C 1YI21 2JA5I 1NJI2 3GTPI 1VQNZ 2ZAEB 1L1OC 4RVFA 1VLAA 1QVFZ 3CXCZ 1QVGZ 1K9M2 3VMIA 4CL1A 1VQOZ 4NBCA 3CC4Z 4NBDA 1KD12 4A3MI 3CCMZ 1WZNA 1USPA 2GTIA 1DL6A 1YI2Z 1Q811 1VQ7Z 1VQN1 4RVHA 1RO2A 1Q7Y1 2M6NA 1M1K2 2QR1B 4HGZA 3HOZI 4DGLA 2JIOA 1ZB8A 2AYDA 4QTUA 2JNYA 4EWCA 3TE5B
chains in the Genus database with same CATH topology
3I4MI 3GKQA 2DE6A 1PFTA 2WAQA 3OW2Z 1VQ71 1Q812 3HOYI 1VQK1 3IF8A 1K83I 1YIJZ 2NVQI 3PO3S 3CCQ1 2F4OA 1ML8A 2W04A 1TWAI 1R9TI 1VQ9Z 1VQ5Z 1VQL1 1KD11 2NVXI 2V8KA 3CCU1 2RIQA 3S16I 2YU9I 1YIJ1 3CCVZ 2OOYB 3EEDA 3ESWA 1VQKZ 3CMAZ 3S1QI 3CC71 3S1MI 5FLXf 1M1K1 2E9HA 2K3RA 5T6BA 3CCR1 3CCJZ 2LIYA 2V8JA 3CPWY 1ZB9A 3VB9A 2KI7B 1NJI1 2EGTA 2Q4ZA 4E31A 1Z03A 2VUGA 1YJN1 4E2YA 5A2Qf 3CMA1 3PO2I 1I6HI 5D1PA 3TDHB 1YJ91 4A3CI 3NH5A 2QKDA 2QA4Z 1N2FA 1TWCI 4A3GI 1VQ41 4A3LI 4S1TA 3J7A4 3CME1 3S14I 2I3CA 5FLXb 4E2XA 4MD7A 2E2JI 4BXXI 1VQP1 2NVTI 4A93I 1RNIA 3CMEZ 4HGYA 3GCFA 3NH4A 3OW2Y 1VQ4Z 3CC21 3G6EZ 1YUKA 5FLMI 5IP9I 4A3FI 3IFUA 1N8R1 3U50C 4E30A 5D1OA 3CCSZ 3VTNA 3J80b 2G2KA 2V8IA 4A3JI 3FQMA 3H0GI 1YJW1 1X0TA 2OZKA 4MD9A 2M48A 1VQO1 3CXCY 3F3FC 1QVGY 2VF1A 1QVFY 1USPB 3GTLI 4MXUA 1LQLA 4BBSI 3LUSA 3NDJA 3G4SZ 5LL6f 2IZ4A 4DQYB 1TWHI 1Q7Y2 3S15I 1K732 3HOVI 4BY1I 1N8R2 1JJ2Y 2PK7A 3T4NB 1WIIA 4NBGA 3HOXI 2DE7A 1WW9A 3NH8A 3CCQZ 2B63I 4DK1A 3GTKI 3J81f 1KQSZ 1JJ2Z 1RLYA 1VQ51 1KC82 1Z01A 2QEXZ 4NB9A 1YIT1 4NBAA 4MONA 3M3YI 2QRCB 1VQ81 4E2WA 3D9XA 4E2ZA 2RBLA 2YADA 3S1NI 3NFZA 2AKLA 2W03A 1TWGI 1YITZ 2HU9A 3QWUA 1W2BY 2Q51A 4RVDA 3BG1B 1VQ8Z 1QF8A 4A3EI 1YJ9Z 1VQ91 1KC81 2J6AA 4A3II 3RZDI 1WCMI 2KPIA 1M901 1NUIA 2RPRA 3CD6Z 3CCUZ 3CCV1 1S7MA 3HOUI 3J80f 1K731 3M4OI 4E32A 3CC7Z 3MZKB 3CCRZ 3RZOI 2LFUA 3CCL1 2JR6A 1VQPZ 5C4XI 3FQQA 3CD61 3NDIA 3H3VJ 3I55Z 2R7ZI 4NBBA 2E2HI 3P5JB 1TWFI 4QTTA 1YJNZ 2R93I 3S2DI 1Q821 2IZ3A 2GU2A 4NBEA 1KQSY 1QYPA 4XX2A 4BBRI 2VUMI 