1YJW1

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjw100
1KQSY 1K9M2 1VQ8Z 1QVGY 1VQLZ 3I561 3CCV1 1VQP1 1VQN1 1W2BY 1NJI2 1K9M1 1VQOZ 1Q822 3G4S1 1VQKZ 2OTJZ 3CC41 3CCQZ 3G711 1NJI1 1YIJZ 1YHQ1 1QVGZ 3CC21 3CCM1 3CC7Z 1YJWZ 1Q821 2OTL1 1QVFY 1VQ71 3G6EZ 3CMEZ 3CD61 1VQMZ 1VQ51 1YI21 1YJNZ 3I551 1K732 3CCJZ 3OW2Y 3CXCY 3CCU1 1VQ9Z 1K731 1VQ4Z 1KD12 1YJ9Z 2QA4Z 1JJ2Y 2QEXZ 1VQ81 3CCLZ 3CCS1 1KQSZ 3CMA1 1KD11 1Q7Y2 3I56Z 3CCVZ 1VQPZ 3OW2Z 1VQNZ 1W2BZ 1Q7Y1 1VQ61 3CCEZ 3G4SZ 3CC4Z 3G71Z 3CCR1 3CPWY 1YHQZ 3CC2Z 1K8A2 3CCMZ 2OTLZ 1QVFZ 1VQ7Z 3CME1 1S721 1K8A1 3CD6Z 1YJN1 1YITZ 3CPWZ 3I55Z 1VQL1 1Q812 1VQ41 3CCUZ 1VQO1 3CXCZ 2QA41 1M902 1Q811 1N8R2 1VQK1 2OTJ1 2QEX1 3CCQ1 3CCL1 1JJ2Z 1YIJ1 3CMAZ 3CCSZ 1M901 1YJW1 3CC71 1N8R1 1KC82 3G6E1 1VQ6Z 3CCE1 1KC81 1VQM1 1Q862 1VQ5Z 1YI2Z 3CCRZ 1Q861 1M1K2 3CCJ1 1S72Z 1VQ91 1YJ91 1M1K1 1YIT1
chains in the Genus database with same CATH superfamily
2QRCB 2B63I 4TNUA 2KPIA 1I50I 1AA6A 1VQLZ 2BJOA 3S14I 2E7ZA 5C4JI 2OTJZ 4NBBA 3CCQZ 2QRDB 4MONA 4E2WA 1NJI1 4DQYB 1YIJZ 2QLVB 3ESWA 3CC7Z 1VLAA 1ZB8A 2JMOA 1I6HI 3J81b 1YUKA 3IX0A 3CD61 4A3LI 1VQMZ 1VQ51 1YI21 1YJNZ 4RVHA 3GTJI 1KRLA 4RVDA 5IP7I 4EWCA 3CCJZ 3T4NB 2I3CA 3VTNA 1K731 1KD12 3TE5B 2AYDA 2WAQA 4NB9A 2VPWA 4E31A 3CMA1 4A3DI 2ZAEB 1RO4A 1VQPZ 2PM9A 4CL1A 3GTOI 2O4HA 5T67A 1VQ61 1Y8CA 3CCEZ 3K7AI 1P9NA 1USPB 3CPWY 2JA6I 3CC2Z 1X0TA 2OTLZ 3S15I 2P3YA 1ZH1A 1RLYA 1R9TI 4A3BI 3GTKI 5CM2M 3I55Z 4E32A 3NH5A 3S2DI 2LIYA 2DE5A 4NBEA 1VQ41 2VF1A 3VMIA 2QA41 4NBCA 1N8R2 2HU9A 1FDIA 3CCL1 3D2LA 4RVGA 3GTGI 2P28A 1YJW1 1KC82 1FDOA 2W04A 3GTQI 2JIMA 1QXFA 2QR1B 1Z02A 1RO0A 3CCRZ 4A3CI 3JAMb 3HOVI 2J6AA 5FLMI 1YJ91 1M1K1 4E2YA 3BG1B 2HF1A 2OOYB 3D9XA 1KQSY 2RT9A 4XX2A 3NDJA 2OZKA 3I561 4NBDA 3J80b 1NJI2 2VUMI 1VQOZ 3GKQA 3G4S1 2OOXB 3CC41 2NVTI 3G711 1L1OC 1QVGZ 3NH4A 2Y0SA 1Z01A 1Q821 4NBFA 3JAMf 3G6EZ 2Q4ZA 2E2HI 1K732 2KI7B 4RV9A 3CCU1 1VQ9Z 2GTIA 3CQZI 3MZLB 1JJ2Y 2QEXZ 3J80f 4A3KI 3CCS1 2JUBA 1KQSZ 2JA5I 3MZKB 3OW2Z 5IT9b 3BG0B 2E2JI 5IP9I 2RBLA 2K5RA 1S721 3CD6Z 1YJN1 3HOYI 4NFRA 2GTHA 3GTMI 3S2HI 