1YJW1

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yjw100
3CCV1 1Q812 3CC2Z 1KC82 3CCM1 1M901 1Q7Y1 1W2BZ 1QVFZ 1VQ6Z 1YJ9Z 1YIT1 1M1K1 2OTLZ 2OTJZ 3I56Z 1VQ9Z 1VQ7Z 3CCS1 1VQ8Z 3CMEZ 3CCLZ 1K8A2 3CMA1 3CCQ1 1S72Z 1Q811 1KC81 1YJW1 1VQKZ 3CCU1 2QEXZ 3CCJZ 1YHQZ 1YIJ1 1JJ2Z 1NJI2 1VQOZ 1VQPZ 3CC21 3CC7Z 3OW2Z 3G4SZ 3CPWY 1Q822 1KD12 3CXCZ 1VQ5Z 1VQLZ 1K8A1 3G71Z 1QVGY 1N8R2 3CCEZ 1QVFY 1VQ61 1YJ91 2OTJ1 2OTL1 3I561 1VQ91 3CCRZ 1VQ71 1VQ4Z 1VQ81 3CD6Z 3I55Z 3CME1 3CCL1 1NJI1 1VQMZ 1YJNZ 1S721 1VQK1 1KQSZ 1Q821 3CC4Z 1KD11 2QEX1 3CCJ1 1YHQ1 1YI2Z 2QA4Z 1N8R1 1K9M2 3G6EZ 1VQO1 1VQNZ 3OW2Y 1VQP1 3CC71 3G4S1 1W2BY 1Q862 3CCVZ 3CXCY 1VQ51 3CCMZ 1VQL1 3G711 3CCE1 3CPWZ 1K732 3CCR1 1VQ41 1YITZ 3CD61 3I551 1QVGZ 1VQM1 1K9M1 3CCSZ 1YJN1 1M902 1KQSY 1Q7Y2 3CC41 1JJ2Y 3CMAZ 3CCQZ 1Q861 1YJWZ 1YI21 2QA41 3CCUZ 1M1K2 1YIJZ 3G6E1 1VQN1 1K731
chains in the Genus database with same CATH superfamily
5IP7I 2HU9A 3I4NI 4A3CI 1NUIA 4A3DI 4S1TA 5FLXf 4A3II 3PO2I 3NH5A 4RV9A 1RNIA 4HGZA 1VLAA 1Z01A 2B63I 3IFUA 2NVYI 3NDJA 3I56Z 2RT9A 2KI7B 3S1RI 1AA6A 3CMEZ 3FKII 2QREB 3CCLZ 4NBFA 3BG0B 3J80b 2Q4ZA 1KC81 4E31A 3FQQA 5AN9F 4A3BI 4BY7I 2JR6A 5D1OA 1JJ2Z 1ZH1A 3NFZA 1VQOZ 1FDIA 1VQPZ 3CC21 3CC7Z 2O53A 1SIWA 1KD12 3D6WA 2Y0SA 1VQLZ 1P9NA 1TWHI 1K8A1 4NBAA 5T6BA 2E2JI 2DE7A 3JAMb 3P5JB 1DL6A 2OTL1 3M4OI 3MZLB 1QXFA 3S14I 1VQ4Z 3KIHA 1WCMI 5C3EI 3CD6Z 1RO4A 1WZNA 4A3JI 1NJI1 3VMGA 2AYDA 4NBHA 3MONA 1VQMZ 1TWFI 4Y7NI 4E30A 3IF8A 2V45A 2JIOA 4E2WA 4A3LI 2QEX1 1YHQ1 5FLXb 3BG1B 5FLMI 4MXUA 1K9M2 2PM9A 1X3WA 4X6AI 4E2YA 2LFUA 5CM2M 4NBEA 3CXCY 3F3FC 4DQYB 3IR7A 2DE5A 3G711 3GKQA 1KRLA 2IZ3A 4NBDA 3CPWZ 1Q16A 1Y1VI 2VUGA 3PO3S 2GTIA 2VUMI 1QVGZ 1Y8CA 3GTMS 4MRIA 3CQZI 3J81f 1R9TI 2QA41 1RLYA 2QKDA 3CC2Z 1KC82 1L1OC 5T67A 3S16I 2QRDB 1W2BZ 2R7ZI 1QVFZ 1S7MA 1X3ZA 3HOZI 2LIYA 1M1K1 2OTLZ 2ZAEB 3TDHB 2RPRA 3S1MI 1K8A2 3HOXI 3CCQ1 2V8JA 1Q811 1USPA 2QEXZ 