1VQ4Z

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4Z00
2QA4Z 1YJ9Z 1VQ61 1M1K1 1KC82 1YIT1 1K8A1 1NJI1 3CME1 1JJ2Y 3CD6Z 3CD61 3I55Z 3G711 3CCL1 1M902 2QEXZ 3CMEZ 1QVFY 3CXCY 1VQM1 3OW2Y 3CXCZ 3CCQ1 1VQ9Z 2OTJ1 3CC7Z 1VQKZ 3CCJZ 1VQK1 1YI21 3CCQZ 1M901 3CCSZ 1YJWZ 1VQ8Z 1VQ41 1VQO1 3CCU1 3CCRZ 1VQ81 3CMAZ 1VQ51 1VQL1 3CC4Z 1K9M2 3G6E1 1Q862 1KD11 3CPWY 1QVFZ 1QVGY 3CCVZ 3I561 3CMA1 3I56Z 1KC81 1VQN1 1M1K2 1Q811 3CCUZ 1N8R1 1VQOZ 3G4S1 1KQSY 1VQ4Z 1YIJZ 1Q812 2QA41 1YJNZ 1W2BY 1QVGZ 3G6EZ 3CCE1 1Q821 3CCEZ 3CC41 3CC71 1VQ7Z 3CCR1 1K9M1 3G4SZ 3OW2Z 2QEX1 1VQP1 1YHQ1 1VQNZ 1YJW1 3G71Z 2OTLZ 2OTL1 3CC21 3CCV1 1YHQZ 1JJ2Z 3CCJ1 1S72Z 1K8A2 1KQSZ 1S721 1VQMZ 1N8R2 1VQ5Z 3CCLZ 1VQLZ 1YJN1 3I551 1Q7Y2 3CC2Z 1YIJ1 1VQPZ 1K732 3CCMZ 1YITZ 3CCM1 3CPWZ 1YJ91 1VQ6Z 1VQ71 1Q822 3CCS1 1YI2Z 1K731 1KD12 1Q861 1NJI2 1VQ91 1Q7Y1 2OTJZ 1W2BZ
chains in the Genus database with same CATH superfamily
2W03A 1M1K1 2RIQA 1YIT1 3S1QI 1K8A1 1NJI1 1JJ2Y 3S2HI 1TWHI 1AA6A 3IF8A 3HOYI 2QREB 3CMEZ 5D1PA 2EGTA 3CQZI 3JAMf 2LFUA 2R6MA 1SIWA 2H85A 1VQ9Z 3CC7Z 1USPA 2G2KA 3QWUA 4Y52I 3HOVI 3CCSZ 2QLVB 1VQ8Z 4E2YA 3S16I 1VQ41 4E30A 1VLAA 5C4XI 4NH1C 4NB9A 3CMAZ 4A3JI 3GTGI 5D1OB 3PO2I 5A2Qb 2JA5I 2IZ3A 4RVHA 3D9XA 1QVFZ 1TWAI 2JA7I 1N2FA 3CCUZ 2JIQA 1Q811 2P28A 4E32A 2B63I 1ZH1A 4DQYB 2PM9A 1KQSY 1YUKA 3NDIA 5IT9b 2QA41 3ESWA 4A3CI 3CCE1 5CM2M 2JIRA 4E2WA 3NH4A 3CCR1 3J80b 2M48A 1K9M1 2V3VA 3OW2Z 1YHQ1 1YJW1 3G71Z 2PK7A 5LL6f 1Z03A 2HF1A 3HOWI 1I6HI 1Z02A 2DE7A 1ML8A 3TE5B 3J81f 1WZNA 4MD8A 2QRDB 3CC2Z 4BY7I 1YIJ1 4CL1A 3VMHA 2LIYA 3CCMZ 2HU9A 1YITZ 3D6WA 3CCM1 2GU2A 1RO0A 4MD7A 4NBCA 3CCS1 2Y0SA 3J81b 4E2XA 5T6BA 4EWCA 5FLMI 2VUGA 3NDJA 3CCL1 2E2JI 3IFUA 4BBRI 3CXCY 3OW2Y 3VMIA 2V8JA 4BXXI 3CCQ1 2R92I 2QKDA 1VQKZ 3CCJZ 3PO3I 4Y7NI 1VQK1 2OOXB 5IP9I 5AN9F 3CCQZ 1M901 3FKII 2Q51A 1WIIA 3TDHB 4DK1A 2K3RA 2E2HI 2YADA 3F3PC 3HOXI 3CC4Z 1RO4A 4NBHA 2QR1B 2W04A 3D2LA 2YU9I 1QVGY 3I561 3I56Z 2VUMI 1WW9A 4A3GI 1N8R1 2IV2X 1VQOZ 1QF8A 3M4OI 1YIJZ 2JIOA 3GTJI 4E31A 1YJNZ 1RNIA 1Q821 3CCEZ 4NBGA 3CC71 2V8IA 4BY1I 1VQ7Z 