1VQ4Z

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4Z00
1KC82 1K732 2OTLZ 1VQL1 1M901 1YJWZ 1VQMZ 1K9M2 3CCQ1 3CC7Z 1Q822 3CCU1 3CMAZ 1YITZ 1QVGY 2QEX1 1VQK1 1VQ51 3CCV1 2OTJ1 3I551 1YJNZ 1Q861 1Q7Y1 3G4S1 1Q811 3CC2Z 2QA4Z 1VQPZ 2OTL1 3CCM1 1YJ9Z 1VQM1 1KC81 3OW2Y 3CC71 1K731 1YIT1 1W2BZ 3CMA1 3CCJZ 3OW2Z 1K8A2 3CPWZ 1N8R2 1YJN1 1VQ7Z 1Q821 1K9M1 3CCLZ 1YI2Z 3CC21 2QA41 1VQP1 1VQOZ 1VQ8Z 3CD6Z 1KD12 1VQ4Z 1NJI2 1QVFZ 1S72Z 1YJ91 3CCRZ 1YIJZ 1VQNZ 1YJW1 1W2BY 3CCEZ 1VQ9Z 3CCJ1 3CPWY 1VQ71 1VQ6Z 3CCQZ 3CXCZ 1M1K2 1KQSZ 3CCL1 3CCSZ 1VQO1 1VQ81 2QEXZ 3CD61 1K8A1 1N8R1 1VQ41 3CCVZ 3I56Z 1QVFY 3G6EZ 1S721 1YHQZ 3CMEZ 3G4SZ 3CCR1 1JJ2Y 3CC4Z 1YIJ1 1M902 1KD11 1VQN1 3G71Z 1NJI1 3CCE1 1VQ91 3CCMZ 1JJ2Z 1VQLZ 1VQ61 3CXCY 1KQSY 3CCS1 1Q862 1Q7Y2 3I561 3G6E1 1YI21 3CCUZ 1Q812 1QVGZ 1YHQ1 1M1K1 3CME1 1VQKZ 1VQ5Z 3CC41 2OTJZ 3I55Z 3G711
chains in the Genus database with same CATH superfamily
3HOUI 1KC82 3D2LA 1K732 4MRIA 1USPB 2K5RA 3KIFA 2NAPA 2VUGA 2E7ZA 1YJWZ 3VMGA 2PK7A 1VQMZ 1Q822 3NDJA 3CMAZ 2LIYA 2QEX1 1VQ51 1WIIA 1QYPA 3PO3S 3CQZI 1YJNZ 1Q7Y1 5C44I 2RIQA 2LFUA 4RV9A 3J80f 2JIOA 4NFRA 2F4MA 3F3FC 4QTUA 2NVTI 2E2HI 4TNUA 3K7AI 1RLYA 2JA5I 1VQM1 2NVYI 3OW2Y 4A3LI 2QRDB 3CMA1 2E2JI 4HGYA 3MZLB 1YUKA 2DE5A 1K8A2 1N8R2 1YJN1 2V8KA 2Q51A 1X0TA 3CCLZ 1P9NA 2E9HA 4X6AI 1K83I 1NJI2 1S72Z 4CL1A 3D9XA 3VB9A 1Z01A 4MD8A 1YIJZ 2AYDA 3GTLI 4A3FI 3JAMf 1VQ6Z 3CCL1 2GU2A 1Q16A 2JNYA 2HF1A 2VPYA 1S721 5IT9b 5T6BA 2R7ZI 1YHQZ 3H3VJ 1YIJ1 1ZH1A 1JJ2Z 1TWAI 4A3MI 5IT9f 2Y0SA 4XX2A 1VQ61 4A3GI 2W03A 3S14I 3NH8A 3FKII 1Y1VS 1YHQ1 1VQKZ 1Y8CA 3P5JB 3I07A 1NP6A 1JWHC 2P3YA 3HOYI 5A2Qf 2J6AA 3D6WA 3S1QI 1K9M2 3CCQ1 4Y52I 4NBFA 1VQK1 4NB8A 2QKDA 3NFZA 3S2HI 1TFIA 2OOYB 2P28A 3J81b 4DGLA 4NBGA 2QA4Z 3I4NI 1VQPZ 4S1TA 2NVQI 2IV2X 2O53A 2LEXA 3S17I 3HOVI 4EWCA 2HU9A 4MXUA 3S1RI 3OW2Z 4NBDA 4HH4A 2JUBA 1DL6A 2V45A 2QA41 1VQP1 1VQOZ 3CD6Z 2JIRA 3GCFA 4Y7NI 1S7MA 1VQNZ 1YJW1 2ZAEB 4A3II 3IR7A 3CCEZ 4A3DI 3RZDI 2WB1A 4BY7I 2BJOA 4NBBA 2GTIA 4MD9A 5D1OB 3GTKI 3GTQI 2JS4A 3CXCZ 1VQO1 3CD61 4A3KI 3CCVZ 5FLXb 1RNIA 