2NVXI 3S1RI 4BXXI 3S17I 2R6MA 3FQQA 4A3EI 4NOZA 2H85A 1X3ZA 4MD7A 4A3GI 1I3QI 3HOZI 4E2XA 5D1OA 1Q16A 1VQK1 4QTTA 1JJ2Z 3NDIA 3CMAZ 3IF8A 5IT9f 3IR7A 2Q51A 1TWFI 4HGZA 3GCFA 2JIRA 1VQ6Z 3CCE1 1K83I 3S16I 1Z03A 2M6NA 4A3II 3NFZA 1WIIA 5FLXb 1Q861 1M1K2 2JA7I 3M3YI 1RNIA 4NH1C 3FKII 1ML8A 1LQLA 3S1QI 1VQ8Z 1QVGY 3TDHB 3CCV1 4RS4A 3FQMA 2JIPA 1VQN1 1W2BY 1K9M1 2R7ZI 4A3FI 2V8KA 3GTLI 4BBRI 1Q822 3GTMS 1WZNA 1YHQ1 1SIWA 2RPRA 4MD9A 3CCM1 1YJWZ 3S1NI 1QVFY 2YADA 2RHBA 2DE6A 1VQ71 3CMEZ 5FLXf 2JA8I 3I4NI 1YUAA 3Q87A 1WJ2A 1WW9A 3OW2Y 3P5JB 3VB9A 3CXCY 5LL6f 1YJ9Z 3HKZA 2DE7A 3HOXI 2G2KA 1DL6A 1ZB9A 3J7A4 2F4OA 3I56Z 2NVYI 1W2BZ 1Q7Y1 5AN9F 3VMGA 4HH4A 3G4SZ 4DGLA 3CC4Z 3G71Z 4A3MI 1TWCI 3I07A 4HGYA 2E9HA 3F3PC 4NB8A 1QVFZ 2M48A 3IFUA 4A93I 1K8A1 2IZ3A 1YITZ 2V8IA 3GTPI 4MRIA 4NBAA 4BBSI 4QTUA 4BY7I 1VQL1 4E2ZA 3LUSA 2EGTA 3S1MI 2GU2A 3KIHA 3VMHA 3EEDA 3CCUZ 3CXCZ 5C44I 1Q811 2OTJ1 2QEX1 3CCQ1 3PO2I 1TWGI 2JS4A 1YIJ1 3CCSZ 1M901 3I4MI 2VPZA 4BY1I 3CC71 2JR6A 5A2Qf 2QREB 1VQM1 1Q862 1VQ5Z 1YI2Z 5D1OB 2W03A 4DK1A 4Y7NI 3CCJ1 3F3FC 2PMZA 1S72Z 4Y52I 4MD8A 3RZDI 2O53A 2WB1A 3HOUI 1K9M2 3HOWI 1VQP1 3M4OI 2R93I 2NVQI 4NBHA 2NAPA 1VQKZ 2IZ4A 1N2FA 3H3VJ 3CC21 2OTL1 2LEXA 5T6BA 5C3EI 2LFUA 3J81f 2JIOA 2QKDA 3I551 3NH8A 1NUIA 3H0GI 1RQFA 3KIFA 2VPXA 1X3WA 1NP6A 1VQ4Z 4E30A 2QA4Z 4AYBA 1USPA 1VQ81 1PFTA 3CCLZ 4A3JI 1KD11 1Q7Y2 3CCVZ 1VQNZ 1RO2A 4NBGA 1Y1VI 3QWUA 2RIQA 4RVFA 2V45A 3PO3I 3CCR1 1YHQZ 1K8A2 2JIQA 3CCMZ 2IV2X 4MH4A 1TWAI 1VQ7Z 1JWHC 3CME1 2E2II 4E33A 5C4XI 3CPWZ 2K3RA 1QF8A 2AKLA 4S1TA 5T64A 1Q812 3U50C 2V3VA 3D6WA 1Y1WI 2YU9I 1VQO1 1M902 2VUGA 2R92I 5A2Qb 5D1PA 3RZOI 2F4MA 1N8R1 1SFOI 2JNYA 1WCMI 3G6E1 3MONA 1KC81 2PK7A 1QYPA 1S7MA 4MXUA 2V8JA 4X6AI 1TFIA 1TWHI 3EERA 1Y1VS 1VQ91 2VPYA 3PO3S 1YIT1
chains in the Genus database with same CATH topology