2E2II 2R7ZI 2ZAEB 2DE5A 4NFRA 2QEX1 1VQP1 1VQNZ 3H3VJ 2OTLZ 3CC21 1FDIA 2JS4A 2V45A 2K5RA 3CCJ1 2AKLA 2DE6A 3GCFA 2PMZA 1K8A2 2JMOA 3MONA 4BBSI 3S14I 4A3FI 1PFTA 2E7ZA 2NVYI 3KIFA 1VQ5Z 3CCLZ 1VQLZ 2I3CA 3KIHA 4MONA 4A3LI 2JNYA 4A3KI 1VQPZ 1WJ2A 3GTMI 1KD12 1I3QI 1NJI2 4NBEA 2NVTI 2V8KA 4NBDA 1JWHC 1Y1WI 1YJ9Z 1VQ61 4NBAA 1KC82 2IZ4A 3MZLB 2AYDA 2KI7B 2OOYB 2VPXA 3HOZI 3BG1B 3I55Z 1M902 1X3ZA 1P9NA 2KPIA 1QVFY 4DGLA 3S17I 3CXCZ 1KRLA 1YI21 1YJWZ 2JA8I 2JIPA 2RHBA 3VB9A 1TWGI 3CCU1 3CCRZ 4NBFA 2JIMA 4RVFA 3IX0A 1VQ51 2NAPA 3GTQI 3GTMS 1RO2A 2BJOA 1KD11 1LQLA 2JUBA 1DL6A 5T67A 1TWCI 1TWFI 2F4MA 4QTTA 3MZKB 3CCVZ 1YUAA 1KC81 1VQN1 3GTOI 3EEDA 4A3MI 3G4S1 3J7A4 1Q812 4RVDA 3NH5A 2QRCB 1W2BY 1QVGZ 5C4JI 4AYBA 3HKZA 5FLXb 3S1MI 4TNUA 1I50I 5T64A 3VMGA 1RLYA 2JA6I 3G4SZ 5C3EI 4XX2A 2OTL1 1QXFA 3CCV1 4E33A 1JJ2Z 4X6AI 3FQQA 1S72Z 1KQSZ 3I07A 4RV9A 3S1RI 1S721 4S1TA 4NB8A 1ZB8A 1R9TI 1N8R2 3HOUI 1YJN1 3I551 1Q16A 3F3FC 2O4HA 2WAQA 1K732 4RVGA 4A3II 3CPWZ 1YJ91 1VQ6Z 1Q822 3RZDI 1NUIA 1Q861 3S2DI 2OTJZ 1Q7Y1 5IT9f 2QA4Z 3GTKI 3Q87A 1Y8CA 5D1OA 3VTNA 3CME1 2J6AA 1WCMI 3CD6Z 3M3YI 3CD61 3G711 2QEXZ 1Y1VS 1VQM1 2NVQI 2E9HA 4A3BI 2LEXA 2VPZA 2GTHA 1Z01A 5FLXf 1Y1VI 2OTJ1 1TFIA 2WB1A 2VPWA 3K7AI 1QYPA 2RPRA 3T4NB 1K83I 4HH4A 3IR7A 3H0GI 1VQO1 4HGZA 1S7MA 1USPB 1VQ81 2O53A 1SFOI 4MRIA 3GKQA 1ZB9A 1VQL1 3RZOI 3J80f 4RS4A 1X0TA 3G6E1 5IP7I 1Q862 1K9M2 3I4NI 3CPWY 3S1NI 4A3EI 3NFZA 4MH4A 5A2Qf 3GTLI 3CMA1 2R93I 1M1K2 4MD9A 2F4OA 1VQ4Z 2M6NA 3G6EZ 3S15I 2RBLA 3CC41 2RT9A 3P5JB 3FQMA 4HGYA 3EERA 1NP6A 2GTIA 4E2ZA 3LUSA 4QTUA 2P3YA 1YHQZ 4NOZA 3NH8A 4A3DI 3I4MI 4NBBA 3GTPI 2Q4ZA 1X3WA 2NVXI 2JR6A 1VQMZ 1RQFA 3PO3S 1Q7Y2 2OZKA 4A93I 3JAMb 2VPYA 5C44I 3U50C 4MXUA 3BG0B 2VF1A 1VQ71 1YI2Z 1FDOA 1K731 1VQ91 1L1OC 1W2BZ
chains in the Genus database with same CATH topology