4NOZA 3CCLZ 4NB8A 3GTMI 5IT9b 2QA41 2R6MA 5T64A 3I551 2E2II 2O4HA 4HH4A 1JWHC 3GTOI 1Q861 1KRLA 1RO4A 2HF1A 2NVYI 3I4NI 1K9M1 3K7AI 4NFRA 4A3KI 1P9NA 2BJOA 4RV9A 3CCE1 3GTQI 4RVGA 3CC41 3EERA 1X3ZA 3CCM1 1YHQZ 2R92I 3G4S1 1ZH1A 2OOXB 3CC2Z 2PM9A 3G711 3CCEZ 3CCJ1 3VMHA 2JA7I 2DE5A 3I07A 3S2HI 2RHBA 3CPWZ 3HKZA 5IT9f 1VQMZ 4MD8A 2JA6I 1YHQ1 4RS4A 1Q862 4Y52I 4A3BI 2P28A 1Y1VI 1Z02A 3G71Z 3MZLB 2QREB 3Q87A 4E33A 3MONA 1Y1VS 1YJWZ 1VQLZ 3S17I 4AYBA 1S721 3GTGI 1W2BZ 1VQM1 2OTL1 1VQ6Z 1Q822 3FKII 3GTJI 1K8A1 4BY7I 4MH4A 3JAMb 5T67A 3I56Z 2H85A 1I3QI 3JAMf 2Y0SA 1S72Z 2OTJZ 2OTLZ 1TFIA 1M902 1RQFA 3F3PC 1VQ61 2F4MA 5C4JI 2JA8I 3BG0B 4A3DI 3HOWI 5CM2M 2WB1A 3S1RI 2JS4A 5C44I 2PMZA 4Y7NI 2GTHA 3I561 3CQZI 1Y1WI 1I50I 2K5RA 2QLVB 3CCS1 2OTJ1 2QEX1 3GTMS 3IX0A 1NP6A 4NBHA 2JUBA 3KIFA 3J81b 4MRIA 1K8A2 5IP7I 4TNUA 1YUAA 5C3EI 2O53A 1SFOI 3KIHA 3VMGA 2JMOA 5AN9F 3G6E1 4X6AI 2RT9A 5A2Qb 2P3YA 1X3WA 4NBFA 1RO0A 2QRDB 5D1OB 3D6WA 3PO3I 4NH1C 1YI21 2JA5I 1NJI2 3GTPI 1VQNZ 2ZAEB 1L1OC 4RVFA 1VLAA 1QVFZ 3CXCZ 1QVGZ 1K9M2 3VMIA 4CL1A 1VQOZ 4NBCA 3CC4Z 4NBDA 1KD12 4A3MI 3CCMZ 1USPA 2GTIA 1DL6A 1YI2Z 1Q811 1VQ7Z 1VQN1 4RVHA 1RO2A 1Q7Y1 2M6NA 1M1K2 2QR1B 4HGZA 3HOZI 4DGLA 1ZB8A 4QTUA 2JNYA 4EWCA 3TE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 Z;  3I56 Z;  3OW2 Z;  3CCR Z;  1S72 Z;  3CCL 1;  2OTJ Z;  1VQ7 1;  1Q81 2;  1VQK 1;  2OTL Z;  1VQP Z;  1YIJ Z;  1M90 2;  1VQ6 1;  3CD6 1;  1YJW 1;  3I55 Z;  3CCQ 1;  1VQO 1;  3CXC Y;  1QVG Y;  1QVF Y;  1VQ9 Z;  1VQ5 Z;  1YJN Z;  1VQL 1;  1KD1 1;  3G4S Z;  1Q82 1;  3I56 1;  3CCU 1;  1KQS Y;  1Q7Y 2;  1YIJ 1;  3CCV Z;  1K73 2;  3CCS 1;  3CCL Z;  2OTJ 1;  2QEX 1;  1VQK Z;  3CMA Z;  2QA4 1;  3CC7 1;  1N8R 2;  3I55 1;  1M1K 1;  1JJ2 Y;  3CCR 1;  1K8A 2;  3CCJ Z;  1Q86 1;  3CPW Y;  1NJI 1;  1K9M 1;  3CCQ Z;  3CCE 1;  3CC4 1;  1YJN 1;  1KQS Z;  3CCM 1;  1JJ2 