4RVHA 1X3ZA 3G4SZ 3VMHA 3GTMI 3HOZI 3S2DI 1KD11 1VQN1 2VF1A 3IX0A 4A93I 3CCE1 3CCMZ 1SIWA 5LL6f 3S16I 5FLXf 2PM9A 1USPA 1I6HI 1VLAA 5C3EI 3CXCY 1RO0A 1ML8A 1Z02A 2R92I 4E2WA 1SFOI 1QXFA 2H85A 1Q7Y2 2IZ4A 4NOZA 1M1K1 1WZNA 3NH5A 3I55Z 2GTHA 3RZOI 2VUMI 2OZKA 1Y1WI 1M901 3S1MI 4NBCA 1RO2A 4E32A 3MZKB 3VMIA 3BG1B 3FQMA 1FDIA 2B63I 1ZB8A 3EEDA 1LQLA 3I551 1Q861 2V8IA 1Q811 2YU9I 3J7A4 2DE6A 4DK1A 2KI7B 4A3JI 1PFTA 3VTNA 4BBRI 1YJ9Z 1WW9A 1KC81 1K731 3LUSA 4NBAA 1W2BZ 4A3EI 4QTTA 4NBHA 2VPXA 3CCJZ 4MH4A 2NVXI 3CPWZ 5FLMI 1VQ7Z 1Q821 4E2YA 2V3VA 4A3BI 2I3CA 2Q4ZA 1YI2Z 3TE5B 3NH4A 1VQ4Z 5CM2M 1WJ2A 1TWGI 2QREB 4NB9A 1YJ91 2JIQA 3NDIA 1W2BY 1TWHI 5IP7I 1KRLA 1I50I 3TDHB 3CCJ1 3J81f 3CPWY 2AKLA 1VQ71 5IP9I 1X3WA 1KQSZ 2PMZA 5T64A 2QEXZ 1K8A1 2G2KA 1N8R1 3GKQA 1VQ41 3I56Z 2R93I 2JA7I 1NUIA 2QLVB 1FDOA 2O4HA 1NJI1 4DQYB 3GTGI 4HGZA 3ESWA 1VQLZ 4NH1C 3GTOI 3T4NB 3J80b 1KQSY 1AA6A 3I561 3F3PC 3CCUZ 1QVGZ 2VPZA 3GTMS 2YADA 3EERA 3HKZA 4E2XA 2OTJZ 4E30A 3PO3I 4BXXI 1TWFI 1YUAA 2R6MA 2OTLZ 1VQL1 3GTPI 4BY1I 2V8JA 1WCMI 3HOWI 3BG0B 3CC7Z 2RT9A 2WAQA 3CCU1 3MONA 1YITZ 4AYBA 1QVGY 1N2FA 5AN9F 2JA8I 3CCV1 2OTJ1 2F4OA 3G4S1 3M4OI 2E2II 3CC2Z 2OTL1 2RPRA 5D1PA 1Z03A 3JAMb 3CCM1 3GTJI 4RS4A 2DE7A 2VPWA 4RVFA 3CC71 3FQQA 1R9TI 2EGTA 1YIT1 3PO2I 3KIHA 5D1OA 1K9M1 2RBLA 3CC21 4MD7A 1VQ8Z 4MONA 1KD12 1I3QI 1QVFZ 4RVGA 2KPIA 1RQFA 4A3CI 3H0GI 3CCRZ 2RHBA 3IF8A 1TWCI 1VQ9Z 1QF8A 2IZ3A 2JR6A 2QR1B 2W04A 2M6NA 5T67A 3I4MI 3HOXI 2OOXB 3CCQZ 2JIPA 1M1K2 3CCSZ 3S1NI 1VQ81 1QVFY 3G6EZ 5C4XI 5A2Qb 3CMEZ 3CCR1 1Y1VI 3U50C 1JJ2Y 3CC4Z 1ZB9A 1M902 2JA6I 3G71Z 2JIMA 3Q87A 1VQ91 4RVDA 5C4JI 3QWUA 4E2ZA 3M3YI 3CCS1 4NBEA 4E31A 1Q862 3G6E1 1YI21 2K3RA 1Q812 2JMOA 1L1OC 4BBSI 3CME1 1VQ5Z 3IFUA 4E33A 3CC41 2QRCB 3S15I 3G711 2M48A 1RO4A
chains in the Genus database with same CATH topology