1YHQZ 1YIJ1 1WW9A 2VPWA 1NJI2 3OW2Z 2V8IA 3J7A4 2JIQA 3HKZA 3D2LA 1RQFA 2P28A 2JIPA 1WIIA 2WB1A 2E7ZA 2V3VA 3G71Z 3J81b 3HOVI 1VQ61 4MH4A 2OTJ1 2VF1A 2IV2X 4RVHA 1VQ71 1USPB 2GU2A 4Y52I 2YADA 1NP6A 2M48A 3EERA 2JIRA 1Q821 1KQSZ 2QA4Z 3HOUI 1RO2A 1LQLA 2GTHA 1YUKA 1N8R1 3G4S1 3VTNA 2JUBA 3D9XA 3KIFA 2QR1B 1K83I 4BXXI 3CCE1 2RHBA 1QF8A 3GTLI 3K7AI 3GTGI 2VPZA 3CCR1 1Z03A 4RVDA 2BJOA 1ZB9A 3NDIA 2NVQI 3FQMA 1QYPA 1YJN1 3CC41 2O4HA 3CCQZ 3RZDI 1Q861 2JS4A 3I07A 5D1PA 4MONA 1YI21 3S1QI 1M1K2 2EGTA 1YIJZ 3S2HI 3G6E1 5C4JI 2NVTI 4BBRI 1Z02A 2V8KA 4E2XA 4A3GI 4RVFA 3CCV1 1Q812 1YUAA 4DK1A 3CCM1 4NBCA 2K5RA 2KPIA 2I3CA 1Q7Y1 1N2FA 2R6MA 1VQ6Z 2OTJZ 1ML8A 1VQ7Z 2K3RA 1TWCI 1YJW1 2R92I 4A3EI 3CCU1 4NH1C 4TNUA 1TWAI 4BBSI 3G4SZ 1Q822 3S15I 4E2ZA 2P3YA 4MD8A 2H85A 3HOWI 4RVGA 1N8R2 4NBGA 2DE6A 3CCEZ 1QVFY 1X0TA 2NAPA 3TE5B 1YJ91 1TFIA 2F4MA 2F4OA 2JA8I 3CCRZ 1VQ91 4NBBA 1VQ81 4E33A 4BY1I 5C4XI 5IP9I 2VPYA 1YJNZ 1S721 1VQK1 2RIQA 3CC4Z 1ZB8A 1I6HI 3CCJ1 2OOXB 3VB9A 1I3QI 2JIMA 1YI2Z 3PO3I 3GTOI 3G6EZ 3OW2Y 1Y1WI 3Q87A 2RBLA 3GTMI 1Q862 3CCVZ 1VQ51 3CCMZ 3H0GI 3QWUA 4QTTA 2R93I 4MD7A 2PK7A 2AKLA 2Q51A 3IX0A 2QLVB 4RS4A 3I551 5T64A 3S1NI 3MZKB 1KQSY 1Q7Y2 1JJ2Y 1YJWZ 3CCUZ 2IZ4A 3GCFA 4E32A 1VQN1 1Y1VS 5A2Qf 1K731 4A3FI 3NH8A 3F3PC 4HH4A 2NVXI 2J6AA 3VMHA 3LUSA 2WAQA 1FDOA 1TWGI 3NH4A 1M901 2JMOA 2QRCB 1YJ9Z 1YIT1 1VQ9Z 3CCS1 1VQ8Z 3CMA1 1S72Z 3S2DI 1VQKZ 1RO0A 4XX2A 3VMIA 3EEDA 4A93I 3GTKI 3CCJZ 3T4NB 2W04A 4HGYA 3I4MI 3HOYI 5D1OB 3CPWY 5IT9f 4A3MI 3CXCZ 1VQ5Z 1JWHC 2JA5I 3M3YI 3GTJI 1QVGY 4CL1A 3GTQI 3U50C 3RZOI 3ESWA 3I561 3H3VJ 3I55Z 3CME1 3CCL1 5A2Qb 4NB8A 3S17I 1KD11 3GTPI 2W03A 1SFOI 5LL6f 2YU9I 1VQO1 1VQNZ 1VQP1 3CC71 2OOYB 3J80f 1W2BY 2OZKA 4NB9A 4QTUA 1VQL1 2LEXA 4A3KI 4MD9A 2M6NA 1K732 4EWCA 1VQ41 1YITZ 4AYBA 4NFRA 2PMZA 2JA6I 3CD61 4DGLA 2HF1A 1VQM1 1K9M1 3CCSZ 1M902 2E2II 5C44I 3CMAZ 1WJ2A 5IT9b 3JAMf 2E2HI 1PFTA 2VPXA 2JNYA 2E9HA 4NOZA 2G2KA 1I50I 2JA7I