2W03A 1M1K1 2RIQA 1YIT1 3S1QI 1K8A1 1NJI1 1JJ2Y 3S2HI 1TWHI 3HOYI 3IF8A 2QREB 3CMEZ 5D1PA 2EGTA 3CQZI 3JAMf 2LFUA 2R6MA 2H85A 1VQ9Z 3CC7Z 1USPA 2G2KA 3QWUA 4Y52I 3HOVI 3CCSZ 2QLVB 1VQ8Z 4E2YA 3S16I 1VQ41 4E30A 1VLAA 5C4XI 4NH1C 4NB9A 1W2BZ 3CMAZ 4A3JI 3GTGI 5D1OB 3PO2I 5A2Qb 2JA5I 2IZ3A 4RVHA 3D9XA 1QVFZ 1TWAI 2JA7I 1N2FA 3CCUZ 1Q811 2P28A 4E32A 2B63I 1ZH1A 4DQYB 2PM9A 1KQSY 1YUKA 3NDIA 5IT9b 2QA41 3ESWA 4A3CI 3CCE1 5CM2M 4E2WA 3NH4A 3CCR1 3J80b 2M48A 1K9M1 3OW2Z 1YHQ1 1YJW1 3G71Z 2PK7A 5LL6f 1Z03A 2HF1A 3HOWI 1I6HI 1Z02A 2DE7A 1ML8A 3TE5B 3J81f 4MD8A 2QRDB 3CC2Z 4BY7I 1YIJ1 4CL1A 3VMHA 2LIYA 3CCMZ 2HU9A 1YITZ 3D6WA 3CCM1 2GU2A 1RO0A 4MD7A 4NBCA 3CCS1 2Y0SA 3J81b 4E2XA 5T6BA 4EWCA 5FLMI 2VUGA 3NDJA 3CCL1 2E2JI 3IFUA 4BBRI 3CXCY 3OW2Y 3VMIA 2V8JA 4BXXI 3CCQ1 2R92I 2QKDA 1VQKZ 3CCJZ 3PO3I 4Y7NI 1VQK1 2OOXB 5IP9I 5AN9F 3CCQZ 1M901 3FKII 2Q51A 1WIIA 3TDHB 4DK1A 2K3RA 2E2HI 2YADA 3F3PC 3HOXI 3CC4Z 1RO4A 4NBHA 2QR1B 2W04A 2YU9I 3I561 3I56Z 2VUMI 1WW9A 4A3GI 1N8R1 1VQOZ 1QF8A 3M4OI 1YIJZ 3GTJI 4E31A 1YJNZ 1RNIA 1Q821 3CCEZ 4NBGA 3CC71 2V8IA 4BY1I 1VQ7Z 2E2II 2R7ZI 2ZAEB 2DE5A 4NFRA 2QEX1 1VQP1 1VQNZ 3H3VJ 2OTLZ 3CC21 2JS4A 2K5RA 3CCJ1 2AKLA 2DE6A 3GCFA 2PMZA 1K8A2 2JMOA 3MONA 4BBSI 3S14I 4A3FI 1PFTA 2NVYI 3KIFA 1VQ5Z 3CCLZ 1VQLZ 2I3CA 3KIHA 4MONA 4A3LI 2JNYA 4A3KI 1VQPZ 3GTMI 1KD12 1I3QI 1NJI2 4NBEA 2NVTI 2V8KA 4NBDA 1JWHC 1Y1WI 1YJ9Z 1VQ61 4NBAA 1KC82 2IZ4A 3MZLB 2KI7B 2OOYB 3HOZI 3BG1B 3I55Z 1M902 1X3ZA 1P9NA 2KPIA 1QVFY 4DGLA 3S17I 3CXCZ 1KRLA 1YI21 1YJWZ 2JA8I 2RHBA 3VB9A 1TWGI 3CCU1 3CCRZ 4NBFA 4RVFA 3IX0A 1VQ51 3GTQI 3GTMS 1RO2A 2BJOA 1KD11 1LQLA 2JUBA 1DL6A 5T67A 1TWCI 1TWFI 2F4MA 4QTTA 3MZKB 3CCVZ 1YUAA 1KC81 1VQN1 3GTOI 3EEDA 4A3MI 3G4S1 3J7A4 1Q812 4RVDA 3NH5A 2QRCB 1W2BY 1QVGZ 5C4JI 4AYBA 3HKZA 5FLXb 3S1MI 4TNUA 1I50I 5T64A 3VMGA 1RLYA 2JA6I 3G4SZ 5C3EI 4XX2A 2OTL1 3CCV1 4E33A 1JJ2Z 4X6AI 3FQQA 1S72Z 1KQSZ 3I07A 4RV9A 1S721 3S1RI 4S1TA 4NB8A 1ZB8A 1R9TI 1N8R2 3HOUI 1YJN1 3I551 3F3FC 2O4HA 2WAQA 1K732 4RVGA 4A3II 3CPWZ 1YJ91 1VQ6Z 1Q822 3RZDI 1NUIA 1Q861 3S2DI 2OTJZ 1Q7Y1 5IT9f 2QA4Z 3GTKI 3Q87A 5D1OA 3VTNA 3CME1 2J6AA 1WCMI 3CD6Z 3M3YI 3CD61 3G711 2QEXZ 1Y1VS 1VQM1 2NVQI 2E9HA 4A3BI 2GTHA 1Z01A 5FLXf 1Y1VI 2OTJ1 1TFIA 2WB1A 3K7AI 1QYPA 2RPRA 3T4NB 1K83I 4HH4A 3H0GI 1VQO1 4HGZA 1S7MA 1USPB 1VQ81 2O53A 1SFOI 