3HOUI 1KC82 1K732 4MRIA 1USPB 2K5RA 3KIFA 2VUGA 1YJWZ 3VMGA 2PK7A 1VQMZ 1Q822 3NDJA 3CMAZ 2LIYA 2QEX1 1VQ51 1WIIA 1QYPA 3PO3S 3CQZI 1YJNZ 1Q7Y1 5C44I 2RIQA 2LFUA 4RV9A 3J80f 4NFRA 2F4MA 3F3FC 4QTUA 2NVTI 2E2HI 4TNUA 3K7AI 1RLYA 2JA5I 1VQM1 2NVYI 3OW2Y 4A3LI 2QRDB 3CMA1 2E2JI 4HGYA 3MZLB 1YUKA 2DE5A 1K8A2 1N8R2 1YJN1 2V8KA 2Q51A 1X0TA 3CCLZ 1P9NA 2E9HA 4X6AI 1K83I 1NJI2 1S72Z 4CL1A 3D9XA 3VB9A 1Z01A 4MD8A 1YIJZ 3GTLI 4A3FI 3JAMf 1VQ6Z 3CCL1 2GU2A 2JNYA 2HF1A 1S721 5IT9b 5T6BA 2R7ZI 1YHQZ 3H3VJ 1YIJ1 1ZH1A 1JJ2Z 1TWAI 4A3MI 5IT9f 2Y0SA 4XX2A 1VQ61 4A3GI 2W03A 3S14I 3NH8A 3FKII 1Y1VS 1YHQ1 1VQKZ 3P5JB 3I07A 1NP6A 1JWHC 2P3YA 3HOYI 5A2Qf 2J6AA 3D6WA 3S1QI 1K9M2 3CCQ1 4Y52I 4NBFA 1VQK1 4NB8A 2QKDA 3NFZA 3S2HI 1TFIA 2OOYB 2P28A 3J81b 4DGLA 4NBGA 2QA4Z 3I4NI 1VQPZ 4S1TA 2NVQI 2O53A 3S17I 3HOVI 4EWCA 2HU9A 4MXUA 3S1RI 3OW2Z 4NBDA 4HH4A 2JUBA 1DL6A 2QA41 1VQP1 1VQOZ 3CD6Z 3GCFA 4Y7NI 1S7MA 1VQNZ 1YJW1 2ZAEB 4A3II 3CCEZ 4A3DI 3RZDI 2WB1A 4BY7I 2BJOA 4NBBA 2GTIA 4MD9A 5D1OB 3GTKI 3GTQI 2JS4A 3CXCZ 1VQO1 3CD61 4A3KI 3CCVZ 5FLXb 1RNIA 4RVHA 1X3ZA 3G4SZ 3VMHA 3GTMI 3HOZI 3S2DI 1KD11 1VQN1 2VF1A 3IX0A 4A93I 3CCE1 3CCMZ 5LL6f 3S16I 5FLXf 2PM9A 1USPA 1I6HI 1VLAA 5C3EI 3CXCY 1RO0A 1ML8A 1Z02A 2R92I 4E2WA 1SFOI 2H85A 1Q7Y2 2IZ4A 4NOZA 1M1K1 3NH5A 3I55Z 2GTHA 3RZOI 2VUMI 2OZKA 1Y1WI 1M901 3S1MI 4NBCA 1RO2A 4E32A 3MZKB 3VMIA 3BG1B 3FQMA 2B63I 1ZB8A 3EEDA 1LQLA 3I551 1Q861 2V8IA 1Q811 2YU9I 3J7A4 2DE6A 4DK1A 2KI7B 4A3JI 1PFTA 3VTNA 4BBRI 1YJ9Z 1WW9A 1KC81 1K731 3LUSA 4NBAA 1W2BZ 4A3EI 4QTTA 4NBHA 3CCJZ 2NVXI 4MH4A 3CPWZ 5FLMI 1VQ7Z 1Q821 4E2YA 4A3BI 2I3CA 2Q4ZA 1YI2Z 3TE5B 3NH4A 1VQ4Z 5CM2M 1TWGI 2QREB 4NB9A 1YJ91 3NDIA 1W2BY 1TWHI 5IP7I 1KRLA 1I50I 3TDHB 3CCJ1 3J81f 3CPWY 2AKLA 1VQ71 5IP9I 1X3WA 1KQSZ 2PMZA 5T64A 2QEXZ 1K8A1 2G2KA 1N8R1 3GKQA 1VQ41 3I56Z 2R93I 2JA7I 1NUIA 2QLVB 2O4HA 1NJI1 4DQYB 3GTGI 4HGZA 3ESWA 1VQLZ 4NH1C 3GTOI 3T4NB 3J80b 1KQSY 3I561 3F3PC 3CCUZ 1QVGZ 3GTMS 2YADA 3EERA 3HKZA 4E2XA 2OTJZ 4E30A 3PO3I 4BXXI 1TWFI 1YUAA 2R6MA 2OTLZ 1VQL1 3GTPI 4BY1I 2V8JA 1WCMI 3HOWI 3BG0B 3CC7Z 2RT9A 2WAQA 3CCU1 3MONA 1YITZ 4AYBA 1QVGY 1N2FA 5AN9F 2JA8I 3CCV1 2OTJ1 2F4OA 3G4S1 3M4OI 2E2II 3CC2Z 2OTL1 2RPRA 5D1PA 1Z03A 3JAMb 3CCM1 3GTJI 4RS4A 2DE7A 4RVFA 3CC71 3FQQA 1R9TI 2EGTA 1YIT1 3PO2I 3KIHA 5D1OA 1K9M1 2RBLA 3CC21 4MD7A 1VQ8Z 