1YJW1

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjw100
1VQM1 2OTJZ 1NJI2 3CD6Z 3G4SZ 3CME1 3CCQZ 3CCS1 3CCLZ 1YJ91 1VQ4Z 1K8A2 1VQKZ 3I56Z 1YIT1 3CCR1 3CPWY 1M902 3G6EZ 1Q862 1JJ2Z 2OTL1 1VQ71 3G711 3I55Z 1KD12 1YJN1 1VQO1 1JJ2Y 3CC2Z 1VQ9Z 1Q861 3CCEZ 3CCJZ 1KC82 2QEX1 1K731 2QA41 1S72Z 1YITZ 1W2BZ 1VQL1 3CC7Z 1VQ5Z 1YJW1 3CCU1 1YHQZ 1M1K1 3CXCZ 1VQ81 1KD11 1K732 1YI21 1VQ6Z 3CC41 1VQN1 1VQ7Z 1VQP1 1KC81 3CMAZ 3CCMZ 3CD61 3G4S1 3CCQ1 1VQ41 3CCL1 1QVGZ 1M1K2 1VQK1 3I561 1YIJZ 1QVFZ 3CXCY 1VQMZ 1Q811 3G6E1 1Q7Y1 3CMEZ 3CCSZ 1YJ9Z 3CCV1 3CCRZ 1QVGY 1N8R1 1YJWZ 1Q812 1KQSZ 1Q7Y2 1QVFY 3I551 2OTLZ 3CPWZ 1Q821 2OTJ1 3CC21 1VQ91 3G71Z 3CCE1 3CCJ1 1W2BY 1N8R2 1VQNZ 1S721 3OW2Z 1K9M1 1YJNZ 1VQOZ 1KQSY 1Q822 3CC71 1VQ51 1YHQ1 2QEXZ 2QA4Z 1VQ61 3CCVZ 1K9M2 1NJI1 1VQLZ 3CMA1 3CCM1 3OW2Y 3CCUZ 1K8A1 1VQ8Z 1YI2Z 1YIJ1 3CC4Z 1M901 1VQPZ
chains in the Genus database with same CATH superfamily
1ML8A 4NB9A 3CD6Z 3CCQZ 3J80b 1RNIA 1K8A2 3I56Z 3GTMS 4E30A 4MH4A 3S15I 4RVDA 1SIWA 3RZOI 5T64A 2JIMA 2P3YA 2G2KA 5D1OB 1WZNA 1NUIA 1VQ71 2OOYB 1QYPA 1Y1VI 3I55Z 2NVTI 2Q51A 3TE5B 4NBFA 1KD12 3I4NI 5T6BA 3HOXI 3CC2Z 1JJ2Y 1QXFA 1Q861 3CCEZ 1KC82 2QEX1 2E9HA 1K731 2LFUA 4QTTA 1N2FA 2E2HI 4E2YA 2RHBA 5D1OA 2GTHA 3QWUA 4A3KI 1M1K1 1YUAA 1Y1WI 3CXCZ 1Z01A 3F3FC 1YI21 4HH4A 3M4OI 1RO4A 1VQP1 3J81b 3CD61 3H0GI 3CCQ1 1TWHI 5AN9F 1S7MA 3ESWA 2O53A 3I561 2AYDA 3NH5A 2VPXA 4E2XA 5IP7I 1RQFA 3CMEZ 1YJ9Z 2V3VA 3S1MI 3CCV1 3FQMA 2QLVB 2JIQA 1YJWZ 1TFIA 1Q7Y2 3I551 3S1QI 2JIPA 3I07A 2OTJ1 3CC21 3RZDI 3S16I 4EWCA 3G71Z 3CCE1 2VF1A 2AKLA 3OW2Z 3KIHA 3JAMf 3S1RI 2IV2X 1VQOZ 1YJNZ 4BY7I 3S17I 1Q822 1WW9A 3D2LA 1P9NA 1USPB 3P5JB 4NBDA 2DE6A 1K9M2 3GTJI 4BBSI 1VQLZ 2E7ZA 4AYBA 1VQ8Z 4NFRA 1Q16A 3GTQI 2KPIA 4NBHA 1M901 1X3WA 2E2JI 2K5RA 1NJI2 2VPZA 3CME1 4BY1I 1VQ4Z 1Y8CA 1YJ91 1YIT1 2RIQA 2QRDB 4A3DI 2JUBA 1I3QI 2GU2A 3NH4A 1X0TA 1Q862 1JJ2Z 3T4NB 3TDHB 3BG1B 3G711 4RV9A 2NAPA 1YJN1 1VQO1 4A3MI 2EGTA 3GTOI 3U50C 3CCJZ 4RVGA 3JAMb 1ZH1A 3MZKB 3VB9A 4S1TA 4DGLA 1VQL1 1VQ5Z 1L1OC 1VQ81 3GTMI 2O4HA 2V45A 2V8JA 2W04A 