4MRIA 3GKQA 1ZB9A 1VQL1 3RZOI 3J80f 4RS4A 1X0TA 3G6E1 5IP7I 1Q862 1K9M2 3I4NI 3CPWY 3S1NI 4A3EI 3NFZA 4MH4A 5A2Qf 3GTLI 3CMA1 2R93I 1M1K2 4MD9A 2F4OA 1VQ4Z 2M6NA 3G6EZ 3S15I 2RBLA 3CC41 2RT9A 3P5JB 3FQMA 4HGYA 3EERA 1NP6A 2GTIA 4E2ZA 3LUSA 4QTUA 2P3YA 1YHQZ 4NOZA 3NH8A 4A3DI 3I4MI 4NBBA 3GTPI 2Q4ZA 1X3WA 2NVXI 2JR6A 1VQMZ 1RQFA 3PO3S 1Q7Y2 2OZKA 4A93I 3JAMb 5C44I 3U50C 4MXUA 3BG0B 2VF1A 1VQ71 1YI2Z 1K731 1VQ91 1L1OC 1QVGY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  1YJ9 Z;  1VQ6 1;  1M1K 1;  1KC8 2;  1YIT 1;  1K8A 1;  1NJI 1;  3CME 1;  1JJ2 Y;  3CD6 Z;  3CD6 1;  3I55 Z;  3G71 1;  3CCL 1;  1M90 2;  2QEX Z;  3CME Z;  1QVF Y;  3CXC Y;  1VQM 1;  3OW2 Y;  3CXC Z;  3CCQ 1;  1VQ9 Z;  2OTJ 1;  3CC7 Z;  1VQK Z;  3CCJ Z;  1VQK 1;  1YI2 1;  3CCQ Z;  1M90 1;  3CCS Z;  1YJW Z;  1VQ8 Z;  1VQ4 1;  1VQO 1;  3CCU 1;  3CCR Z;  1VQ8 1;  3CMA Z;  1VQ5 1;  1VQL 1;  3CC4 Z;  1K9M 2;  3G6E 1;  1Q86 2;  1KD1 1;  3CPW Y;  1QVF Z;  1QVG Y;  3CCV Z;  3I56 1;  3CMA 1;  3I56 Z;  1KC8 1;  1VQN 1;  1M1K 2;  1Q81 1;  3CCU Z;  1N8R 1;  1VQO Z;  3G4S 1;  1KQS Y;  1VQ4 Z;  1YIJ Z;  1Q81 2;  2QA4 1;  1YJN Z;  1W2B Y;  1QVG Z;  3G6E Z;  3CCE 1;  1Q82 1;  3CCE Z;  3CC4 1;  3CC7 1;  1VQ7 Z;  3CCR 1;  1K9M 1;  3G4S Z;  3OW2 Z;  2QEX 1;  1VQP 1;  1YHQ 1;  1VQN Z;  1YJW 1;  3G71 Z;  2OTL Z;  2OTL 1;  3CC2 1;  3CCV 1;  1YHQ Z;  1JJ2 Z;  3CCJ 1;  1S72 Z;  1K8A 2;  1KQS Z;  1S72 1;  1VQM Z;  1N8R 2;  1VQ5 Z;  3CCL Z;  1VQL Z;  1YJN 1;  3I55 1;  1Q7Y 2;  3CC2 Z;  1YIJ 1;  1VQP Z;  1K73 2;  3CCM Z;  1YIT Z;  3CCM 1;  3CPW Z;  1YJ9 1;  1VQ6 Z;  1VQ7 1;  1Q82 2;  3CCS 1;  1YI2 Z;  1K73 1;  1KD1 2;  1Q86 1;  1NJI 2;  1VQ9 1;  1Q7Y 1;  2OTJ Z;  1W2B Z; 
#chains in the Genus database with same CATH topology
 2W03 A;  1M1K 1;  2RIQ A;  1YIT 1;  3S1Q I;  1K8A 1;  1NJI 1;  1JJ2 Y;  3S2H I;  1TWH I;  1AA6 A;  3IF8 A;  3HOY I;  2QRE B;  3CME Z;  5D1P A;  2EGT A;  3CQZ I;  3JAM f;  2LFU A;  2R6M A;  1SIW A;  2H85 A;  1VQ9 Z;  3CC7 Z;  1USP A;  2G2K A;  3QWU A;  4Y52 I;  3HOV I;  3CCS Z;  2QLV B;  1VQ8 Z;  4E2Y A;  3S16 I;  1VQ4 