4MONA 1KD12 1I3QI 1QVFZ 4RVGA 2KPIA 1RQFA 4A3CI 3H0GI 3CCRZ 2RHBA 3IF8A 1TWCI 1VQ9Z 1QF8A 2IZ3A 2JR6A 2QR1B 2W04A 2M6NA 5T67A 3I4MI 3HOXI 2OOXB 3CCQZ 1M1K2 3CCSZ 3S1NI 1VQ81 1QVFY 3G6EZ 5C4XI 5A2Qb 3CMEZ 3CCR1 1Y1VI 3U50C 1JJ2Y 3CC4Z 1ZB9A 1M902 2JA6I 3G71Z 3Q87A 1VQ91 4RVDA 5C4JI 3QWUA 4E2ZA 3M3YI 3CCS1 4NBEA 4E31A 1Q862 3G6E1 1YI21 2K3RA 1Q812 2JMOA 1L1OC 4BBSI 3CME1 1VQ5Z 3IFUA 4E33A 3CC41 2QRCB 3S15I 3G711 2M48A 1RO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 2;  1K73 2;  2OTL Z;  1VQL 1;  1M90 1;  1YJW Z;  1VQM Z;  1K9M 2;  3CCQ 1;  3CC7 Z;  1Q82 2;  3CCU 1;  3CMA Z;  1YIT Z;  1QVG Y;  2QEX 1;  1VQK 1;  1VQ5 1;  3CCV 1;  2OTJ 1;  3I55 1;  1YJN Z;  1Q86 1;  1Q7Y 1;  3G4S 1;  1Q81 1;  3CC2 Z;  2QA4 Z;  1VQP Z;  2OTL 1;  3CCM 1;  1YJ9 Z;  1VQM 1;  1KC8 1;  3OW2 Y;  3CC7 1;  1K73 1;  1YIT 1;  1W2B Z;  3CMA 1;  3CCJ Z;  3OW2 Z;  1K8A 2;  3CPW Z;  1N8R 2;  1YJN 1;  1VQ7 Z;  1Q82 1;  1K9M 1;  3CCL Z;  1YI2 Z;  3CC2 1;  2QA4 1;  1VQP 1;  1VQO Z;  1VQ8 Z;  3CD6 Z;  1KD1 2;  1VQ4 Z;  1NJI 2;  1QVF Z;  1S72 Z;  1YJ9 1;  3CCR Z;  1YIJ Z;  1VQN Z;  1YJW 1;  1W2B Y;  3CCE Z;  1VQ9 Z;  3CCJ 1;  3CPW Y;  1VQ7 1;  1VQ6 Z;  3CCQ Z;  3CXC Z;  1M1K 2;  1KQS Z;  3CCL 1;  3CCS Z;  1VQO 1;  1VQ8 1;  2QEX Z;  3CD6 1;  1K8A 1;  1N8R 1;  1VQ4 1;  3CCV Z;  3I56 Z;  1QVF Y;  3G6E Z;  1S72 1;  1YHQ Z;  3CME Z;  3G4S Z;  3CCR 1;  1JJ2 Y;  3CC4 Z;  1YIJ 1;  1M90 2;  1KD1 1;  1VQN 1;  3G71 Z;  1NJI 1;  3CCE 1;  1VQ9 1;  3CCM Z;  1JJ2 Z;  1VQL Z;  1VQ6 1;  3CXC Y;  1KQS Y;  3CCS 1;  1Q86 2;  1Q7Y 2;  3I56 1;  3G6E 1;  1YI2 1;  3CCU Z;  1Q81 2;  1QVG Z;  1YHQ 1;  1M1K 1;  3CME 1;  1VQK Z;  1VQ5 Z;  3CC4 1;  2OTJ Z;  3I55 Z;  3G71 1; 
#chains in the Genus database with same CATH topology
 3HOU I;  1KC8 2;  3D2L A;  1K73 2;  4MRI A;  1USP B;  2K5R A;  3KIF A;  2NAP A;  2VUG A;  2E7Z A;  1YJW Z;  3VMG A;  2PK7 A;  1VQM Z;  1Q82 2;  3NDJ A;  3CMA Z;  2LIY A;  2QEX 1;  1VQ5 1;  1WII A;  1QYP A;  3PO3 S;  3CQZ I;  1YJN Z;  1Q7Y 1;  5C44 I;  2RIQ A;  2LFU A;  4RV9 A;  3J80 f;  2JIO A;  4NFR A;  2F4M A;  3F3F