Z;  3CMA 1;  1YHQ Z;  1VQ5 1;  1KC8 2;  3G6E 1;  1YJ9 1;  3G4S 1;  3CC2 Z;  2QEX Z;  2QA4 Z;  3G71 1;  1YIT 1;  3CCE Z;  1VQ4 1;  3CCJ 1;  3CME 1;  1VQ8 1;  1YI2 1;  3CPW Z;  1NJI 2;  1VQM Z;  1VQN Z;  1YHQ 1;  1Q86 2;  1VQP 1;  1QVF Z;  3CXC Z;  1QVG Z;  3G71 Z;  1YIT Z;  1K9M 2;  1VQO Z;  1W2B Y;  3CC4 Z;  1KD1 2;  3CME Z;  1YJW Z;  3CCM Z;  3OW2 Y;  1VQ4 Z;  1YI2 Z;  1Q81 1;  1VQL Z;  1VQ7 Z;  3CC2 1;  1VQN 1;  1VQ8 Z;  3G6E Z;  1YJ9 Z;  1VQ9 1;  1S72 1;  1Q7Y 1;  1W2B Z;  1VQM 1;  1KC8 1;  2OTL 1;  1N8R 1;  1M1K 2;  1M90 1;  1VQ6 Z;  1Q82 2;  3CD6 Z;  3CCU Z;  3CCV 1;  3CCS Z;  1K73 1;  1K8A 1; 
#chains in the Genus database with same CATH topology
 3I4M I;  3GKQ A;  2DE6 A;  1PFT A;  3IR7 A;  2WAQ A;  3OW2 Z;  1VQ7 1;  1Q81 2;  3HOY I;  1VQK 1;  3IF8 A;  1K83 I;  1YIJ Z;  2NVQ I;  1Q16 A;  3PO3 S;  3CCQ 1;  2F4O A;  1ML8 A;  2W04 A;  1TWA I;  1R9T I;  1VQ9 Z;  1VQ5 Z;  1VQL 1;  2V3V A;  1KD1 1;  2NVX I;  2V8K A;  3CCU 1;  2RIQ A;  3S16 I;  2YU9 I;  1YIJ 1;  3CCV Z;  2OOY B;  3EED A;  3ESW A;  1VQK Z;  3CMA Z;  3S1Q I;  3CC7 1;  3S1M I;  5FLX f;  1M1K 1;  2E9H A;  2LEX A;  2K3R A;  5T6B A;  3CCR 1;  3CCJ Z;  2LIY A;  1SIW A;  2V8J A;  3CPW Y;  1ZB9 A;  3VB9 A;  2KI7 B;  1NJI 1;  2EGT A;  2Q4Z A;  4E31 A;  1Z03 A;  2VUG A;  1YJN 1;  4E2Y A;  5A2Q f;  3CMA 1;  3PO2 I;  1I6H I;  5D1P A;  3TDH B;  1YJ9 1;  4A3C I;  3NH5 A;  2QKD A;  2QA4 Z;  1N2F A;  1TWC I;  4A3G I;  1VQ4 1;  4A3L I;  4S1T A;  3J7A 4;  3CME 1;  3S14 I;  2I3C A;  5FLX b;  4E2X A;  2JIR A;  4MD7 A;  2E2J I;  4BXX I;  1VQP 1;  2NVT I;  4A93 I;  1RNI A;  3CME Z;  4HGY A;  3GCF A;  3NH4 A;  3OW2 Y;  1VQ4 Z;  3CC2 1;  3G6E Z;  1YUK A;  5FLM I;  5IP9 I;  4A3F I;  3IFU A;  1N8R 1;  3U50 C;  4E30 A;  5D1O A;  3CCS Z;  2JIQ A;  3VTN A;  3J80 b;  2G2K A;  2V8I A;  4A3J I;  3FQM A;  3H0G I;  1YJW 1;  1X0T A;  2OZK A;  