1;  4E30 A;  1VLA A;  5C4X I;  4NH1 C;  4NB9 A;  3CMA Z;  4A3J I;  3GTG I;  5D1O B;  3PO2 I;  5A2Q b;  2JA5 I;  2IZ3 A;  4RVH A;  3D9X A;  1QVF Z;  1TWA I;  2JA7 I;  1N2F A;  3CCU Z;  2JIQ A;  1Q81 1;  2P28 A;  4E32 A;  2B63 I;  1ZH1 A;  4DQY B;  2PM9 A;  1KQS Y;  1YUK A;  3NDI A;  5IT9 b;  2QA4 1;  3ESW A;  4A3C I;  3CCE 1;  5CM2 M;  2JIR A;  4E2W A;  3NH4 A;  3CCR 1;  3J80 b;  2M48 A;  1K9M 1;  2V3V A;  3OW2 Z;  1YHQ 1;  1YJW 1;  3G71 Z;  2PK7 A;  5LL6 f;  1Z03 A;  2HF1 A;  3HOW I;  1I6H I;  1Z02 A;  2DE7 A;  1ML8 A;  3TE5 B;  3J81 f;  1WZN A;  4MD8 A;  2QRD B;  3CC2 Z;  4BY7 I;  1YIJ 1;  4CL1 A;  3VMH A;  2LIY A;  3CCM Z;  2HU9 A;  1YIT Z;  3D6W A;  3CCM 1;  2GU2 A;  1RO0 A;  4MD7 A;  4NBC A;  3CCS 1;  2Y0S A;  3J81 b;  4E2X A;  5T6B A;  4EWC A;  5FLM I;  2VUG A;  3NDJ A;  3CCL 1;  2E2J I;  3IFU A;  4BBR I;  3CXC Y;  3OW2 Y;  3VMI A;  2V8J A;  4BXX I;  3CCQ 1;  2R92 I;  2QKD A;  1VQK Z;  3CCJ Z;  3PO3 I;  4Y7N I;  1VQK 1;  2OOX B;  5IP9 I;  5AN9 F;  3CCQ Z;  1M90 1;  3FKI I;  2Q51 A;  1WII A;  3TDH B;  4DK1 A;  2K3R A;  2E2H I;  2YAD A;  3F3P C;  3HOX I;  3CC4 Z;  1RO4 A;  4NBH A;  2QR1 B;  2W04 A;  3D2L A;  2YU9 I;  1QVG Y;  3I56 1;  3I56 Z;  2VUM I;  1WW9 A;  4A3G I;  1N8R 1;  2IV2 X;  1VQO Z;  1QF8 A;  3M4O I;  1YIJ Z;  2JIO A;  3GTJ I;  4E31 A;  1YJN Z;  1RNI A;  1Q82 1;  3CCE Z;  4NBG A;  3CC7 1;  2V8I A;  4BY1 I;  1VQ7 Z;  2E2I I;  2R7Z I;  2ZAE B;  2DE5 A;  4NFR A;  2QEX 1;  1VQP 1;  1VQN Z;  3H3V J;  2OTL Z;  3CC2 1;  1FDI A;  2JS4 A;  2V45 A;  2K5R A;  3CCJ 1;  2AKL A;  2DE6 A;  3GCF A;  2PMZ A;  1K8A 2;  2JMO A;  3MON A;  4BBS I;  3S14 I;  4A3F I;  1PFT A;  2E7Z A;  2NVY I;  3KIF A;  1VQ5 Z;  3CCL Z;  1VQL Z;  2I3C A;  3KIH A;  4MON A;  4A3L I;  2JNY A;  4A3K I;  1VQP Z;  1WJ2 A;  3GTM I;  1KD1 2;  1I3Q I;  1NJI 2;  4NBE A;  2NVT I;  2V8K A;  4NBD A;  1JWH C;  1Y1W I;  1YJ9 Z;  1VQ6 1;  4NBA A;  1KC8 2;  2IZ4 A;  3MZL B;  2AYD A;  2KI7 B;  2OOY B;  2VPX A;  3HOZ I;  3BG1 B;  3I55 Z;  1M90 2;  1X3Z A;  1P9N A;  2KPI A;  1QVF Y;  4DGL A;  3S17 I;  3CXC Z;  1KRL A;  1YI2 