C;  4QTU A;  2NVT I;  2E2H I;  4TNU A;  3K7A I;  1RLY A;  2JA5 I;  1VQM 1;  2NVY I;  3OW2 Y;  4A3L I;  2QRD B;  3CMA 1;  2E2J I;  4HGY A;  3MZL B;  1YUK A;  2DE5 A;  1K8A 2;  1N8R 2;  1YJN 1;  2V8K A;  2Q51 A;  1X0T A;  3CCL Z;  1P9N A;  2E9H A;  4X6A I;  1K83 I;  1NJI 2;  1S72 Z;  4CL1 A;  3D9X A;  3VB9 A;  1Z01 A;  4MD8 A;  1YIJ Z;  2AYD A;  3GTL I;  4A3F I;  3JAM f;  1VQ6 Z;  3CCL 1;  2GU2 A;  1Q16 A;  2JNY A;  2HF1 A;  2VPY A;  1S72 1;  5IT9 b;  5T6B A;  2R7Z I;  1YHQ Z;  3H3V J;  1YIJ 1;  1ZH1 A;  1JJ2 Z;  1TWA I;  4A3M I;  5IT9 f;  2Y0S A;  4XX2 A;  1VQ6 1;  4A3G I;  2W03 A;  3S14 I;  3NH8 A;  3FKI I;  1Y1V S;  1YHQ 1;  1VQK Z;  1Y8C A;  3P5J B;  3I07 A;  1NP6 A;  1JWH C;  2P3Y A;  3HOY I;  5A2Q f;  2J6A A;  3D6W A;  3S1Q I;  1K9M 2;  3CCQ 1;  4Y52 I;  4NBF A;  1VQK 1;  4NB8 A;  2QKD A;  3NFZ A;  3S2H I;  1TFI A;  2OOY B;  2P28 A;  3J81 b;  4DGL A;  4NBG A;  2QA4 Z;  3I4N I;  1VQP Z;  4S1T A;  2NVQ I;  2IV2 X;  2O53 A;  2LEX A;  3S17 I;  3HOV I;  4EWC A;  2HU9 A;  4MXU A;  3S1R I;  3OW2 Z;  4NBD A;  4HH4 A;  2JUB A;  1DL6 A;  2V45 A;  2QA4 1;  1VQP 1;  1VQO Z;  3CD6 Z;  2JIR A;  3GCF A;  4Y7N I;  1S7M A;  1VQN Z;  1YJW 1;  2ZAE B;  4A3I I;  3IR7 A;  3CCE Z;  4A3D I;  3RZD I;  2WB1 A;  4BY7 I;  2BJO A;  4NBB A;  2GTI A;  4MD9 A;  5D1O B;  3GTK I;  3GTQ I;  2JS4 A;  3CXC Z;  1VQO 1;  3CD6 1;  4A3K I;  3CCV Z;  5FLX b;  1RNI A;  4RVH A;  1X3Z A;  3G4S Z;  3VMH A;  3GTM I;  3HOZ I;  3S2D I;  1KD1 1;  1VQN 1;  2VF1 A;  3IX0 A;  4A93 I;  3CCE 1;  3CCM Z;  1SIW A;  5LL6 f;  3S16 I;  5FLX f;  2PM9 A;  1USP A;  1I6H I;  1VLA A;  5C3E I;  3CXC Y;  1RO0 A;  1ML8 A;  1Z02 A;  2R92 I;  4E2W A;  1SFO I;  1QXF A;  2H85 A;  1Q7Y 2;  2IZ4 A;  4NOZ A;  1M1K 1;  1WZN A;  3NH5 A;  3I55 Z;  2GTH A;  3RZO I;  2VUM I;  2OZK A;  1Y1W I;  1M90 1;  3S1M I;  4NBC A;  1RO2 A;  4E32 A;  3MZK B;  3VMI A;  3BG1 B;  3FQM A;  1FDI A;  2B63 I;  1ZB8 A;  3EED A;  1LQL A;  3I55 1;  1Q86 1;  2V8I A;  1Q81 1;  2YU9 I;  3J7A 4;  2DE6 A;  4DK1 A;  2KI7 B;  4A3J I;  1PFT A;  3VTN A;  4BBR I;  1YJ9 Z;  1WW9 A;  