2NVQI 4RVHA 3HOWI 1KRLA 1VQ41 5CM2M 3VMGA 1FDOA 3Q87A 1VQMZ 1SFOI 3IX0A 2RT9A 4NBGA 2R93I 1QVGY 2BJOA 4E33A 1N8R1 2QRCB 1Q812 4A3BI 3I4MI 3IR7A 4RVFA 2H85A 4A3CI 3CPWZ 3NDIA 3VMIA 1R9TI 2R7ZI 2F4OA 2V8KA 3CCJ1 4MD9A 5C4XI 3M3YI 3NFZA 1KQSY 4X6AI 3LUSA 1VQ51 3D9XA 2QA4Z 2YADA 4A3GI 2NVYI 1WIIA 3S1NI 4MXUA 1RO2A 2KI7B 3CCUZ 1K8A1 3PO2I 3K7AI 4E2WA 1JWHC 2I3CA 1TWGI 3CC4Z 1VQM1 3HOZI 1ZB8A 2DE7A 3G4SZ 2JR6A 3CCLZ 1VQKZ 4A3LI 3CPWY 3HOVI 3G6EZ 4TNUA 2M6NA 3HOYI 2HF1A 1AA6A 2JA5I 3D6WA 2LIYA 1K83I 5IT9f 4QTUA 3F3PC 5T67A 1VQ9Z 2JA7I 2IZ4A 5LL6f 2QA41 1S72Z 4A3JI 1X3ZA 1I6HI 1YJW1 3CCU1 2JMOA 4NBCA 3S2DI 1K732 1VQ6Z 4MRIA 3CC41 1VQ7Z 3FQQA 1FDIA 3CMAZ 3MONA 3CCMZ 4NB8A 3G4S1 3HKZA 3CCL1 2P28A 1QVGZ 1M1K2 2ZAEB 3VTNA 1VQK1 3BG0B 1RO0A 4RS4A 1YIJZ 2F4MA 2JIOA 3VMHA 3S2HI 3G6E1 1Q7Y1 3CCSZ 2QKDA 1I50I 3CCRZ 1RLYA 4BXXI 1KQSZ 1QVFY 2OTLZ 1DL6A 1Q821 3NDJA 4NBBA 1VQ91 2JS4A 5IT9b 2JIRA 3NH8A 4MD7A 4BBRI 1S721 1K9M1 4MONA 2K3RA 2WAQA 1Y1VS 2GTIA 2PK7A 1VQ61 2OZKA 4NOZA 3CCVZ 3GCFA 1NJI1 4NBEA 3CMA1 3CCM1 3KIFA 3MZLB 2R92I 1WCMI 1YUKA 3PO3S 1NP6A 3GTGI 1YIJ1 1VQNZ 2E2II 2OOXB 5A2Qf 3H3VJ 2OTJZ 3CCS1 2PM9A 3PO3I 4A93I 3CCR1 1VLAA 1M902 1TWCI 3IFUA 3EEDA 5D1PA 2OTL1 4HGYA 2IZ3A 2LEXA 4E31A 2JA8I 5C3EI 4A3FI 4XX2A 4CL1A 3GTKI 5FLXf 2DE5A 2QR1B 2M48A 3J7A4 3IF8A 4DQYB 2B63I 2J6AA 2Y0SA 3GTLI 1YITZ 1W2BZ 3CC7Z 3GTPI 1WJ2A 1YHQZ 4E2ZA 3S14I 5C44I 2WB1A 1KD11 1ZB9A 2VUMI 1VQN1 1TWAI 4NBAA 1KC81 1TWFI 2RBLA 3EERA 4A3II 3J80f 4NH1C 5A2Qb 1Z02A 1QVFZ 1QF8A 3CXCY 4Y7NI 1Q811 2PMZA 4A3EI 3CQZI 5FLMI 2W03A 2VPWA 4HGZA 4DK1A 1LQLA 3HOUI 2JA6I 2QREB 2R6MA 2RPRA 1W2BY 3FKII 1N8R2 2V8IA 2NVXI 4MD8A 1Z03A 5FLXb 4E32A 2VUGA 1PFTA 3CC71 5C4JI 1YHQ1 1USPA 2QEXZ 2VPYA 4Y52I 2YU9I 2Q4ZA 3OW2Y 2HU9A 2JNYA 3J81f 1YI2Z 5IP9I 3GKQA 1VQPZ
chains in the Genus database with same CATH topology