1;  1YJW Z;  2JA8 I;  2JIP A;  2RHB A;  3VB9 A;  1TWG I;  3CCU 1;  3CCR Z;  4NBF A;  2JIM A;  4RVF A;  3IX0 A;  1VQ5 1;  2NAP A;  3GTQ I;  3GTM S;  1RO2 A;  2BJO A;  1KD1 1;  1LQL A;  2JUB A;  1DL6 A;  5T67 A;  1TWC I;  1TWF I;  2F4M A;  4QTT A;  3MZK B;  3CCV Z;  1YUA A;  1KC8 1;  1VQN 1;  3GTO I;  3EED A;  4A3M I;  3G4S 1;  3J7A 4;  1Q81 2;  4RVD A;  3NH5 A;  2QRC B;  1W2B Y;  1QVG Z;  5C4J I;  4AYB A;  3HKZ A;  5FLX b;  3S1M I;  4TNU A;  1I50 I;  5T64 A;  3VMG A;  1RLY A;  2JA6 I;  3G4S Z;  5C3E I;  4XX2 A;  2OTL 1;  1QXF A;  3CCV 1;  4E33 A;  1JJ2 Z;  4X6A I;  3FQQ A;  1S72 Z;  1KQS Z;  3I07 A;  4RV9 A;  3S1R I;  1S72 1;  4S1T A;  4NB8 A;  1ZB8 A;  1R9T I;  1N8R 2;  3HOU I;  1YJN 1;  3I55 1;  1Q16 A;  3F3F C;  2O4H A;  2WAQ A;  1K73 2;  4RVG A;  4A3I I;  3CPW Z;  1YJ9 1;  1VQ6 Z;  1Q82 2;  3RZD I;  1NUI A;  1Q86 1;  3S2D I;  2OTJ Z;  1Q7Y 1;  5IT9 f;  2QA4 Z;  3GTK I;  3Q87 A;  1Y8C A;  5D1O A;  3VTN A;  3CME 1;  2J6A A;  1WCM I;  3CD6 Z;  3M3Y I;  3CD6 1;  3G71 1;  2QEX Z;  1Y1V S;  1VQM 1;  2NVQ I;  2E9H A;  4A3B I;  2LEX A;  2VPZ A;  2GTH A;  1Z01 A;  5FLX f;  1Y1V I;  2OTJ 1;  1TFI A;  2WB1 A;  2VPW A;  3K7A I;  1QYP A;  2RPR A;  3T4N B;  1K83 I;  4HH4 A;  3IR7 A;  3H0G I;  1VQO 1;  4HGZ A;  1S7M A;  1USP B;  1VQ8 1;  2O53 A;  1SFO I;  4MRI A;  3GKQ A;  1ZB9 A;  1VQL 1;  3RZO I;  3J80 f;  4RS4 A;  1X0T A;  3G6E 1;  5IP7 I;  1Q86 2;  1K9M 2;  3I4N I;  3CPW Y;  3S1N I;  4A3E I;  3NFZ A;  4MH4 A;  5A2Q f;  3GTL I;  3CMA 1;  2R93 I;  1M1K 2;  4MD9 A;  2F4O A;  1VQ4 Z;  2M6N A;  3G6E Z;  3S15 I;  2RBL A;  3CC4 1;  2RT9 A;  3P5J B;  3FQM A;  4HGY A;  3EER A;  1NP6 A;  2GTI A;  4E2Z A;  3LUS A;  4QTU A;  2P3Y A;  1YHQ Z;  4NOZ A;  3NH8 A;  4A3D I;  3I4M I;  4NBB A;  3GTP I;  2Q4Z A;  1X3W A;  2NVX I;  2JR6 A;  1VQM Z;  1RQF A;  3PO3 S;  1Q7Y 2;  2OZK A;  4A93 I;  3JAM b;  2VPY A;  5C44 I;  3U50 C;  4MXU A;  3BG0 B;  2VF1 A;  1VQ7 1;  1YI2 Z;  1FDO A;  1K73 1;  1VQ9 1;  1L1O C;  1W2B Z; 
#chains in the Genus database with same CATH homology