chains in the Genus database with same CATH topology
5IP7I 2HU9A 3I4NI 4A3CI 1NUIA 4A3DI 4S1TA 5FLXf 4A3II 3PO2I 3NH5A 4RV9A 1RNIA 4HGZA 1VLAA 1Z01A 2B63I 3IFUA 2NVYI 3NDJA 3I56Z 2RT9A 2KI7B 3S1RI 3CMEZ 3FKII 2QREB 3CCLZ 4NBFA 3BG0B 3J80b 2Q4ZA 1KC81 4E31A 3FQQA 5AN9F 4A3BI 4BY7I 2JR6A 5D1OA 1JJ2Z 1ZH1A 3NFZA 1VQOZ 1VQPZ 3CC21 3CC7Z 2O53A 1KD12 3D6WA 2Y0SA 1VQLZ 1P9NA 1TWHI 1K8A1 4NBAA 5T6BA 2E2JI 2DE7A 3JAMb 3P5JB 1DL6A 2OTL1 3M4OI 3MZLB 3S14I 1VQ4Z 3KIHA 1WCMI 5C3EI 3CD6Z 1RO4A 4A3JI 1NJI1 3VMGA 4NBHA 3MONA 1VQMZ 1TWFI 4Y7NI 4E30A 3IF8A 4E2WA 4A3LI 2QEX1 1YHQ1 5FLXb 3BG1B 5FLMI 4MXUA 1K9M2 2PM9A 1X3WA 4X6AI 4E2YA 2LFUA 5CM2M 4NBEA 3CXCY 3F3FC 4DQYB 2DE5A 3G711 3GKQA 1KRLA 2IZ3A 4NBDA 3CPWZ 1Y1VI 2VUGA 3PO3S 2GTIA 2VUMI 1QVGZ 3GTMS 4MRIA 3CQZI 3J81f 1R9TI 2QA41 1RLYA 2QKDA 3CC2Z 1KC82 1L1OC 5T67A 3S16I 2QRDB 1W2BZ 2R7ZI 1QVFZ 1S7MA 1X3ZA 3HOZI 2LIYA 1M1K1 2OTLZ 2ZAEB 3TDHB 2RPRA 3S1MI 1K8A2 3HOXI 3CCQ1 2V8JA 1Q811 1USPA 2QEXZ 1YHQZ 1YIJ1 1WW9A 1NJI2 3OW2Z 2V8IA 3J7A4 3HKZA 1RQFA 2P28A 3G71Z 1WIIA 2WB1A 3J81b 3HOVI 1VQ61 4MH4A 2OTJ1 2VF1A 4RVHA 1VQ71 1USPB 2GU2A 4Y52I 2YADA 1NP6A 2M48A 3EERA 1KQSZ 1Q821 2QA4Z 3HOUI 1RO2A 1LQLA 2GTHA 1YUKA 1N8R1 3G4S1 3VTNA 2JUBA 3D9XA 3KIFA 2QR1B 1K83I 4BXXI 3CCE1 2RHBA 1QF8A 3GTLI 3K7AI 3GTGI 3CCR1 1Z03A 4RVDA 2BJOA 1ZB9A 3NDIA 2NVQI 3FQMA 1QYPA 1YJN1 3CC41 2O4HA 3CCQZ 3RZDI 1Q861 2JS4A 3I07A 5D1PA 4MONA 1YI21 3S1QI 1M1K2 2EGTA 1YIJZ 3S2HI 3G6E1 5C4JI 2NVTI 4BBRI 1Z02A 2V8KA 4E2XA 4A3GI 4RVFA 3CCV1 1Q812 1YUAA 4DK1A 3CCM1 4NBCA 2K5RA 2KPIA 2I3CA 1Q7Y1 1N2FA 2R6MA 1VQ6Z 2OTJZ 1ML8A 1VQ7Z 2K3RA 1TWCI 1YJW1 2R92I 4A3EI 3CCU1 4NH1C 4TNUA 1TWAI 4BBSI 3G4SZ 1Q822 3S15I 4E2ZA 2P3YA 4MD8A 2H85A 3HOWI 4RVGA 1N8R2 4NBGA 2DE6A 3CCEZ 1QVFY 1X0TA 3TE5B 1YJ91 1TFIA 2F4MA 2F4OA 2JA8I 3CCRZ 1VQ91 4NBBA 1VQ81 4E33A 4BY1I 5C4XI 5IP9I 1YJNZ 1S721 1VQK1 2RIQA 3CC4Z 1ZB8A 1I6HI 3CCJ1 