4MD9 A;  2M48 A;  1VQO 1;  3CXC Y;  3F3F C;  1QVG Y;  2VF1 A;  1QVF Y;  1USP B;  3GTL I;  4MXU A;  1LQL A;  4BBS I;  3LUS A;  3NDJ A;  3G4S Z;  5LL6 f;  2IZ4 A;  4DQY B;  2VPW A;  1TWH I;  1Q7Y 2;  3S15 I;  1K73 2;  3HOV I;  4BY1 I;  1N8R 2;  3D2L A;  1JJ2 Y;  2JIM A;  2PK7 A;  3T4N B;  1WII A;  4NBG A;  3HOX I;  2DE7 A;  1WW9 A;  3NH8 A;  1FDI A;  3CCQ Z;  2B63 I;  4DK1 A;  3GTK I;  3J81 f;  1KQS Z;  1JJ2 Z;  1RLY A;  1VQ5 1;  1KC8 2;  1Z01 A;  2QEX Z;  4NB9 A;  1YIT 1;  4NBA A;  4MON A;  3M3Y I;  1FDO A;  2IV2 X;  2QRC B;  1VQ8 1;  4E2W A;  3D9X A;  4E2Z A;  2RBL A;  2YAD A;  3S1N I;  3NFZ A;  2AKL A;  2W03 A;  1TWG I;  1YIT Z;  2VPY A;  2HU9 A;  1WJ2 A;  3QWU A;  1W2B Y;  2Q51 A;  4RVD A;  3BG1 B;  1VQ8 Z;  1QF8 A;  4A3E I;  1YJ9 Z;  1VQ9 1;  1KC8 1;  2J6A A;  4A3I I;  3RZD I;  1WCM I;  2KPI A;  1M90 1;  1NUI A;  2RPR A;  3CD6 Z;  3CCU Z;  3CCV 1;  1S7M A;  3HOU I;  2NAP A;  3J80 f;  2JIP A;  1K73 1;  3M4O I;  4E32 A;  3CC7 Z;  3MZK B;  2VPZ A;  3CCR Z;  3RZO I;  2LFU A;  3CCL 1;  2JR6 A;  1VQP Z;  5C4X I;  3FQQ A;  3CD6 1;  3NDI A;  3H3V J;  3I55 Z;  2R7Z I;  4NBB A;  2E2H I;  3P5J B;  1TWF I;  4QTT A;  1YJN Z;  2R93 I;  3S2D I;  1Q82 1;  2IZ3 A;  2GU2 A;  4NBE A;  1KQS Y;  1QYP A;  4XX2 A;  4BBR I;  2VUM I;  4NOZ A;  3CCL Z;  4NB8 A;  3GTM I;  1AA6 A;  5IT9 b;  2QA4 1;  2R6M A;  5T64 A;  3I55 1;  2VPX A;  2E2I I;  2O4H A;  4HH4 A;  1JWH C;  3GTO I;  1Q86 1;  1KRL A;  1RO4 A;  2HF1 A;  2NVY I;  3I4N I;  1K9M 1;  3K7A I;  4NFR A;  4A3K I;  1P9N A;  2BJO A;  4RV9 A;  3CCE 1;  3GTQ I;  4RVG A;  3CC4 1;  3EER A;  1X3Z A;  3CCM 1;  1YHQ Z;  2R92 I;  3G4S 1;  2E7Z A;  1ZH1 A;  2OOX B;  3CC2 Z;  2PM9 A;  3G71 1;  3CCE Z;  3CCJ 1;  1Y8C A;  3VMH A;  2JA7 I;  2DE5 A;  3I07 A;  3S2H I;  1QXF A;  2RHB A;  3CPW Z;  3HKZ A;  5IT9 f;  1VQM Z;  4MD8 A;  2JA6 I;  1YHQ 1;  4RS4 A;  1Q86 2;  