 2W03 A;  1M1K 1;  2RIQ A;  1YIT 1;  3S1Q I;  1K8A 1;  1NJI 1;  1JJ2 Y;  3S2H I;  1TWH I;  3HOY I;  3IF8 A;  2QRE B;  3CME Z;  5D1P A;  2EGT A;  3CQZ I;  3JAM f;  2LFU A;  2R6M A;  2H85 A;  1VQ9 Z;  3CC7 Z;  1USP A;  2G2K A;  3QWU A;  4Y52 I;  3HOV I;  3CCS Z;  2QLV B;  1VQ8 Z;  4E2Y A;  3S16 I;  1VQ4 1;  4E30 A;  1VLA A;  5C4X I;  4NH1 C;  4NB9 A;  1W2B Z;  3CMA Z;  4A3J I;  3GTG I;  5D1O B;  3PO2 I;  5A2Q b;  2JA5 I;  2IZ3 A;  4RVH A;  3D9X A;  1QVF Z;  1TWA I;  2JA7 I;  1N2F A;  3CCU Z;  1Q81 1;  2P28 A;  4E32 A;  2B63 I;  1ZH1 A;  4DQY B;  2PM9 A;  1KQS Y;  1YUK A;  3NDI A;  5IT9 b;  2QA4 1;  3ESW A;  4A3C I;  3CCE 1;  5CM2 M;  4E2W A;  3NH4 A;  3CCR 1;  3J80 b;  2M48 A;  1K9M 1;  3OW2 Z;  1YHQ 1;  1YJW 1;  3G71 Z;  2PK7 A;  5LL6 f;  1Z03 A;  2HF1 A;  3HOW I;  1I6H I;  1Z02 A;  2DE7 A;  1ML8 A;  3TE5 B;  3J81 f;  4MD8 A;  2QRD B;  3CC2 Z;  4BY7 I;  1YIJ 1;  4CL1 A;  3VMH A;  2LIY A;  3CCM Z;  2HU9 A;  1YIT Z;  3D6W A;  3CCM 1;  2GU2 A;  1RO0 A;  4MD7 A;  4NBC A;  3CCS 1;  2Y0S A;  3J81 b;  4E2X A;  5T6B A;  4EWC A;  5FLM I;  2VUG A;  3NDJ A;  3CCL 1;  2E2J I;  3IFU A;  4BBR I;  3CXC Y;  3OW2 Y;  3VMI A;  2V8J A;  4BXX I;  3CCQ 1;  2R92 I;  2QKD A;  1VQK Z;  3CCJ Z;  3PO3 I;  4Y7N I;  1VQK 1;  2OOX B;  5IP9 I;  5AN9 F;  3CCQ Z;  1M90 1;  3FKI I;  2Q51 A;  1WII A;  3TDH B;  4DK1 A;  2K3R A;  2E2H I;  2YAD A;  3F3P C;  3HOX I;  3CC4 Z;  1RO4 A;  4NBH A;  2QR1 B;  2W04 A;  2YU9 I;  3I56 1;  3I56 Z;  2VUM I;  1WW9 A;  4A3G I;  1N8R 1;  1VQO Z;  1QF8 A;  3M4O I;  1YIJ Z;  3GTJ I;  4E31 A;  1YJN Z;  1RNI A;  1Q82 1;  3CCE Z;  4NBG A;  3CC7 1;  2V8I A;  4BY1 I;  1VQ7 Z;  2E2I I;  2R7Z I;  2ZAE B;  2DE5 A;  4NFR A;  2QEX 1;  1VQP 1;  1VQN Z;  3H3V J;  2OTL Z;  3CC2 1;  2JS4 A;  2K5R A;  3CCJ 1;  2AKL A;  2DE6 A;  3GCF A;  2PMZ A;  1K8A 2;  2JMO A;  3MON A;  4BBS I;  3S14 I;  4A3F I;  1PFT A;  2NVY I;  3KIF A;  1VQ5 Z;  3CCL Z;  1VQL Z;  2I3C A;  3KIH A;  4MON A;  4A3L I;  2JNY A;  4A3K I;  1VQP Z;  3GTM I;  1KD1 2;  1I3Q I;  1NJI 2;  4NBE A;  2NVT I;  2V8K A;  4NBD A;  1JWH C;  1Y1W I;  1YJ9 Z;  1VQ6 1;  4NBA A;  1KC8 2;  