2QRCB 2B63I 4TNUA 2KPIA 1I50I 1VQLZ 2BJOA 3S14I 5C4JI 2OTJZ 4NBBA 3CCQZ 2QRDB 4MONA 4E2WA 1NJI1 4DQYB 1YIJZ 2QLVB 3ESWA 3CC7Z 1VLAA 1ZB8A 2JMOA 1I6HI 3J81b 1YUKA 3IX0A 3CD61 4A3LI 1VQMZ 1VQ51 1YI21 1YJNZ 4RVHA 3GTJI 1KRLA 4RVDA 5IP7I 4EWCA 3CCJZ 3T4NB 2I3CA 3VTNA 1K731 1KD12 3TE5B 4NB9A 2WAQA 4E31A 3CMA1 4A3DI 2ZAEB 1RO4A 1VQPZ 2PM9A 4CL1A 3GTOI 2O4HA 5T67A 1VQ61 3CCEZ 3K7AI 1P9NA 1USPB 3CPWY 2JA6I 3CC2Z 1X0TA 2OTLZ 3S15I 2P3YA 1ZH1A 1RLYA 1R9TI 4A3BI 3GTKI 5CM2M 3I55Z 4E32A 3NH5A 3S2DI 2LIYA 2DE5A 4NBEA 1VQ41 2VF1A 3VMIA 2QA41 4NBCA 1N8R2 2HU9A 3CCL1 3GTGI 4RVGA 2P28A 1YJW1 1KC82 2W04A 3GTQI 2QR1B 1Z02A 1RO0A 3CCRZ 4A3CI 3JAMb 3HOVI 2J6AA 5FLMI 1YJ91 1M1K1 4E2YA 3BG1B 2HF1A 2OOYB 3D9XA 1KQSY 2RT9A 4XX2A 3NDJA 2OZKA 3I561 4NBDA 3J80b 1NJI2 2VUMI 1VQOZ 3GKQA 3G4S1 2OOXB 3CC41 2NVTI 3G711 1L1OC 1QVGZ 3NH4A 2Y0SA 1Z01A 1Q821 4NBFA 3JAMf 3G6EZ 2Q4ZA 2E2HI 1K732 2KI7B 4RV9A 3CCU1 1VQ9Z 2GTIA 3CQZI 3MZLB 1JJ2Y 2QEXZ 3J80f 4A3KI 3CCS1 2JUBA 1KQSZ 2JA5I 3MZKB 3OW2Z 5IT9b 3BG0B 2E2JI 5IP9I 2RBLA 2K5RA 1S721 3CD6Z 1YJN1 3HOYI 4NFRA 2GTHA 3GTMI 3S2HI 2NVXI 3S1RI 4BXXI 3S17I 2R6MA 3FQQA 4A3EI 4NOZA 2H85A 1X3ZA 4MD7A 4A3GI 1I3QI 3HOZI 4E2XA 5D1OA 1VQK1 4QTTA 1JJ2Z 3NDIA 3CMAZ 3IF8A 5IT9f 2Q51A 1TWFI 4HGZA 3GCFA 1VQ6Z 3CCE1 1K83I 3S16I 1Z03A 2M6NA 4A3II 3NFZA 1WIIA 5FLXb 1Q861 1M1K2 2JA7I 3M3YI 1RNIA 4NH1C 3FKII 1ML8A 1LQLA 3S1QI 1VQ8Z 1QVGY 3TDHB 3CCV1 4RS4A 3FQMA 1VQN1 1W2BY 1K9M1 2R7ZI 4A3FI 2V8KA 3GTLI 4BBRI 1Q822 3GTMS 1YHQ1 2RPRA 4MD9A 3CCM1 1YJWZ 3S1NI 1QVFY 2YADA 2RHBA 2DE6A 1VQ71 3CMEZ 5FLXf 2JA8I 3I4NI 1YUAA 3Q87A 1WW9A 3OW2Y 3P5JB 3VB9A 3CXCY 5LL6f 1YJ9Z 3HKZA 2DE7A 3HOXI 2G2KA 1DL6A 1ZB9A 3J7A4 2F4OA 3I56Z 2NVYI 1W2BZ 1Q7Y1 5AN9F 3VMGA 4HH4A 3G4SZ 4DGLA 3CC4Z 3G71Z 4A3MI 1TWCI 3I07A 4HGYA 2E9HA 3F3PC 4NB8A 1QVFZ 2M48A 3IFUA 4A93I 1K8A1 2IZ3A 1YITZ 2V8IA 3GTPI 4MRIA 4NBAA 4BBSI 4QTUA 4BY7I 1VQL1 4E2ZA 3LUSA 2EGTA 3S1MI 2GU2A 3KIHA 3VMHA 3EEDA 3CCUZ 3CXCZ 5C44I 1Q811 2OTJ1 2QEX1 3CCQ1 3PO2I 1TWGI 2JS4A 1YIJ1 3CCSZ 1M901 3I4MI 4BY1I 3CC71 2JR6A 5A2Qf 2QREB 1VQM1 1Q862 1VQ5Z 1YI2Z 5D1OB 2W03A 4DK1A 4Y7NI 3CCJ1 3F3FC 2PMZA 1S72Z 4Y52I 3RZDI 4MD8A 2O53A 2WB1A 3HOUI 1K9M2 3HOWI 1VQP1 3M4OI 2R93I 2NVQI 4NBHA 1VQKZ 2IZ4A 1N2FA 3H3VJ 3CC21 2OTL1 5T6BA 5C3EI 2LFUA 3J81f 2QKDA 3I551 3NH8A 1NUIA 3H0GI 1RQFA 3KIFA 1X3WA 1NP6A 