1ML8A 4NB9A 3CD6Z 3CCQZ 3J80b 1RNIA 1K8A2 3I56Z 3GTMS 4E30A 4MH4A 3S15I 4RVDA 3RZOI 5T64A 2P3YA 2G2KA 5D1OB 1NUIA 1VQ71 2OOYB 1QYPA 1Y1VI 3I55Z 2NVTI 2Q51A 3TE5B 4NBFA 1KD12 3I4NI 5T6BA 3HOXI 3CC2Z 1JJ2Y 1Q861 3CCEZ 1KC82 2QEX1 2E9HA 1K731 2LFUA 4QTTA 1N2FA 2E2HI 4E2YA 2RHBA 5D1OA 2GTHA 3QWUA 4A3KI 1M1K1 1YUAA 1Y1WI 3CXCZ 1Z01A 3F3FC 1YI21 4HH4A 3M4OI 1RO4A 1VQP1 3J81b 3CD61 3H0GI 3CCQ1 1TWHI 5AN9F 1S7MA 3ESWA 2O53A 3I561 3NH5A 4E2XA 5IP7I 1RQFA 3CMEZ 1YJ9Z 3S1MI 3CCV1 3FQMA 2QLVB 1YJWZ 1TFIA 1Q7Y2 3I551 3S1QI 3I07A 2OTJ1 3CC21 3RZDI 3S16I 4EWCA 3G71Z 3CCE1 2VF1A 2AKLA 3OW2Z 3KIHA 3JAMf 3S1RI 1YJNZ 1VQOZ 4BY7I 3S17I 1Q822 1WW9A 1P9NA 1USPB 3P5JB 4NBDA 2DE6A 1K9M2 3GTJI 4BBSI 1VQLZ 4AYBA 1VQ8Z 4NFRA 3GTQI 2KPIA 4NBHA 1M901 1X3WA 2E2JI 2K5RA 1NJI2 3CME1 4BY1I 1VQ4Z 1YJ91 1YIT1 2RIQA 2QRDB 4A3DI 2JUBA 1I3QI 2GU2A 3NH4A 1X0TA 1Q862 1JJ2Z 3T4NB 3TDHB 3BG1B 3G711 4RV9A 1YJN1 1VQO1 4A3MI 2EGTA 3GTOI 3U50C 3CCJZ 4RVGA 3JAMb 1ZH1A 3MZKB 3VB9A 4S1TA 4DGLA 1VQL1 1VQ5Z 1L1OC 1VQ81 3GTMI 2O4HA 2V8JA 2W04A 2NVQI 4RVHA 3HOWI 1KRLA 1VQ41 5CM2M 3VMGA 3Q87A 1VQMZ 1SFOI 3IX0A 2RT9A 4NBGA 2R93I 1QVGY 2BJOA 4E33A 1N8R1 2QRCB 1Q812 4A3BI 3I4MI 4RVFA 2H85A 4A3CI 3CPWZ 3NDIA 3VMIA 1R9TI 2R7ZI 2F4OA 2V8KA 3CCJ1 4MD9A 5C4XI 3M3YI 3NFZA 1KQSY 4X6AI 3LUSA 1VQ51 3D9XA 2QA4Z 2YADA 4A3GI 2NVYI 1WIIA 3S1NI 4MXUA 1RO2A 2KI7B 3CCUZ 1K8A1 3PO2I 3K7AI 4E2WA 1JWHC 2I3CA 1TWGI 3CC4Z 1VQM1 3HOZI 1ZB8A 2DE7A 3G4SZ 2JR6A 3CCLZ 1VQKZ 4A3LI 3CPWY 3HOVI 3G6EZ 4TNUA 2M6NA 3HOYI 2HF1A 2JA5I 3D6WA 2LIYA 1K83I 5IT9f 4QTUA 3F3PC 1VQ9Z 5T67A 2JA7I 2IZ4A 5LL6f 2QA41 1S72Z 4A3JI 1X3ZA 1I6HI 1YJW1 3CCU1 2JMOA 4NBCA 3S2DI 1K732 1VQ6Z 4MRIA 3CC41 1VQ7Z 3FQQA 3CMAZ 3MONA 3CCMZ 4NB8A 3G4S1 3HKZA 3CCL1 2P28A 1QVGZ 1M1K2 2ZAEB 3VTNA 1VQK1 3BG0B 1RO0A 4RS4A 1YIJZ 2F4MA 3VMHA 3S2HI 3G6E1 1Q7Y1 3CCSZ 2QKDA 1I50I 3CCRZ 1RLYA 4BXXI 1KQSZ 1QVFY 2OTLZ 1DL6A 1Q821 3NDJA 4NBBA 1VQ91 2JS4A 5IT9b 3NH8A 4MD7A 4BBRI 1S721 1K9M1 4MONA 2K3RA 2WAQA 1Y1VS 2GTIA 2PK7A 1VQ61 2OZKA 4NOZA 3CCVZ 3GCFA 1NJI1 4NBEA 3CMA1 3CCM1 3KIFA 3MZLB 2R92I 1WCMI 1YUKA 3PO3S 1NP6A 3GTGI 1YIJ1 1VQNZ 2E2II 2OOXB 5A2Qf 3H3VJ 2OTJZ 3CCS1 2PM9A 3PO3I 4A93I 3CCR1 1VLAA 1M902 1TWCI 3IFUA 3EEDA 5D1PA 2OTL1 4HGYA 2IZ3A 4E31A 2JA8I 5C3EI 4A3FI 4XX2A 4CL1A 3GTKI 5FLXf 2DE5A 2QR1B 2M48A 3J7A4 3IF8A 4DQYB 2B63I 2J6AA 