2OOXB 3VB9A 1I3QI 1YI2Z 3PO3I 3GTOI 3G6EZ 3OW2Y 1Y1WI 3Q87A 2RBLA 3GTMI 1Q862 3CCVZ 1VQ51 3CCMZ 3H0GI 3QWUA 4QTTA 2R93I 4MD7A 2PK7A 2AKLA 2Q51A 3IX0A 2QLVB 4RS4A 3I551 5T64A 3S1NI 3MZKB 1KQSY 1Q7Y2 1JJ2Y 1YJWZ 3CCUZ 2IZ4A 3GCFA 4E32A 1VQN1 1Y1VS 5A2Qf 1K731 4A3FI 3NH8A 3F3PC 4HH4A 2NVXI 2J6AA 3VMHA 3LUSA 2WAQA 1TWGI 3NH4A 1M901 2JMOA 2QRCB 1YJ9Z 1YIT1 1VQ9Z 3CCS1 1VQ8Z 3CMA1 1S72Z 3S2DI 1VQKZ 1RO0A 4XX2A 3VMIA 3EEDA 4A93I 3GTKI 3CCJZ 3T4NB 2W04A 4HGYA 3I4MI 3HOYI 5D1OB 3CPWY 5IT9f 4A3MI 3CXCZ 1VQ5Z 1JWHC 2JA5I 3M3YI 3GTJI 1QVGY 4CL1A 3GTQI 3U50C 3RZOI 3ESWA 3I561 3H3VJ 3I55Z 3CME1 3CCL1 5A2Qb 4NB8A 3S17I 1KD11 3GTPI 2W03A 1SFOI 5LL6f 2YU9I 1VQO1 1VQNZ 1VQP1 3CC71 2OOYB 3J80f 1W2BY 2OZKA 4NB9A 4QTUA 1VQL1 4A3KI 4MD9A 2M6NA 1K732 4EWCA 1VQ41 1YITZ 4AYBA 4NFRA 2PMZA 2JA6I 3CD61 4DGLA 2HF1A 1VQM1 1K9M1 3CCSZ 1M902 2E2II 5C44I 3CMAZ 5IT9b 3JAMf 2E2HI 1PFTA 2JNYA 2E9HA 4NOZA 2G2KA 1I50I 2JA7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV 1;  1Q81 2;  3CC2 Z;  1KC8 2;  3CCM 1;  1M90 1;  1Q7Y 1;  1W2B Z;  1QVF Z;  1VQ6 Z;  1YJ9 Z;  1YIT 1;  1M1K 1;  2OTL Z;  2OTJ Z;  3I56 Z;  1VQ9 Z;  1VQ7 Z;  3CCS 1;  1VQ8 Z;  3CME Z;  3CCL Z;  1K8A 2;  3CMA 1;  3CCQ 1;  1S72 Z;  1Q81 1;  1KC8 1;  1YJW 1;  1VQK Z;  3CCU 1;  2QEX Z;  3CCJ Z;  1YHQ Z;  1YIJ 1;  1JJ2 Z;  1NJI 2;  1VQO Z;  1VQP Z;  3CC2 1;  3CC7 Z;  3OW2 Z;  3G4S Z;  3CPW Y;  1Q82 2;  1KD1 2;  3CXC Z;  1VQ5 Z;  1VQL Z;  1K8A 1;  3G71 Z;  1QVG Y;  1N8R 2;  3CCE Z;  1QVF Y;  1VQ6 1;  1YJ9 1;  2OTJ 1;  2OTL 1;  3I56 1;  1VQ9 1;  3CCR Z;  1VQ7 1;  1VQ4 Z;  1VQ8 1;  3CD6 Z;  3I55 Z;  3CME 1;  3CCL 1;  1NJI 1;  1VQM Z;  1YJN Z;  1S72 1;  1VQK 1;  1KQS Z;  1Q82 1;  3CC4 Z;  1KD1 1;  2QEX 1;  3CCJ 1;  1YHQ 1;  1YI2 Z;  2QA4 Z;  1N8R 1;  1K9M 2;  3G6E Z;  1VQO 1;  1VQN Z;  3OW2 Y;  1VQP 1;  3CC7 1;  3G4S 1;  1W2B Y;  1Q86 2;  3CCV Z;  3CXC Y;  1VQ5 1;  3CCM Z;  1VQL 1;  3G71 1;  3CCE 1;  3CPW Z;  1K73 2;  3CCR 1;  1VQ4 1;  1YIT Z;  3CD6 1;  3I55 1;  1QVG Z;  1VQM 1;  1K9M 1;  3CCS Z;  1YJN 1;  1M90 2;  1KQS Y;  1Q7Y 2;  3CC4 1;  1JJ2 Y;  3CMA Z;  3CCQ Z;  1Q86 1;  1YJW Z;  1YI2 1;  2QA4 1;  3CCU Z;  1M1K 2;  1YIJ Z;  3G6E 1;  1VQN 1;  1K73 1; 