1VQ4Z 4E30A 2QA4Z 4AYBA 1USPA 1VQ81 1PFTA 3CCLZ 4A3JI 1KD11 1Q7Y2 3CCVZ 1VQNZ 1RO2A 4NBGA 1Y1VI 3QWUA 2RIQA 4RVFA 3PO3I 3CCR1 1YHQZ 1K8A2 3CCMZ 4MH4A 1TWAI 1VQ7Z 1JWHC 3CME1 2E2II 4E33A 5C4XI 3CPWZ 2K3RA 1QF8A 2AKLA 4S1TA 5T64A 1Q812 3D6WA 3U50C 1Y1WI 2YU9I 1VQO1 1M902 2VUGA 2R92I 5A2Qb 5D1PA 3RZOI 2F4MA 1N8R1 1SFOI 2JNYA 1WCMI 3G6E1 3MONA 1KC81 2PK7A 1QYPA 1S7MA 4MXUA 2V8JA 4X6AI 1TFIA 1TWHI 3EERA 1Y1VS 1VQ91 3PO3S 1YIT1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS Y;  1K9M 2;  1VQ8 Z;  1QVG Y;  1VQL Z;  3I56 1;  3CCV 1;  1VQP 1;  1VQN 1;  1W2B Y;  1NJI 2;  1K9M 1;  1VQO Z;  1Q82 2;  3G4S 1;  1VQK Z;  2OTJ Z;  3CC4 1;  3CCQ Z;  3G71 1;  1NJI 1;  1YIJ Z;  1YHQ 1;  1QVG Z;  3CC2 1;  3CCM 1;  3CC7 Z;  1YJW Z;  1Q82 1;  2OTL 1;  1QVF Y;  1VQ7 1;  3G6E Z;  3CME Z;  3CD6 1;  1VQM Z;  1VQ5 1;  1YI2 1;  1YJN Z;  3I55 1;  1K73 2;  3CCJ Z;  3OW2 Y;  3CXC Y;  3CCU 1;  1VQ9 Z;  1K73 1;  1VQ4 Z;  1KD1 2;  1YJ9 Z;  2QA4 Z;  1JJ2 Y;  2QEX Z;  1VQ8 1;  3CCL Z;  3CCS 1;  1KQS Z;  3CMA 1;  1KD1 1;  1Q7Y 2;  3I56 Z;  3CCV Z;  1VQP Z;  3OW2 Z;  1VQN Z;  1W2B Z;  1Q7Y 1;  1VQ6 1;  3CCE Z;  3G4S Z;  3CC4 Z;  3G71 Z;  3CCR 1;  3CPW Y;  1YHQ Z;  3CC2 Z;  1K8A 2;  3CCM Z;  2OTL Z;  1QVF Z;  1VQ7 Z;  3CME 1;  1S72 1;  1K8A 1;  3CD6 Z;  1YJN 1;  1YIT Z;  3CPW Z;  3I55 Z;  1VQL 1;  1Q81 2;  1VQ4 1;  3CCU Z;  1VQO 1;  3CXC Z;  2QA4 1;  1M90 2;  1Q81 1;  1N8R 2;  1VQK 1;  2OTJ 1;  2QEX 1;  3CCQ 1;  3CCL 1;  1JJ2 Z;  1YIJ 1;  3CMA Z;  3CCS Z;  1M90 1;  1YJW 1;  3CC7 1;  1N8R 1;  1KC8 2;  3G6E 1;  1VQ6 Z;  3CCE 1;  1KC8 1;  1VQM 1;  1Q86 2;  1VQ5 Z;  1YI2 Z;  3CCR Z;  1Q86 1;  1M1K 2;  3CCJ 1;  1S72 Z;  1VQ9 1;  1YJ9 1;  1M1K 1;  1YIT 1; 
#chains in the Genus database with same CATH topology
 2QRC B;  2B63 I;  4TNU A;  2KPI A;  1I50 I;  1AA6 A;  1VQL Z;  2BJO A;  3S14 I;  2E7Z A;  5C4J I;  2OTJ Z;  4NBB A;  3CCQ Z;  2QRD B;  4MON A;  4E2W A;  1NJI 1;  4DQY B;  1YIJ Z;  2QLV B;  3ESW A;  3CC7 Z;  1VLA A;  1ZB8 A;  2JMO A;  1I6H I;  3J81 b;  1YUK A;  3IX0 A;  3CD6 1;  4A3L I;  1VQM Z;  1VQ5 1;  1YI2 1;  