2Y0SA 3GTLI 1YITZ 1W2BZ 3CC7Z 3GTPI 1YHQZ 4E2ZA 3S14I 5C44I 2WB1A 1KD11 1ZB9A 2VUMI 1VQN1 1TWAI 4NBAA 1KC81 1TWFI 2RBLA 3EERA 4A3II 3J80f 4NH1C 5A2Qb 1Z02A 1QVFZ 1QF8A 3CXCY 4Y7NI 1Q811 2PMZA 4A3EI 3CQZI 5FLMI 2W03A 4HGZA 4DK1A 1LQLA 3HOUI 2JA6I 2QREB 2R6MA 2RPRA 1W2BY 3FKII 1N8R2 2V8IA 2NVXI 4MD8A 1Z03A 5FLXb 4E32A 2VUGA 1PFTA 3CC71 5C4JI 1YHQ1 1USPA 2QEXZ 4Y52I 2YU9I 2Q4ZA 3OW2Y 2HU9A 2JNYA 3J81f 1YI2Z 5IP9I 3GKQA 1VQPZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM 1;  2OTJ Z;  1NJI 2;  3CD6 Z;  3G4S Z;  3CME 1;  3CCQ Z;  3CCS 1;  3CCL Z;  1YJ9 1;  1VQ4 Z;  1K8A 2;  1VQK Z;  3I56 Z;  1YIT 1;  3CCR 1;  3CPW Y;  1M90 2;  3G6E Z;  1Q86 2;  1JJ2 Z;  2OTL 1;  1VQ7 1;  3G71 1;  3I55 Z;  1KD1 2;  1YJN 1;  1VQO 1;  1JJ2 Y;  3CC2 Z;  1VQ9 Z;  1Q86 1;  3CCE Z;  3CCJ Z;  1KC8 2;  2QEX 1;  1K73 1;  2QA4 1;  1S72 Z;  1YIT Z;  1W2B Z;  1VQL 1;  3CC7 Z;  1VQ5 Z;  1YJW 1;  3CCU 1;  1YHQ Z;  1M1K 1;  3CXC Z;  1VQ8 1;  1KD1 1;  1K73 2;  1YI2 1;  1VQ6 Z;  3CC4 1;  1VQN 1;  1VQ7 Z;  1VQP 1;  1KC8 1;  3CMA Z;  3CCM Z;  3CD6 1;  3G4S 1;  3CCQ 1;  1VQ4 1;  3CCL 1;  1QVG Z;  1M1K 2;  1VQK 1;  3I56 1;  1YIJ Z;  1QVF Z;  3CXC Y;  1VQM Z;  1Q81 1;  3G6E 1;  1Q7Y 1;  3CME Z;  3CCS Z;  1YJ9 Z;  3CCV 1;  3CCR Z;  1QVG Y;  1N8R 1;  1YJW Z;  1Q81 2;  1KQS Z;  1Q7Y 2;  1QVF Y;  3I55 1;  2OTL Z;  3CPW Z;  1Q82 1;  2OTJ 1;  3CC2 1;  1VQ9 1;  3G71 Z;  3CCE 1;  3CCJ 1;  1W2B Y;  1N8R 2;  1VQN Z;  1S72 1;  3OW2 Z;  1K9M 1;  1YJN Z;  1VQO Z;  1KQS Y;  1Q82 2;  3CC7 1;  1VQ5 1;  1YHQ 1;  2QEX Z;  2QA4 Z;  1VQ6 1;  3CCV Z;  1K9M 2;  1NJI 1;  1VQL Z;  3CMA 1;  3CCM 1;  3OW2 Y;  3CCU Z;  1K8A 1;  1VQ8 Z;  1YI2 Z;  1YIJ 1;  3CC4 Z;  1M90 1;  1VQP Z; 
#chains in the Genus database with same CATH topology
 1ML8 A;  4NB9 A;  3CD6 Z;  3CCQ Z;  3J80 b;  1RNI A;  1K8A 2;  3I56 Z;  3GTM S;  4E30 A;  4MH4 A;  3S15 I;  4RVD A;  1SIW A;  3RZO I;  5T64 A;  2JIM A;  2P3Y A;  2G2K A;  5D1O B;  1WZN A;  1NUI A;  1VQ7 1;  2OOY B;  1QYP A;  1Y1V I;  3I55 Z;  2NVT I;  2Q51 A;  3TE5 B;  4NBF A;  1KD1 2;  3I4N I;  5T6B A;  3HOX I;  