4Y52 I;  4A3B I;  2P28 A;  1Y1V I;  1Z02 A;  3G71 Z;  3MZL B;  2QRE B;  3Q87 A;  4E33 A;  3MON A;  1Y1V S;  2V45 A;  1YJW Z;  1VQL Z;  3S17 I;  4AYB A;  1S72 1;  3GTG I;  1W2B Z;  1VQM 1;  2OTL 1;  1VQ6 Z;  1Q82 2;  3FKI I;  3GTJ I;  1K8A 1;  4BY7 I;  4MH4 A;  3JAM b;  5T67 A;  3I56 Z;  2H85 A;  1I3Q I;  3JAM f;  2Y0S A;  1S72 Z;  2OTJ Z;  2OTL Z;  1TFI A;  1M90 2;  1RQF A;  3F3P C;  1VQ6 1;  2F4M A;  5C4J I;  2JA8 I;  3BG0 B;  4A3D I;  3HOW I;  5CM2 M;  2WB1 A;  3S1R I;  2JS4 A;  5C44 I;  2PMZ A;  4Y7N I;  2GTH A;  3I56 1;  3CQZ I;  1Y1W I;  1I50 I;  2K5R A;  2QLV B;  3CCS 1;  2OTJ 1;  2QEX 1;  3GTM S;  3IX0 A;  1NP6 A;  4NBH A;  2JUB A;  3KIF A;  3J81 b;  4MRI A;  1K8A 2;  5IP7 I;  4TNU A;  1YUA A;  5C3E I;  2O53 A;  1SFO I;  3KIH A;  3VMG A;  2JMO A;  5AN9 F;  3G6E 1;  4X6A I;  2RT9 A;  5A2Q b;  2P3Y A;  1X3W A;  4NBF A;  1RO0 A;  2QRD B;  5D1O B;  3D6W A;  3PO3 I;  4NH1 C;  1YI2 1;  2JA5 I;  1NJI 2;  3GTP I;  1VQN Z;  2ZAE B;  1L1O C;  4RVF A;  1VLA A;  1QVF Z;  3CXC Z;  1QVG Z;  1K9M 2;  3VMI A;  4CL1 A;  1VQO Z;  4NBC A;  3CC4 Z;  4NBD A;  1KD1 2;  4A3M I;  3CCM Z;  1WZN A;  1USP A;  2GTI A;  1DL6 A;  1YI2 Z;  1Q81 1;  1VQ7 Z;  1VQN 1;  4RVH A;  1RO2 A;  1Q7Y 1;  2M6N A;  1M1K 2;  2QR1 B;  4HGZ A;  3HOZ I;  4DGL A;  2JIO A;  1ZB8 A;  2AYD A;  4QTU A;  2JNY A;  4EWC A;  3TE5 B; 
#chains in the Genus database with same CATH homology
 3I4M I;  3GKQ A;  2DE6 A;  1PFT A;  2WAQ A;  3OW2 Z;  1VQ7 1;  1Q81 2;  3HOY I;  1VQK 1;  3IF8 A;  1K83 I;  1YIJ Z;  2NVQ I;  3PO3 S;  3CCQ 1;  2F4O A;  1ML8 A;  2W04 A;  1TWA I;  1R9T I;  1VQ9 Z;  1VQ5 Z;  1VQL 1;  1KD1 1;  2NVX I;  2V8K A;  3CCU 1;  2RIQ A;  3S16 I;  2YU9 I;  1YIJ 1;  3CCV Z;  2OOY B;  3EED A;  3ESW A;  1VQK Z;  3CMA Z;  3S1Q I;  3CC7 1;  3S1M I;  5FLX f;  1M1K 1;  2E9H A;  2K3R A;  5T6B A;  3CCR 1;  3CCJ Z;  2LIY A;  2V8J A;  