1YJN Z;  4RVH A;  3GTJ I;  1KRL A;  4RVD A;  5IP7 I;  4EWC A;  3CCJ Z;  3T4N B;  2I3C A;  3VTN A;  1K73 1;  1KD1 2;  3TE5 B;  2AYD A;  2WAQ A;  4NB9 A;  2VPW A;  4E31 A;  3CMA 1;  4A3D I;  2ZAE B;  1RO4 A;  1VQP Z;  2PM9 A;  4CL1 A;  3GTO I;  2O4H A;  5T67 A;  1VQ6 1;  1Y8C A;  3CCE Z;  3K7A I;  1P9N A;  1USP B;  3CPW Y;  2JA6 I;  3CC2 Z;  1X0T A;  2OTL Z;  3S15 I;  2P3Y A;  1ZH1 A;  1RLY A;  1R9T I;  4A3B I;  3GTK I;  5CM2 M;  3I55 Z;  4E32 A;  3NH5 A;  3S2D I;  2LIY A;  2DE5 A;  4NBE A;  1VQ4 1;  2VF1 A;  3VMI A;  2QA4 1;  4NBC A;  1N8R 2;  2HU9 A;  1FDI A;  3CCL 1;  3D2L A;  4RVG A;  3GTG I;  2P28 A;  1YJW 1;  1KC8 2;  1FDO A;  2W04 A;  3GTQ I;  2JIM A;  1QXF A;  2QR1 B;  1Z02 A;  1RO0 A;  3CCR Z;  4A3C I;  3JAM b;  3HOV I;  2J6A A;  5FLM I;  1YJ9 1;  1M1K 1;  4E2Y A;  3BG1 B;  2HF1 A;  2OOY B;  3D9X A;  1KQS Y;  2RT9 A;  4XX2 A;  3NDJ A;  2OZK A;  3I56 1;  4NBD A;  3J80 b;  1NJI 2;  2VUM I;  1VQO Z;  3GKQ A;  3G4S 1;  2OOX B;  3CC4 1;  2NVT I;  3G71 1;  1L1O C;  1QVG Z;  3NH4 A;  2Y0S A;  1Z01 A;  1Q82 1;  4NBF A;  3JAM f;  3G6E Z;  2Q4Z A;  2E2H I;  1K73 2;  2KI7 B;  4RV9 A;  3CCU 1;  1VQ9 Z;  2GTI A;  3CQZ I;  3MZL B;  1JJ2 Y;  2QEX Z;  3J80 f;  4A3K I;  3CCS 1;  2JUB A;  1KQS Z;  2JA5 I;  3MZK B;  3OW2 Z;  5IT9 b;  3BG0 B;  2E2J I;  5IP9 I;  2RBL A;  2K5R A;  1S72 1;  3CD6 Z;  1YJN 1;  3HOY I;  4NFR A;  2GTH A;  3GTM I;  3S2H I;  2NVX I;  3S1R I;  4BXX I;  3S17 I;  2R6M A;  3FQQ A;  4A3E I;  4NOZ A;  2H85 A;  1X3Z A;  4MD7 A;  4A3G I;  1I3Q I;  3HOZ I;  4E2X A;  5D1O A;  1Q16 A;  1VQK 1;  4QTT A;  1JJ2 Z;  3NDI A;  3CMA Z;  3IF8 A;  5IT9 f;  3IR7 A;  2Q51 A;  1TWF I;  4HGZ A;  3GCF A;  2JIR A;  1VQ6 Z;  3CCE 1;  1K83 I;  3S16 I;  1Z03 A;  2M6N A;  4A3I I;  3NFZ A;  1WII A;  5FLX b;  1Q86 1;  1M1K 2;  2JA7 I;  3M3Y I;  1RNI A;  4NH1 C;  3FKI I;  1ML8 A;  1LQL A;  3S1Q I;  1VQ8 Z;  1QVG Y;  3TDH B;  3CCV 1;  4RS4 A;  3FQM A;  2JIP A;  1VQN 1;  1W2B Y;  1K9M 1;  2R7Z I;  4A3F I;  2V8K A;  3GTL I;  4BBR I;  1Q82 2;  3GTM S;  1WZN A;  1YHQ 1;  1SIW A;  2RPR A;  4MD9 A;  3CCM 1;  