3CC2 Z;  1JJ2 Y;  1QXF A;  1Q86 1;  3CCE Z;  1KC8 2;  2QEX 1;  2E9H A;  1K73 1;  2LFU A;  4QTT A;  1N2F A;  2E2H I;  4E2Y A;  2RHB A;  5D1O A;  2GTH A;  3QWU A;  4A3K I;  1M1K 1;  1YUA A;  1Y1W I;  3CXC Z;  1Z01 A;  3F3F C;  1YI2 1;  4HH4 A;  3M4O I;  1RO4 A;  1VQP 1;  3J81 b;  3CD6 1;  3H0G I;  3CCQ 1;  1TWH I;  5AN9 F;  1S7M A;  3ESW A;  2O53 A;  3I56 1;  2AYD A;  3NH5 A;  2VPX A;  4E2X A;  5IP7 I;  1RQF A;  3CME Z;  1YJ9 Z;  2V3V A;  3S1M I;  3CCV 1;  3FQM A;  2QLV B;  2JIQ A;  1YJW Z;  1TFI A;  1Q7Y 2;  3I55 1;  3S1Q I;  2JIP A;  3I07 A;  2OTJ 1;  3CC2 1;  3RZD I;  3S16 I;  4EWC A;  3G71 Z;  3CCE 1;  2VF1 A;  2AKL A;  3OW2 Z;  3KIH A;  3JAM f;  3S1R I;  2IV2 X;  1VQO Z;  1YJN Z;  4BY7 I;  3S17 I;  1Q82 2;  1WW9 A;  3D2L A;  1P9N A;  1USP B;  3P5J B;  4NBD A;  2DE6 A;  1K9M 2;  3GTJ I;  4BBS I;  1VQL Z;  2E7Z A;  4AYB A;  1VQ8 Z;  4NFR A;  1Q16 A;  3GTQ I;  2KPI A;  4NBH A;  1M90 1;  1X3W A;  2E2J I;  2K5R A;  1NJI 2;  2VPZ A;  3CME 1;  4BY1 I;  1VQ4 Z;  1Y8C A;  1YJ9 1;  1YIT 1;  2RIQ A;  2QRD B;  4A3D I;  2JUB A;  1I3Q I;  2GU2 A;  3NH4 A;  1X0T A;  1Q86 2;  1JJ2 Z;  3T4N B;  3TDH B;  3BG1 B;  3G71 1;  4RV9 A;  2NAP A;  1YJN 1;  1VQO 1;  4A3M I;  2EGT A;  3GTO I;  3U50 C;  3CCJ Z;  4RVG A;  3JAM b;  1ZH1 A;  3MZK B;  3VB9 A;  4S1T A;  4DGL A;  1VQL 1;  1VQ5 Z;  1L1O C;  1VQ8 1;  3GTM I;  2O4H A;  2V45 A;  2V8J A;  2W04 A;  2NVQ I;  4RVH A;  3HOW I;  1KRL A;  1VQ4 1;  5CM2 M;  3VMG A;  1FDO A;  3Q87 A;  1VQM Z;  1SFO I;  3IX0 A;  2RT9 A;  4NBG A;  2R93 I;  1QVG Y;  2BJO A;  4E33 A;  1N8R 1;  2QRC B;  1Q81 2;  4A3B I;  3I4M I;  3IR7 A;  4RVF A;  2H85 A;  4A3C I;  3CPW Z;  3NDI A;  3VMI A;  1R9T I;  2R7Z I;  2F4O A;  2V8K A;  3CCJ 1;  4MD9 A;  5C4X I;  3M3Y I;  3NFZ A;  1KQS Y;  4X6A I;  3LUS A;  1VQ5 1;  3D9X A;  2QA4 Z;  2YAD A;  4A3G I;  2NVY I;  1WII A;  3S1N I;  4MXU A;  1RO2 A;  2KI7 B;  3CCU Z;  1K8A 1;  3PO2 I;  3K7A I;  4E2W A;  1JWH C;  2I3C A;  1TWG I;  3CC4 Z;  1VQM 1;  3HOZ I;  1ZB8 A;  2DE7 A;  3G4S Z;  2JR6 A;  3CCL Z;  1VQK Z;  4A3L I;  3CPW Y;  3HOV I;  3G6E Z;  