1KC8 1;  1K73 1;  3LUS A;  4NBA A;  1W2B Z;  4A3E I;  4QTT A;  4NBH A;  2VPX A;  3CCJ Z;  4MH4 A;  2NVX I;  3CPW Z;  5FLM I;  1VQ7 Z;  1Q82 1;  4E2Y A;  2V3V A;  4A3B I;  2I3C A;  2Q4Z A;  1YI2 Z;  3TE5 B;  3NH4 A;  1VQ4 Z;  5CM2 M;  1WJ2 A;  1TWG I;  2QRE B;  4NB9 A;  1YJ9 1;  2JIQ A;  3NDI A;  1W2B Y;  1TWH I;  5IP7 I;  1KRL A;  1I50 I;  3TDH B;  3CCJ 1;  3J81 f;  3CPW Y;  2AKL A;  1VQ7 1;  5IP9 I;  1X3W A;  1KQS Z;  2PMZ A;  5T64 A;  2QEX Z;  1K8A 1;  2G2K A;  1N8R 1;  3GKQ A;  1VQ4 1;  3I56 Z;  2R93 I;  2JA7 I;  1NUI A;  2QLV B;  1FDO A;  2O4H A;  1NJI 1;  4DQY B;  3GTG I;  4HGZ A;  3ESW A;  1VQL Z;  4NH1 C;  3GTO I;  3T4N B;  3J80 b;  1KQS Y;  1AA6 A;  3I56 1;  3F3P C;  3CCU Z;  1QVG Z;  2VPZ A;  3GTM S;  2YAD A;  3EER A;  3HKZ A;  4E2X A;  2OTJ Z;  4E30 A;  3PO3 I;  4BXX I;  1TWF I;  1YUA A;  2R6M A;  2OTL Z;  1VQL 1;  3GTP I;  4BY1 I;  2V8J A;  1WCM I;  3HOW I;  3BG0 B;  3CC7 Z;  2RT9 A;  2WAQ A;  3CCU 1;  3MON A;  1YIT Z;  4AYB A;  1QVG Y;  1N2F A;  5AN9 F;  2JA8 I;  3CCV 1;  2OTJ 1;  2F4O A;  3G4S 1;  3M4O I;  2E2I I;  3CC2 Z;  2OTL 1;  2RPR A;  5D1P A;  1Z03 A;  3JAM b;  3CCM 1;  3GTJ I;  4RS4 A;  2DE7 A;  2VPW A;  4RVF A;  3CC7 1;  3FQQ A;  1R9T I;  2EGT A;  1YIT 1;  3PO2 I;  3KIH A;  5D1O A;  1K9M 1;  2RBL A;  3CC2 1;  4MD7 A;  1VQ8 Z;  4MON A;  1KD1 2;  1I3Q I;  1QVF Z;  4RVG A;  2KPI A;  1RQF A;  4A3C I;  3H0G I;  3CCR Z;  2RHB A;  3IF8 A;  1TWC I;  1VQ9 Z;  1QF8 A;  2IZ3 A;  2JR6 A;  2QR1 B;  2W04 A;  2M6N A;  5T67 A;  3I4M I;  3HOX I;  2OOX B;  3CCQ Z;  2JIP A;  1M1K 2;  3CCS Z;  3S1N I;  1VQ8 1;  1QVF Y;  3G6E Z;  5C4X I;  5A2Q b;  3CME Z;  3CCR 1;  1Y1V I;  3U50 C;  1JJ2 Y;  3CC4 Z;  1ZB9 A;  1M90 2;  2JA6 I;  3G71 Z;  2JIM A;  3Q87 A;  1VQ9 1;  4RVD A;  5C4J I;  3QWU A;  4E2Z A;  3M3Y I;  3CCS 1;  4NBE A;  4E31 A;  1Q86 2;  3G6E 1;  1YI2 1;  2K3R A;  1Q81 2;  2JMO A;  1L1O C;  4BBS I;  3CME 1;  1VQ5 Z;  3IFU A;  4E33 A;  3CC4 1;  2QRC B;  3S15 I;  3G71 1;  2M48 A;  1RO4 A; 
#chains in the Genus database with same CATH homology