1YJW Z;  3S1N I;  1QVF Y;  2YAD A;  2RHB A;  2DE6 A;  1VQ7 1;  3CME Z;  5FLX f;  2JA8 I;  3I4N I;  1YUA A;  3Q87 A;  1WJ2 A;  1WW9 A;  3OW2 Y;  3P5J B;  3VB9 A;  3CXC Y;  5LL6 f;  1YJ9 Z;  3HKZ A;  2DE7 A;  3HOX I;  2G2K A;  1DL6 A;  1ZB9 A;  3J7A 4;  2F4O A;  3I56 Z;  2NVY I;  1W2B Z;  1Q7Y 1;  5AN9 F;  3VMG A;  4HH4 A;  3G4S Z;  4DGL A;  3CC4 Z;  3G71 Z;  4A3M I;  1TWC I;  3I07 A;  4HGY A;  2E9H A;  3F3P C;  4NB8 A;  1QVF Z;  2M48 A;  3IFU A;  4A93 I;  1K8A 1;  2IZ3 A;  1YIT Z;  2V8I A;  3GTP I;  4MRI A;  4NBA A;  4BBS I;  4QTU A;  4BY7 I;  1VQL 1;  4E2Z A;  3LUS A;  2EGT A;  3S1M I;  2GU2 A;  3KIH A;  3VMH A;  3EED A;  3CCU Z;  3CXC Z;  5C44 I;  1Q81 1;  2OTJ 1;  2QEX 1;  3CCQ 1;  3PO2 I;  1TWG I;  2JS4 A;  1YIJ 1;  3CCS Z;  1M90 1;  3I4M I;  2VPZ A;  4BY1 I;  3CC7 1;  2JR6 A;  5A2Q f;  2QRE B;  1VQM 1;  1Q86 2;  1VQ5 Z;  1YI2 Z;  5D1O B;  2W03 A;  4DK1 A;  4Y7N I;  3CCJ 1;  3F3F C;  2PMZ A;  1S72 Z;  4Y52 I;  4MD8 A;  3RZD I;  2O53 A;  2WB1 A;  3HOU I;  1K9M 2;  3HOW I;  1VQP 1;  3M4O I;  2R93 I;  2NVQ I;  4NBH A;  2NAP A;  1VQK Z;  2IZ4 A;  1N2F A;  3H3V J;  3CC2 1;  2OTL 1;  2LEX A;  5T6B A;  5C3E I;  2LFU A;  3J81 f;  2JIO A;  2QKD A;  3I55 1;  3NH8 A;  1NUI A;  3H0G I;  1RQF A;  3KIF A;  2VPX A;  1X3W A;  1NP6 A;  1VQ4 Z;  4E30 A;  2QA4 Z;  4AYB A;  1USP A;  1VQ8 1;  1PFT A;  3CCL Z;  4A3J I;  1KD1 1;  1Q7Y 2;  3CCV Z;  1VQN Z;  1RO2 A;  4NBG A;  1Y1V I;  3QWU A;  2RIQ A;  4RVF A;  2V45 A;  3PO3 I;  3CCR 1;  1YHQ Z;  1K8A 2;  2JIQ A;  3CCM Z;  2IV2 X;  4MH4 A;  1TWA I;  1VQ7 Z;  1JWH C;  3CME 1;  2E2I I;  4E33 A;  5C4X I;  3CPW Z;  2K3R A;  1QF8 A;  2AKL A;  4S1T A;  5T64 A;  1Q81 2;  3U50 C;  2V3V A;  3D6W A;  1Y1W I;  2YU9 I;  1VQO 1;  1M90 2;  2VUG A;  2R92 I;  5A2Q b;  5D1P A;  3RZO I;  2F4M A;  1N8R 1;  1SFO I;  2JNY A;  1WCM I;  3G6E 1;  3MON A;  1KC8 1;  2PK7 A;  1QYP A;  1S7M A;  4MXU A;  2V8J A;  4X6A I;  1TFI A;  1TWH I;  3EER A;  1Y1V S;  1VQ9 1;  2VPY A;  3PO3 S;  1YIT 1; 
#chains in the Genus database with same CATH homology