#chains in the Genus database with same CATH topology
 5IP7 I;  2HU9 A;  3I4N I;  4A3C I;  1NUI A;  4A3D I;  4S1T A;  5FLX f;  4A3I I;  3PO2 I;  3NH5 A;  4RV9 A;  1RNI A;  4HGZ A;  1VLA A;  1Z01 A;  2B63 I;  3IFU A;  2NVY I;  3NDJ A;  3I56 Z;  2RT9 A;  2KI7 B;  3S1R I;  1AA6 A;  3CME Z;  3FKI I;  2QRE B;  3CCL Z;  4NBF A;  3BG0 B;  3J80 b;  2Q4Z A;  1KC8 1;  4E31 A;  3FQQ A;  5AN9 F;  4A3B I;  4BY7 I;  2JR6 A;  5D1O A;  1JJ2 Z;  1ZH1 A;  3NFZ A;  1VQO Z;  1FDI A;  1VQP Z;  3CC2 1;  3CC7 Z;  2O53 A;  1SIW A;  1KD1 2;  3D6W A;  2Y0S A;  1VQL Z;  1P9N A;  1TWH I;  1K8A 1;  4NBA A;  5T6B A;  2E2J I;  2DE7 A;  3JAM b;  3P5J B;  1DL6 A;  2OTL 1;  3M4O I;  3MZL B;  1QXF A;  3S14 I;  1VQ4 Z;  3KIH A;  1WCM I;  5C3E I;  3CD6 Z;  1RO4 A;  1WZN A;  4A3J I;  1NJI 1;  3VMG A;  2AYD A;  4NBH A;  3MON A;  1VQM Z;  1TWF I;  4Y7N I;  4E30 A;  3IF8 A;  2V45 A;  2JIO A;  4E2W A;  4A3L I;  2QEX 1;  1YHQ 1;  5FLX b;  3BG1 B;  5FLM I;  4MXU A;  1K9M 2;  2PM9 A;  1X3W A;  4X6A I;  4E2Y A;  2LFU A;  5CM2 M;  4NBE A;  3CXC Y;  3F3F C;  4DQY B;  3IR7 A;  2DE5 A;  3G71 1;  3GKQ A;  1KRL A;  2IZ3 A;  4NBD A;  3CPW Z;  1Q16 A;  1Y1V I;  2VUG A;  3PO3 S;  2GTI A;  2VUM I;  1QVG Z;  1Y8C A;  3GTM S;  4MRI A;  3CQZ I;  3J81 f;  1R9T I;  2QA4 1;  1RLY A;  2QKD A;  3CC2 Z;  1KC8 2;  1L1O C;  5T67 A;  3S16 I;  2QRD B;  1W2B Z;  2R7Z I;  1QVF Z;  1S7M A;  1X3Z A;  3HOZ I;  2LIY A;  1M1K 1;  2OTL Z;  2ZAE B;  3TDH B;  2RPR A;  3S1M I;  1K8A 2;  3HOX I;  3CCQ 1;  2V8J A;  1Q81 1;  1USP A;  2QEX Z;  1YHQ Z;  1YIJ 1;  1WW9 A;  2VPW A;  1NJI 2;  3OW2 Z;  2V8I A;  3J7A 4;  2JIQ A;  3HKZ A;  3D2L A;  1RQF A;  