4TNU A;  2M6N A;  3HOY I;  2HF1 A;  1AA6 A;  2JA5 I;  3D6W A;  2LIY A;  1K83 I;  5IT9 f;  4QTU A;  3F3P C;  5T67 A;  1VQ9 Z;  2JA7 I;  2IZ4 A;  5LL6 f;  2QA4 1;  1S72 Z;  4A3J I;  1X3Z A;  1I6H I;  1YJW 1;  3CCU 1;  2JMO A;  4NBC A;  3S2D I;  1K73 2;  1VQ6 Z;  4MRI A;  3CC4 1;  1VQ7 Z;  3FQQ A;  1FDI A;  3CMA Z;  3MON A;  3CCM Z;  4NB8 A;  3G4S 1;  3HKZ A;  3CCL 1;  2P28 A;  1QVG Z;  1M1K 2;  2ZAE B;  3VTN A;  1VQK 1;  3BG0 B;  1RO0 A;  4RS4 A;  1YIJ Z;  2F4M A;  2JIO A;  3VMH A;  3S2H I;  3G6E 1;  1Q7Y 1;  3CCS Z;  2QKD A;  1I50 I;  3CCR Z;  1RLY A;  4BXX I;  1KQS Z;  1QVF Y;  2OTL Z;  1DL6 A;  1Q82 1;  3NDJ A;  4NBB A;  1VQ9 1;  2JS4 A;  5IT9 b;  2JIR A;  3NH8 A;  4MD7 A;  4BBR I;  1S72 1;  1K9M 1;  4MON A;  2K3R A;  2WAQ A;  1Y1V S;  2GTI A;  2PK7 A;  1VQ6 1;  2OZK A;  4NOZ A;  3CCV Z;  3GCF A;  1NJI 1;  4NBE A;  3CMA 1;  3CCM 1;  3KIF A;  3MZL B;  2R92 I;  1WCM I;  1YUK A;  3PO3 S;  1NP6 A;  3GTG I;  1YIJ 1;  1VQN Z;  2E2I I;  2OOX B;  5A2Q f;  3H3V J;  2OTJ Z;  3CCS 1;  2PM9 A;  3PO3 I;  4A93 I;  3CCR 1;  1VLA A;  1M90 2;  1TWC I;  3IFU A;  3EED A;  5D1P A;  2OTL 1;  4HGY A;  2IZ3 A;  2LEX A;  4E31 A;  2JA8 I;  5C3E I;  4A3F I;  4XX2 A;  4CL1 A;  3GTK I;  5FLX f;  2DE5 A;  2QR1 B;  2M48 A;  3J7A 4;  3IF8 A;  4DQY B;  2B63 I;  2J6A A;  2Y0S A;  3GTL I;  1YIT Z;  1W2B Z;  3CC7 Z;  3GTP I;  1WJ2 A;  1YHQ Z;  4E2Z A;  3S14 I;  5C44 I;  2WB1 A;  1KD1 1;  1ZB9 A;  2VUM I;  1VQN 1;  1TWA I;  4NBA A;  1KC8 1;  1TWF I;  2RBL A;  3EER A;  4A3I I;  3J80 f;  4NH1 C;  5A2Q b;  1Z02 A;  1QVF Z;  1QF8 A;  3CXC Y;  4Y7N I;  1Q81 1;  2PMZ A;  4A3E I;  3CQZ I;  5FLM I;  2W03 A;  2VPW A;  4HGZ A;  4DK1 A;  1LQL A;  3HOU I;  2JA6 I;  2QRE B;  2R6M A;  2RPR A;  1W2B Y;  3FKI I;  1N8R 2;  2V8I A;  2NVX I;  4MD8 A;  1Z03 A;  5FLX b;  4E32 A;  2VUG A;  1PFT A;  3CC7 1;  5C4J I;  1YHQ 1;  1USP A;  2QEX Z;  2VPY A;  4Y52 I;  2YU9 I;  2Q4Z A;  3OW2 Y;  2HU9 A;  2JNY A;  3J81 f;  1YI2 Z;  5IP9 I;  3GKQ A;  1VQP Z; 
#chains in the Genus database with same CATH homology