 2QRC B;  2B63 I;  4TNU A;  2KPI A;  1I50 I;  1VQL Z;  2BJO A;  3S14 I;  5C4J I;  2OTJ Z;  4NBB A;  3CCQ Z;  2QRD B;  4MON A;  4E2W A;  1NJI 1;  4DQY B;  1YIJ Z;  2QLV B;  3ESW A;  3CC7 Z;  1VLA A;  1ZB8 A;  2JMO A;  1I6H I;  3J81 b;  1YUK A;  3IX0 A;  3CD6 1;  4A3L I;  1VQM Z;  1VQ5 1;  1YI2 1;  1YJN Z;  4RVH A;  3GTJ I;  1KRL A;  4RVD A;  5IP7 I;  4EWC A;  3CCJ Z;  3T4N B;  2I3C A;  3VTN A;  1K73 1;  1KD1 2;  3TE5 B;  4NB9 A;  2WAQ A;  4E31 A;  3CMA 1;  4A3D I;  2ZAE B;  1RO4 A;  1VQP Z;  2PM9 A;  4CL1 A;  3GTO I;  2O4H A;  5T67 A;  1VQ6 1;  3CCE Z;  3K7A I;  1P9N A;  1USP B;  3CPW Y;  2JA6 I;  3CC2 Z;  1X0T A;  2OTL Z;  3S15 I;  2P3Y A;  1ZH1 A;  1RLY A;  1R9T I;  4A3B I;  3GTK I;  5CM2 M;  3I55 Z;  4E32 A;  3NH5 A;  3S2D I;  2LIY A;  2DE5 A;  4NBE A;  1VQ4 1;  2VF1 A;  3VMI A;  2QA4 1;  4NBC A;  1N8R 2;  2HU9 A;  3CCL 1;  3GTG I;  4RVG A;  2P28 A;  1YJW 1;  1KC8 2;  2W04 A;  3GTQ I;  2QR1 B;  1Z02 A;  1RO0 A;  3CCR Z;  4A3C I;  3JAM b;  3HOV I;  2J6A A;  5FLM I;  1YJ9 1;  1M1K 1;  4E2Y A;  3BG1 B;  2HF1 A;  2OOY B;  3D9X A;  1KQS Y;  2RT9 A;  4XX2 A;  3NDJ A;  2OZK A;  3I56 1;  4NBD A;  3J80 b;  1NJI 2;  2VUM I;  1VQO Z;  3GKQ A;  3G4S 1;  2OOX B;  3CC4 1;  2NVT I;  3G71 1;  1L1O C;  1QVG Z;  3NH4 A;  2Y0S A;  1Z01 A;  1Q82 1;  4NBF A;  3JAM f;  3G6E Z;  2Q4Z A;  2E2H I;  1K73 2;  2KI7 B;  4RV9 A;  3CCU 1;  1VQ9 Z;  2GTI A;  3CQZ I;  3MZL B;  1JJ2 Y;  2QEX Z;  3J80 f;  4A3K I;  3CCS 1;  2JUB A;  1KQS Z;  2JA5 I;  3MZK B;  3OW2 Z;  5IT9 b;  3BG0 B;  2E2J I;  5IP9 I;  2RBL A;  2K5R A;  1S72 1;  3CD6 Z;  1YJN 1;  3HOY I;  4NFR A;  2GTH A;  3GTM I;  3S2H I;  2NVX I;  3S1R I;  4BXX I;  3S17 I;  2R6M A;  3FQQ A;  4A3E I;  4NOZ A;  2H85 A;  1X3Z A;  4MD7 A;  4A3G I;  1I3Q I;  3HOZ I;  4E2X A;  5D1O A;  1VQK 1;  4QTT A;  1JJ2 Z;  3NDI A;  3CMA Z;  3IF8 A;  5IT9 f;  2Q51 A;  1TWF I;  4HGZ A;  3GCF A;  1VQ6 Z;  3CCE 1;  1K83 I;  3S16 I;  1Z03 A;  2M6N A;  4A3I I;  3NFZ A;  1WII A;  5FLX b;  1Q86 1;  1M1K 2;  2JA7 I;  3M3Y I;  1RNI A;  4NH1 C;  3FKI I;  1ML8 A;  1LQL A;  3S1Q I;  1VQ8 Z;  1QVG Y;  3TDH B;  3CCV 1;  4RS4 A;  