2P28 A;  2JIP A;  1WII A;  2WB1 A;  2E7Z A;  2V3V A;  3G71 Z;  3J81 b;  3HOV I;  1VQ6 1;  4MH4 A;  2OTJ 1;  2VF1 A;  2IV2 X;  4RVH A;  1VQ7 1;  1USP B;  2GU2 A;  4Y52 I;  2YAD A;  1NP6 A;  2M48 A;  3EER A;  2JIR A;  1Q82 1;  1KQS Z;  2QA4 Z;  3HOU I;  1RO2 A;  1LQL A;  2GTH A;  1YUK A;  1N8R 1;  3G4S 1;  3VTN A;  2JUB A;  3D9X A;  3KIF A;  2QR1 B;  1K83 I;  4BXX I;  3CCE 1;  2RHB A;  1QF8 A;  3GTL I;  3K7A I;  3GTG I;  2VPZ A;  3CCR 1;  1Z03 A;  4RVD A;  2BJO A;  1ZB9 A;  3NDI A;  2NVQ I;  3FQM A;  1QYP A;  1YJN 1;  3CC4 1;  2O4H A;  3CCQ Z;  3RZD I;  1Q86 1;  2JS4 A;  3I07 A;  5D1P A;  4MON A;  1YI2 1;  3S1Q I;  1M1K 2;  2EGT A;  1YIJ Z;  3S2H I;  3G6E 1;  5C4J I;  2NVT I;  4BBR I;  1Z02 A;  2V8K A;  4E2X A;  4A3G I;  4RVF A;  3CCV 1;  1Q81 2;  1YUA A;  4DK1 A;  3CCM 1;  4NBC A;  2K5R A;  2KPI A;  2I3C A;  1Q7Y 1;  1N2F A;  2R6M A;  1VQ6 Z;  2OTJ Z;  1ML8 A;  1VQ7 Z;  2K3R A;  1TWC I;  1YJW 1;  2R92 I;  4A3E I;  3CCU 1;  4NH1 C;  4TNU A;  1TWA I;  4BBS I;  3G4S Z;  1Q82 2;  3S15 I;  4E2Z A;  2P3Y A;  4MD8 A;  2H85 A;  3HOW I;  4RVG A;  1N8R 2;  4NBG A;  2DE6 A;  3CCE Z;  1QVF Y;  1X0T A;  2NAP A;  3TE5 B;  1YJ9 1;  1TFI A;  2F4M A;  2F4O A;  2JA8 I;  3CCR Z;  1VQ9 1;  4NBB A;  1VQ8 1;  4E33 A;  4BY1 I;  5C4X I;  5IP9 I;  2VPY A;  1YJN Z;  1S72 1;  1VQK 1;  2RIQ A;  3CC4 Z;  1ZB8 A;  1I6H I;  3CCJ 1;  2OOX B;  3VB9 A;  1I3Q I;  2JIM A;  1YI2 Z;  3PO3 I;  3GTO I;  3G6E Z;  3OW2 Y;  1Y1W I;  3Q87 A;  2RBL A;  3GTM I;  1Q86 2;  3CCV Z;  1VQ5 1;  3CCM Z;  3H0G I;  3QWU A;  4QTT A;  2R93 I;  4MD7 A;  2PK7 A;  2AKL A;  2Q51 A;  3IX0 A;  2QLV B;  4RS4 A;  3I55 1;  5T64 A;  3S1N I;  3MZK B;  1KQS Y;  1Q7Y 2;  1JJ2 Y;  1YJW Z;  3CCU Z;  2IZ4 A;  3GCF A;  4E32 A;  1VQN 1;  1Y1V S;  5A2Q f;  1K73 1;  4A3F I;  3NH8 A;  3F3P C;  4HH4 A;  2NVX I;  2J6A A;  3VMH A;  3LUS A;  2WAQ A;  1FDO A;  1TWG I;  3NH4 A;  1M90 1;  2JMO A;  2QRC B;  