2IZ4 A;  3MZL B;  2KI7 B;  2OOY B;  3HOZ I;  3BG1 B;  3I55 Z;  1M90 2;  1X3Z A;  1P9N A;  2KPI A;  1QVF Y;  4DGL A;  3S17 I;  3CXC Z;  1KRL A;  1YI2 1;  1YJW Z;  2JA8 I;  2RHB A;  3VB9 A;  1TWG I;  3CCU 1;  3CCR Z;  4NBF A;  4RVF A;  3IX0 A;  1VQ5 1;  3GTQ I;  3GTM S;  1RO2 A;  2BJO A;  1KD1 1;  1LQL A;  2JUB A;  1DL6 A;  5T67 A;  1TWC I;  1TWF I;  2F4M A;  4QTT A;  3MZK B;  3CCV Z;  1YUA A;  1KC8 1;  1VQN 1;  3GTO I;  3EED A;  4A3M I;  3G4S 1;  3J7A 4;  1Q81 2;  4RVD A;  3NH5 A;  2QRC B;  1W2B Y;  1QVG Z;  5C4J I;  4AYB A;  3HKZ A;  5FLX b;  3S1M I;  4TNU A;  1I50 I;  5T64 A;  3VMG A;  1RLY A;  2JA6 I;  3G4S Z;  5C3E I;  4XX2 A;  2OTL 1;  3CCV 1;  4E33 A;  1JJ2 Z;  4X6A I;  3FQQ A;  1S72 Z;  1KQS Z;  3I07 A;  4RV9 A;  1S72 1;  3S1R I;  4S1T A;  4NB8 A;  1ZB8 A;  1R9T I;  1N8R 2;  3HOU I;  1YJN 1;  3I55 1;  3F3F C;  2O4H A;  2WAQ A;  1K73 2;  4RVG A;  4A3I I;  3CPW Z;  1YJ9 1;  1VQ6 Z;  1Q82 2;  3RZD I;  1NUI A;  1Q86 1;  3S2D I;  2OTJ Z;  1Q7Y 1;  5IT9 f;  2QA4 Z;  3GTK I;  3Q87 A;  5D1O A;  3VTN A;  3CME 1;  2J6A A;  1WCM I;  3CD6 Z;  3M3Y I;  3CD6 1;  3G71 1;  2QEX Z;  1Y1V S;  1VQM 1;  2NVQ I;  2E9H A;  4A3B I;  2GTH A;  1Z01 A;  5FLX f;  1Y1V I;  2OTJ 1;  1TFI A;  2WB1 A;  3K7A I;  1QYP A;  2RPR A;  3T4N B;  1K83 I;  4HH4 A;  3H0G I;  1VQO 1;  4HGZ A;  1S7M A;  1USP B;  1VQ8 1;  2O53 A;  1SFO I;  4MRI A;  3GKQ A;  1ZB9 A;  1VQL 1;  3RZO I;  3J80 f;  4RS4 A;  1X0T A;  3G6E 1;  5IP7 I;  1Q86 2;  1K9M 2;  3I4N I;  3CPW Y;  3S1N I;  4A3E I;  3NFZ A;  4MH4 A;  5A2Q f;  3GTL I;  3CMA 1;  2R93 I;  1M1K 2;  4MD9 A;  2F4O A;  1VQ4 Z;  2M6N A;  3G6E Z;  3S15 I;  2RBL A;  3CC4 1;  2RT9 A;  3P5J B;  3FQM A;  4HGY A;  3EER A;  1NP6 A;  2GTI A;  4E2Z A;  3LUS A;  4QTU A;  2P3Y A;  1YHQ Z;  4NOZ A;  3NH8 A;  4A3D I;  3I4M I;  4NBB A;  3GTP I;  2Q4Z A;  1X3W A;  2NVX I;  2JR6 A;  1VQM Z;  1RQF A;  3PO3 S;  1Q7Y 2;  2OZK A;  4A93 I;  3JAM b;  5C44 I;  3U50 C;  4MXU A;  3BG0 B;  2VF1 A;  1VQ7 1;  1YI2 Z;  1K73 1;  1VQ9 1;  1L1O C;  1QVG Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...