3FQM A;  1VQN 1;  1W2B Y;  1K9M 1;  2R7Z I;  4A3F I;  2V8K A;  3GTL I;  4BBR I;  1Q82 2;  3GTM S;  1YHQ 1;  2RPR A;  4MD9 A;  3CCM 1;  1YJW Z;  3S1N I;  1QVF Y;  2YAD A;  2RHB A;  2DE6 A;  1VQ7 1;  3CME Z;  5FLX f;  2JA8 I;  3I4N I;  1YUA A;  3Q87 A;  1WW9 A;  3OW2 Y;  3P5J B;  3VB9 A;  3CXC Y;  5LL6 f;  1YJ9 Z;  3HKZ A;  2DE7 A;  3HOX I;  2G2K A;  1DL6 A;  1ZB9 A;  3J7A 4;  2F4O A;  3I56 Z;  2NVY I;  1W2B Z;  1Q7Y 1;  5AN9 F;  3VMG A;  4HH4 A;  3G4S Z;  4DGL A;  3CC4 Z;  3G71 Z;  4A3M I;  1TWC I;  3I07 A;  4HGY A;  2E9H A;  3F3P C;  4NB8 A;  1QVF Z;  2M48 A;  3IFU A;  4A93 I;  1K8A 1;  2IZ3 A;  1YIT Z;  2V8I A;  3GTP I;  4MRI A;  4NBA A;  4BBS I;  4QTU A;  4BY7 I;  1VQL 1;  4E2Z A;  3LUS A;  2EGT A;  3S1M I;  2GU2 A;  3KIH A;  3VMH A;  3EED A;  3CCU Z;  3CXC Z;  5C44 I;  1Q81 1;  2OTJ 1;  2QEX 1;  3CCQ 1;  3PO2 I;  1TWG I;  2JS4 A;  1YIJ 1;  3CCS Z;  1M90 1;  3I4M I;  4BY1 I;  3CC7 1;  2JR6 A;  5A2Q f;  2QRE B;  1VQM 1;  1Q86 2;  1VQ5 Z;  1YI2 Z;  5D1O B;  2W03 A;  4DK1 A;  4Y7N I;  3CCJ 1;  3F3F C;  2PMZ A;  1S72 Z;  4Y52 I;  3RZD I;  4MD8 A;  2O53 A;  2WB1 A;  3HOU I;  1K9M 2;  3HOW I;  1VQP 1;  3M4O I;  2R93 I;  2NVQ I;  4NBH A;  1VQK Z;  2IZ4 A;  1N2F A;  3H3V J;  3CC2 1;  2OTL 1;  5T6B A;  5C3E I;  2LFU A;  3J81 f;  2QKD A;  3I55 1;  3NH8 A;  1NUI A;  3H0G I;  1RQF A;  3KIF A;  1X3W A;  1NP6 A;  1VQ4 Z;  4E30 A;  2QA4 Z;  4AYB A;  1USP A;  1VQ8 1;  1PFT A;  3CCL Z;  4A3J I;  1KD1 1;  1Q7Y 2;  3CCV Z;  1VQN Z;  1RO2 A;  4NBG A;  1Y1V I;  3QWU A;  2RIQ A;  4RVF A;  3PO3 I;  3CCR 1;  1YHQ Z;  1K8A 2;  3CCM Z;  4MH4 A;  1TWA I;  1VQ7 Z;  1JWH C;  3CME 1;  2E2I I;  4E33 A;  5C4X I;  3CPW Z;  2K3R A;  1QF8 A;  2AKL A;  4S1T A;  5T64 A;  1Q81 2;  3D6W A;  3U50 C;  1Y1W I;  2YU9 I;  1VQO 1;  1M90 2;  2VUG A;  2R92 I;  5A2Q b;  5D1P A;  3RZO I;  2F4M A;  1N8R 1;  1SFO I;  2JNY A;  1WCM I;  3G6E 1;  3MON A;  1KC8 1;  2PK7 A;  1QYP A;  1S7M A;  4MXU A;  2V8J A;  4X6A I;  1TFI A;  1TWH I;  3EER A;  1Y1V S;  1VQ9 1;  3PO3 S;  1YIT 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...