 3HOU I;  1KC8 2;  1K73 2;  4MRI A;  1USP B;  2K5R A;  3KIF A;  2VUG A;  1YJW Z;  3VMG A;  2PK7 A;  1VQM Z;  1Q82 2;  3NDJ A;  3CMA Z;  2LIY A;  2QEX 1;  1VQ5 1;  1WII A;  1QYP A;  3PO3 S;  3CQZ I;  1YJN Z;  1Q7Y 1;  5C44 I;  2RIQ A;  2LFU A;  4RV9 A;  3J80 f;  4NFR A;  2F4M A;  3F3F C;  4QTU A;  2NVT I;  2E2H I;  4TNU A;  3K7A I;  1RLY A;  2JA5 I;  1VQM 1;  2NVY I;  3OW2 Y;  4A3L I;  2QRD B;  3CMA 1;  2E2J I;  4HGY A;  3MZL B;  1YUK A;  2DE5 A;  1K8A 2;  1N8R 2;  1YJN 1;  2V8K A;  2Q51 A;  1X0T A;  3CCL Z;  1P9N A;  2E9H A;  4X6A I;  1K83 I;  1NJI 2;  1S72 Z;  4CL1 A;  3D9X A;  3VB9 A;  1Z01 A;  4MD8 A;  1YIJ Z;  3GTL I;  4A3F I;  3JAM f;  1VQ6 Z;  3CCL 1;  2GU2 A;  2JNY A;  2HF1 A;  1S72 1;  5IT9 b;  5T6B A;  2R7Z I;  1YHQ Z;  3H3V J;  1YIJ 1;  1ZH1 A;  1JJ2 Z;  1TWA I;  4A3M I;  5IT9 f;  2Y0S A;  4XX2 A;  1VQ6 1;  4A3G I;  2W03 A;  3S14 I;  3NH8 A;  3FKI I;  1Y1V S;  1YHQ 1;  1VQK Z;  3P5J B;  3I07 A;  1NP6 A;  1JWH C;  2P3Y A;  3HOY I;  5A2Q f;  2J6A A;  3D6W A;  3S1Q I;  1K9M 2;  3CCQ 1;  4Y52 I;  4NBF A;  1VQK 1;  4NB8 A;  2QKD A;  3NFZ A;  3S2H I;  1TFI A;  2OOY B;  2P28 A;  3J81 b;  4DGL A;  4NBG A;  2QA4 Z;  3I4N I;  1VQP Z;  4S1T A;  2NVQ I;  2O53 A;  3S17 I;  3HOV I;  4EWC A;  2HU9 A;  4MXU A;  3S1R I;  3OW2 Z;  4NBD A;  4HH4 A;  2JUB A;  1DL6 A;  2QA4 1;  1VQP 1;  1VQO Z;  3CD6 Z;  3GCF A;  4Y7N I;  1S7M A;  1VQN Z;  1YJW 1;  2ZAE B;  4A3I I;  3CCE Z;  4A3D I;  3RZD I;  2WB1 A;  4BY7 I;  2BJO A;  4NBB A;  2GTI A;  4MD9 A;  5D1O B;  3GTK I;  3GTQ I;  2JS4 A;  3CXC Z;  1VQO 1;  3CD6 1;  4A3K I;  3CCV Z;  5FLX b;  1RNI A;  4RVH A;  1X3Z A;  3G4S Z;  3VMH A;  3GTM I;  3HOZ I;  3S2D I;  1KD1 1;  1VQN 1;  2VF1 A;  3IX0 A;  4A93 I;  3CCE 1;  3CCM Z;  5LL6 f;  3S16 I;  5FLX f;  2PM9 A;  1USP A;  1I6H I;  1VLA A;  5C3E I;  3CXC Y;  1RO0 A;  1ML8 A;  1Z02 A;  2R92 I;  4E2W A;  1SFO I;  2H85 A;  1Q7Y 2;  2IZ4 A;  4NOZ A;  1M1K 1;  3NH5 A;  3I55 Z;  2GTH A;  3RZO I;  2VUM I;  2OZK A;  1Y1W I;  1M90 1;  3S1M I;  4NBC A;  1RO2 A;  4E32 A;  3MZK B;  3VMI A;  3BG1 B;  3FQM A;  2B63 I;  1ZB8 A;  3EED A;  1LQL A;  3I55 