1YJ9 Z;  1YIT 1;  1VQ9 Z;  3CCS 1;  1VQ8 Z;  3CMA 1;  1S72 Z;  3S2D I;  1VQK Z;  1RO0 A;  4XX2 A;  3VMI A;  3EED A;  4A93 I;  3GTK I;  3CCJ Z;  3T4N B;  2W04 A;  4HGY A;  3I4M I;  3HOY I;  5D1O B;  3CPW Y;  5IT9 f;  4A3M I;  3CXC Z;  1VQ5 Z;  1JWH C;  2JA5 I;  3M3Y I;  3GTJ I;  1QVG Y;  4CL1 A;  3GTQ I;  3U50 C;  3RZO I;  3ESW A;  3I56 1;  3H3V J;  3I55 Z;  3CME 1;  3CCL 1;  5A2Q b;  4NB8 A;  3S17 I;  1KD1 1;  3GTP I;  2W03 A;  1SFO I;  5LL6 f;  2YU9 I;  1VQO 1;  1VQN Z;  1VQP 1;  3CC7 1;  2OOY B;  3J80 f;  1W2B Y;  2OZK A;  4NB9 A;  4QTU A;  1VQL 1;  2LEX A;  4A3K I;  4MD9 A;  2M6N A;  1K73 2;  4EWC A;  1VQ4 1;  1YIT Z;  4AYB A;  4NFR A;  2PMZ A;  2JA6 I;  3CD6 1;  4DGL A;  2HF1 A;  1VQM 1;  1K9M 1;  3CCS Z;  1M90 2;  2E2I I;  5C44 I;  3CMA Z;  1WJ2 A;  5IT9 b;  3JAM f;  2E2H I;  1PFT A;  2VPX A;  2JNY A;  2E9H A;  4NOZ A;  2G2K A;  1I50 I;  2JA7 I; 
#chains in the Genus database with same CATH homology
 5IP7 I;  2HU9 A;  3I4N I;  4A3C I;  1NUI A;  4A3D I;  4S1T A;  5FLX f;  4A3I I;  3PO2 I;  3NH5 A;  4RV9 A;  1RNI A;  4HGZ A;  1VLA A;  1Z01 A;  2B63 I;  3IFU A;  2NVY I;  3NDJ A;  3I56 Z;  2RT9 A;  2KI7 B;  3S1R I;  3CME Z;  3FKI I;  2QRE B;  3CCL Z;  4NBF A;  3BG0 B;  3J80 b;  2Q4Z A;  1KC8 1;  4E31 A;  3FQQ A;  5AN9 F;  4A3B I;  4BY7 I;  2JR6 A;  5D1O A;  1JJ2 Z;  1ZH1 A;  3NFZ A;  1VQO Z;  1VQP Z;  3CC2 1;  3CC7 Z;  2O53 A;  1KD1 2;  3D6W A;  2Y0S A;  1VQL Z;  1P9N A;  1TWH I;  1K8A 1;  4NBA A;  5T6B A;  2E2J I;  2DE7 A;  3JAM b;  3P5J B;  1DL6 A;  2OTL 1;  3M4O I;  3MZL B;  3S14 I;  1VQ4 Z;  3KIH A;  1WCM I;  5C3E I;  3CD6 Z;  1RO4 A;  4A3J I;  1NJI 1;  3VMG A;  4NBH A;  3MON A;  1VQM Z;  1TWF I;  4Y7N I;  4E30 A;  3IF8 A;  4E2W A;  4A3L I;  2QEX 1;  1YHQ 1;  5FLX b;  3BG1 B;  5FLM I;  4MXU A;  1K9M 2;  2PM9 A;  1X3W A;  4X6A I;  4E2Y A;  2LFU A;  5CM2 M;  4NBE A;  3CXC Y;  3F3F C;  4DQY B;  2DE5 A;  3G71 1;  3GKQ A;  1KRL