 1ML8 A;  4NB9 A;  3CD6 Z;  3CCQ Z;  3J80 b;  1RNI A;  1K8A 2;  3I56 Z;  3GTM S;  4E30 A;  4MH4 A;  3S15 I;  4RVD A;  3RZO I;  5T64 A;  2P3Y A;  2G2K A;  5D1O B;  1NUI A;  1VQ7 1;  2OOY B;  1QYP A;  1Y1V I;  3I55 Z;  2NVT I;  2Q51 A;  3TE5 B;  4NBF A;  1KD1 2;  3I4N I;  5T6B A;  3HOX I;  3CC2 Z;  1JJ2 Y;  1Q86 1;  3CCE Z;  1KC8 2;  2QEX 1;  2E9H A;  1K73 1;  2LFU A;  4QTT A;  1N2F A;  2E2H I;  4E2Y A;  2RHB A;  5D1O A;  2GTH A;  3QWU A;  4A3K I;  1M1K 1;  1YUA A;  1Y1W I;  3CXC Z;  1Z01 A;  3F3F C;  1YI2 1;  4HH4 A;  3M4O I;  1RO4 A;  1VQP 1;  3J81 b;  3CD6 1;  3H0G I;  3CCQ 1;  1TWH I;  5AN9 F;  1S7M A;  3ESW A;  2O53 A;  3I56 1;  3NH5 A;  4E2X A;  5IP7 I;  1RQF A;  3CME Z;  1YJ9 Z;  3S1M I;  3CCV 1;  3FQM A;  2QLV B;  1YJW Z;  1TFI A;  1Q7Y 2;  3I55 1;  3S1Q I;  3I07 A;  2OTJ 1;  3CC2 1;  3RZD I;  3S16 I;  4EWC A;  3G71 Z;  3CCE 1;  2VF1 A;  2AKL A;  3OW2 Z;  3KIH A;  3JAM f;  3S1R I;  1YJN Z;  1VQO Z;  4BY7 I;  3S17 I;  1Q82 2;  1WW9 A;  1P9N A;  1USP B;  3P5J B;  4NBD A;  2DE6 A;  1K9M 2;  3GTJ I;  4BBS I;  1VQL Z;  4AYB A;  1VQ8 Z;  4NFR A;  3GTQ I;  2KPI A;  4NBH A;  1M90 1;  1X3W A;  2E2J I;  2K5R A;  1NJI 2;  3CME 1;  4BY1 I;  1VQ4 Z;  1YJ9 1;  1YIT 1;  2RIQ A;  2QRD B;  4A3D I;  2JUB A;  1I3Q I;  2GU2 A;  3NH4 A;  1X0T A;  1Q86 2;  1JJ2 Z;  3T4N B;  3TDH B;  3BG1 B;  3G71 1;  4RV9 A;  1YJN 1;  1VQO 1;  4A3M I;  2EGT A;  3GTO I;  3U50 C;  3CCJ Z;  4RVG A;  3JAM b;  1ZH1 A;  3MZK B;  3VB9 A;  4S1T A;  4DGL A;  1VQL 1;  1VQ5 Z;  1L1O C;  1VQ8 1;  3GTM I;  2O4H A;  2V8J A;  2W04 A;  2NVQ I;  4RVH A;  3HOW I;  1KRL A;  1VQ4 1;  5CM2 M;  3VMG A;  3Q87 A;  1VQM Z;  1SFO I;  3IX0 A;  2RT9 A;  4NBG A;  2R93 I;  1QVG Y;  2BJO A;  4E33 A;  1N8R 1;  2QRC B;  1Q81 2;  4A3B I;  3I4M I;  4RVF A;  2H85 A;  4A3C I;  3CPW Z;  3NDI A;  3VMI A;  1R9T I;  2R7Z I;  2F4O A;  2V8K A;  3CCJ 1;  4MD9 A;  5C4X I;  3M3Y I;  3NFZ A;  1KQS Y;  4X6A I;  3LUS A;  1VQ5 1;  3D9X A;  2QA4 Z;  2YAD A;  4A3G I;  2NVY I;  1WII A;  3S1N I;  4MXU A;  1RO2 A;  2KI7 B;  3CCU Z;  1K8A 1;  3PO2 I;  3K7A I;  4E2W A;  1JWH C;  2I3C A;  1TWG I;  3CC4 