1;  1Q86 1;  2V8I A;  1Q81 1;  2YU9 I;  3J7A 4;  2DE6 A;  4DK1 A;  2KI7 B;  4A3J I;  1PFT A;  3VTN A;  4BBR I;  1YJ9 Z;  1WW9 A;  1KC8 1;  1K73 1;  3LUS A;  4NBA A;  1W2B Z;  4A3E I;  4QTT A;  4NBH A;  3CCJ Z;  2NVX I;  4MH4 A;  3CPW Z;  5FLM I;  1VQ7 Z;  1Q82 1;  4E2Y A;  4A3B I;  2I3C A;  2Q4Z A;  1YI2 Z;  3TE5 B;  3NH4 A;  1VQ4 Z;  5CM2 M;  1TWG I;  2QRE B;  4NB9 A;  1YJ9 1;  3NDI A;  1W2B Y;  1TWH I;  5IP7 I;  1KRL A;  1I50 I;  3TDH B;  3CCJ 1;  3J81 f;  3CPW Y;  2AKL A;  1VQ7 1;  5IP9 I;  1X3W A;  1KQS Z;  2PMZ A;  5T64 A;  2QEX Z;  1K8A 1;  2G2K A;  1N8R 1;  3GKQ A;  1VQ4 1;  3I56 Z;  2R93 I;  2JA7 I;  1NUI A;  2QLV B;  2O4H A;  1NJI 1;  4DQY B;  3GTG I;  4HGZ A;  3ESW A;  1VQL Z;  4NH1 C;  3GTO I;  3T4N B;  3J80 b;  1KQS Y;  3I56 1;  3F3P C;  3CCU Z;  1QVG Z;  3GTM S;  2YAD A;  3EER A;  3HKZ A;  4E2X A;  2OTJ Z;  4E30 A;  3PO3 I;  4BXX I;  1TWF I;  1YUA A;  2R6M A;  2OTL Z;  1VQL 1;  3GTP I;  4BY1 I;  2V8J A;  1WCM I;  3HOW I;  3BG0 B;  3CC7 Z;  2RT9 A;  2WAQ A;  3CCU 1;  3MON A;  1YIT Z;  4AYB A;  1QVG Y;  1N2F A;  5AN9 F;  2JA8 I;  3CCV 1;  2OTJ 1;  2F4O A;  3G4S 1;  3M4O I;  2E2I I;  3CC2 Z;  2OTL 1;  2RPR A;  5D1P A;  1Z03 A;  3JAM b;  3CCM 1;  3GTJ I;  4RS4 A;  2DE7 A;  4RVF A;  3CC7 1;  3FQQ A;  1R9T I;  2EGT A;  1YIT 1;  3PO2 I;  3KIH A;  5D1O A;  1K9M 1;  2RBL A;  3CC2 1;  4MD7 A;  1VQ8 Z;  4MON A;  1KD1 2;  1I3Q I;  1QVF Z;  4RVG A;  2KPI A;  1RQF A;  4A3C I;  3H0G I;  3CCR Z;  2RHB A;  3IF8 A;  1TWC I;  1VQ9 Z;  1QF8 A;  2IZ3 A;  2JR6 A;  2QR1 B;  2W04 A;  2M6N A;  5T67 A;  3I4M I;  3HOX I;  2OOX B;  3CCQ Z;  1M1K 2;  3CCS Z;  3S1N I;  1VQ8 1;  1QVF Y;  3G6E Z;  5C4X I;  5A2Q b;  3CME Z;  3CCR 1;  1Y1V I;  3U50 C;  1JJ2 Y;  3CC4 Z;  1ZB9 A;  1M90 2;  2JA6 I;  3G71 Z;  3Q87 A;  1VQ9 1;  4RVD A;  5C4J I;  3QWU A;  4E2Z A;  3M3Y I;  3CCS 1;  4NBE A;  4E31 A;  1Q86 2;  3G6E 1;  1YI2 1;  2K3R A;  1Q81 2;  2JMO A;  1L1O C;  4BBS I;  3CME 1;  1VQ5 Z;  3IFU A;  4E33 A;  3CC4 1;  2QRC B;  3S15 I;  3G71 1;  2M48 A;  1RO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...