3CPW Y;  1ZB9 A;  3VB9 A;  2KI7 B;  1NJI 1;  2EGT A;  2Q4Z A;  4E31 A;  1Z03 A;  2VUG A;  1YJN 1;  4E2Y A;  5A2Q f;  3CMA 1;  3PO2 I;  1I6H I;  5D1P A;  3TDH B;  1YJ9 1;  4A3C I;  3NH5 A;  2QKD A;  2QA4 Z;  1N2F A;  1TWC I;  4A3G I;  1VQ4 1;  4A3L I;  4S1T A;  3J7A 4;  3CME 1;  3S14 I;  2I3C A;  5FLX b;  4E2X A;  4MD7 A;  2E2J I;  4BXX I;  1VQP 1;  2NVT I;  4A93 I;  1RNI A;  3CME Z;  4HGY A;  3GCF A;  3NH4 A;  3OW2 Y;  1VQ4 Z;  3CC2 1;  3G6E Z;  1YUK A;  5FLM I;  5IP9 I;  4A3F I;  3IFU A;  1N8R 1;  3U50 C;  4E30 A;  5D1O A;  3CCS Z;  3VTN A;  3J80 b;  2G2K A;  2V8I A;  4A3J I;  3FQM A;  3H0G I;  1YJW 1;  1X0T A;  2OZK A;  4MD9 A;  2M48 A;  1VQO 1;  3CXC Y;  3F3F C;  1QVG Y;  2VF1 A;  1QVF Y;  1USP B;  3GTL I;  4MXU A;  1LQL A;  4BBS I;  3LUS A;  3NDJ A;  3G4S Z;  5LL6 f;  2IZ4 A;  4DQY B;  1TWH I;  1Q7Y 2;  3S15 I;  1K73 2;  3HOV I;  4BY1 I;  1N8R 2;  1JJ2 Y;  2PK7 A;  3T4N B;  1WII A;  4NBG A;  3HOX I;  2DE7 A;  1WW9 A;  3NH8 A;  3CCQ Z;  2B63 I;  4DK1 A;  3GTK I;  3J81 f;  1KQS Z;  1JJ2 Z;  1RLY A;  1VQ5 1;  1KC8 2;  1Z01 A;  2QEX Z;  4NB9 A;  1YIT 1;  4NBA A;  4MON A;  3M3Y I;  2QRC B;  1VQ8 1;  4E2W A;  3D9X A;  4E2Z A;  2RBL A;  2YAD A;  3S1N I;  3NFZ A;  2AKL A;  2W03 A;  1TWG I;  1YIT Z;  2HU9 A;  3QWU A;  1W2B Y;  2Q51 A;  4RVD A;  3BG1 B;  1VQ8 Z;  1QF8 A;  4A3E I;  1YJ9 Z;  1VQ9 1;  1KC8 1;  2J6A A;  4A3I I;  3RZD I;  1WCM I;  2KPI A;  1M90 1;  1NUI A;  2RPR A;  3CD6 Z;  3CCU Z;  3CCV 1;  1S7M A;  3HOU I;  3J80 f;  1K73 1;  3M4O I;  4E32 A;  3CC7 Z;  3MZK B;  3CCR Z;  3RZO I;  2LFU A;  3CCL 1;  2JR6 A;  1VQP Z;  5C4X I;  3FQQ A;  3CD6 1;  3NDI A;  3H3V J;  3I55 Z;  2R7Z I;  4NBB A;  2E2H I;  3P5J B;  1TWF I;  4QTT A;  1YJN Z;  2R93 I;  3S2D I;  1Q82 1;  2IZ3 A;  2GU2 A;  4NBE A;  1KQS Y;  1QYP A;  4XX2 A;  4BBR I;  2VUM I;  4NOZ A;  3CCL Z;  4NB8 A;  3GTM I;  5IT9 