Z;  1VQM 1;  3HOZ I;  1ZB8 A;  2DE7 A;  3G4S Z;  2JR6 A;  3CCL Z;  1VQK Z;  4A3L I;  3CPW Y;  3HOV I;  3G6E Z;  4TNU A;  2M6N A;  3HOY I;  2HF1 A;  2JA5 I;  3D6W A;  2LIY A;  1K83 I;  5IT9 f;  4QTU A;  3F3P C;  1VQ9 Z;  5T67 A;  2JA7 I;  2IZ4 A;  5LL6 f;  2QA4 1;  1S72 Z;  4A3J I;  1X3Z A;  1I6H I;  1YJW 1;  3CCU 1;  2JMO A;  4NBC A;  3S2D I;  1K73 2;  1VQ6 Z;  4MRI A;  3CC4 1;  1VQ7 Z;  3FQQ A;  3CMA Z;  3MON A;  3CCM Z;  4NB8 A;  3G4S 1;  3HKZ A;  3CCL 1;  2P28 A;  1QVG Z;  1M1K 2;  2ZAE B;  3VTN A;  1VQK 1;  3BG0 B;  1RO0 A;  4RS4 A;  1YIJ Z;  2F4M A;  3VMH A;  3S2H I;  3G6E 1;  1Q7Y 1;  3CCS Z;  2QKD A;  1I50 I;  3CCR Z;  1RLY A;  4BXX I;  1KQS Z;  1QVF Y;  2OTL Z;  1DL6 A;  1Q82 1;  3NDJ A;  4NBB A;  1VQ9 1;  2JS4 A;  5IT9 b;  3NH8 A;  4MD7 A;  4BBR I;  1S72 1;  1K9M 1;  4MON A;  2K3R A;  2WAQ A;  1Y1V S;  2GTI A;  2PK7 A;  1VQ6 1;  2OZK A;  4NOZ A;  3CCV Z;  3GCF A;  1NJI 1;  4NBE A;  3CMA 1;  3CCM 1;  3KIF A;  3MZL B;  2R92 I;  1WCM I;  1YUK A;  3PO3 S;  1NP6 A;  3GTG I;  1YIJ 1;  1VQN Z;  2E2I I;  2OOX B;  5A2Q f;  3H3V J;  2OTJ Z;  3CCS 1;  2PM9 A;  3PO3 I;  4A93 I;  3CCR 1;  1VLA A;  1M90 2;  1TWC I;  3IFU A;  3EED A;  5D1P A;  2OTL 1;  4HGY A;  2IZ3 A;  4E31 A;  2JA8 I;  5C3E I;  4A3F I;  4XX2 A;  4CL1 A;  3GTK I;  5FLX f;  2DE5 A;  2QR1 B;  2M48 A;  3J7A 4;  3IF8 A;  4DQY B;  2B63 I;  2J6A A;  2Y0S A;  3GTL I;  1YIT Z;  1W2B Z;  3CC7 Z;  3GTP I;  1YHQ Z;  4E2Z A;  3S14 I;  5C44 I;  2WB1 A;  1KD1 1;  1ZB9 A;  2VUM I;  1VQN 1;  1TWA I;  4NBA A;  1KC8 1;  1TWF I;  2RBL A;  3EER A;  4A3I I;  3J80 f;  4NH1 C;  5A2Q b;  1Z02 A;  1QVF Z;  1QF8 A;  3CXC Y;  4Y7N I;  1Q81 1;  2PMZ A;  4A3E I;  3CQZ I;  5FLM I;  2W03 A;  4HGZ A;  4DK1 A;  1LQL A;  3HOU I;  2JA6 I;  2QRE B;  2R6M A;  2RPR A;  1W2B Y;  3FKI I;  1N8R 2;  2V8I A;  2NVX I;  4MD8 A;  1Z03 A;  5FLX b;  4E32 A;  2VUG A;  1PFT A;  3CC7 1;  5C4J I;  1YHQ 1;  1USP A;  2QEX Z;  4Y52 I;  2YU9 I;  2Q4Z A;  3OW2 Y;  2HU9 A;  2JNY A;  3J81 f;  1YI2 Z;  5IP9 I;  3GKQ A;  1VQP Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...