b;  2QA4 1;  2R6M A;  5T64 A;  3I55 1;  2E2I I;  2O4H A;  4HH4 A;  1JWH C;  3GTO I;  1Q86 1;  1KRL A;  1RO4 A;  2HF1 A;  2NVY I;  3I4N I;  1K9M 1;  3K7A I;  4NFR A;  4A3K I;  1P9N A;  2BJO A;  4RV9 A;  3CCE 1;  3GTQ I;  4RVG A;  3CC4 1;  3EER A;  1X3Z A;  3CCM 1;  1YHQ Z;  2R92 I;  3G4S 1;  1ZH1 A;  2OOX B;  3CC2 Z;  2PM9 A;  3G71 1;  3CCE Z;  3CCJ 1;  3VMH A;  2JA7 I;  2DE5 A;  3I07 A;  3S2H I;  2RHB A;  3CPW Z;  3HKZ A;  5IT9 f;  1VQM Z;  4MD8 A;  2JA6 I;  1YHQ 1;  4RS4 A;  1Q86 2;  4Y52 I;  4A3B I;  2P28 A;  1Y1V I;  1Z02 A;  3G71 Z;  3MZL B;  2QRE B;  3Q87 A;  4E33 A;  3MON A;  1Y1V S;  1YJW Z;  1VQL Z;  3S17 I;  4AYB A;  1S72 1;  3GTG I;  1W2B Z;  1VQM 1;  2OTL 1;  1VQ6 Z;  1Q82 2;  3FKI I;  3GTJ I;  1K8A 1;  4BY7 I;  4MH4 A;  3JAM b;  5T67 A;  3I56 Z;  2H85 A;  1I3Q I;  3JAM f;  2Y0S A;  1S72 Z;  2OTJ Z;  2OTL Z;  1TFI A;  1M90 2;  1RQF A;  3F3P C;  1VQ6 1;  2F4M A;  5C4J I;  2JA8 I;  3BG0 B;  4A3D I;  3HOW I;  5CM2 M;  2WB1 A;  3S1R I;  2JS4 A;  5C44 I;  2PMZ A;  4Y7N I;  2GTH A;  3I56 1;  3CQZ I;  1Y1W I;  1I50 I;  2K5R A;  2QLV B;  3CCS 1;  2OTJ 1;  2QEX 1;  3GTM S;  3IX0 A;  1NP6 A;  4NBH A;  2JUB A;  3KIF A;  3J81 b;  4MRI A;  1K8A 2;  5IP7 I;  4TNU A;  1YUA A;  5C3E I;  2O53 A;  1SFO I;  3KIH A;  3VMG A;  2JMO A;  5AN9 F;  3G6E 1;  4X6A I;  2RT9 A;  5A2Q b;  2P3Y A;  1X3W A;  4NBF A;  1RO0 A;  2QRD B;  5D1O B;  3D6W A;  3PO3 I;  4NH1 C;  1YI2 1;  2JA5 I;  1NJI 2;  3GTP I;  1VQN Z;  2ZAE B;  1L1O C;  4RVF A;  1VLA A;  1QVF Z;  3CXC Z;  1QVG Z;  1K9M 2;  3VMI A;  4CL1 A;  1VQO Z;  4NBC A;  3CC4 Z;  4NBD A;  1KD1 2;  4A3M I;  3CCM Z;  1USP A;  2GTI A;  1DL6 A;  1YI2 Z;  1Q81 1;  1VQ7 Z;  1VQN 1;  4RVH A;  1RO2 A;  1Q7Y 1;  2M6N A;  1M1K 2;  2QR1 B;  4HGZ A;  3HOZ I;  4DGL A;  1ZB8 A;  4QTU A;  2JNY A;  4EWC A;  3TE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...