A;  2IZ3 A;  4NBD A;  3CPW Z;  1Y1V I;  2VUG A;  3PO3 S;  2GTI A;  2VUM I;  1QVG Z;  3GTM S;  4MRI A;  3CQZ I;  3J81 f;  1R9T I;  2QA4 1;  1RLY A;  2QKD A;  3CC2 Z;  1KC8 2;  1L1O C;  5T67 A;  3S16 I;  2QRD B;  1W2B Z;  2R7Z I;  1QVF Z;  1S7M A;  1X3Z A;  3HOZ I;  2LIY A;  1M1K 1;  2OTL Z;  2ZAE B;  3TDH B;  2RPR A;  3S1M I;  1K8A 2;  3HOX I;  3CCQ 1;  2V8J A;  1Q81 1;  1USP A;  2QEX Z;  1YHQ Z;  1YIJ 1;  1WW9 A;  1NJI 2;  3OW2 Z;  2V8I A;  3J7A 4;  3HKZ A;  1RQF A;  2P28 A;  3G71 Z;  1WII A;  2WB1 A;  3J81 b;  3HOV I;  1VQ6 1;  4MH4 A;  2OTJ 1;  2VF1 A;  4RVH A;  1VQ7 1;  1USP B;  2GU2 A;  4Y52 I;  2YAD A;  1NP6 A;  2M48 A;  3EER A;  1KQS Z;  1Q82 1;  2QA4 Z;  3HOU I;  1RO2 A;  1LQL A;  2GTH A;  1YUK A;  1N8R 1;  3G4S 1;  3VTN A;  2JUB A;  3D9X A;  3KIF A;  2QR1 B;  1K83 I;  4BXX I;  3CCE 1;  2RHB A;  1QF8 A;  3GTL I;  3K7A I;  3GTG I;  3CCR 1;  1Z03 A;  4RVD A;  2BJO A;  1ZB9 A;  3NDI A;  2NVQ I;  3FQM A;  1QYP A;  1YJN 1;  3CC4 1;  2O4H A;  3CCQ Z;  3RZD I;  1Q86 1;  2JS4 A;  3I07 A;  5D1P A;  4MON A;  1YI2 1;  3S1Q I;  1M1K 2;  2EGT A;  1YIJ Z;  3S2H I;  3G6E 1;  5C4J I;  2NVT I;  4BBR I;  1Z02 A;  2V8K A;  4E2X A;  4A3G I;  4RVF A;  3CCV 1;  1Q81 2;  1YUA A;  4DK1 A;  3CCM 1;  4NBC A;  2K5R A;  2KPI A;  2I3C A;  1Q7Y 1;  1N2F A;  2R6M A;  1VQ6 Z;  2OTJ Z;  1ML8 A;  1VQ7 Z;  2K3R A;  1TWC I;  1YJW 1;  2R92 I;  4A3E I;  3CCU 1;  4NH1 C;  4TNU A;  1TWA I;  4BBS I;  3G4S Z;  1Q82 2;  3S15 I;  4E2Z A;  2P3Y A;  4MD8 A;  2H85 A;  3HOW I;  4RVG A;  1N8R 2;  4NBG A;  2DE6 A;  3CCE Z;  1QVF Y;  1X0T A;  3TE5 B;  1YJ9 1;  1TFI A;  2F4M A;  2F4O A;  2JA8 I;  3CCR Z;  1VQ9 1;  4NBB A;  1VQ8 1;  4E33 A;  4BY1 I;  5C4X I;  5IP9 I;  1YJN Z;  1S72 1;  1VQK 1;  2RIQ A;  3CC4 Z;  1ZB8 A;  1I6H I;  3CCJ 1;  2OOX B;  3VB9 A;  1I3Q I;  1YI2 Z;  3PO3 I;  3GTO I;  3G6E Z;  3OW2 Y;  1Y1W I;  3Q87 A;  2RBL A;  3GTM I;  1Q86 2;  3CCV Z;  1VQ5 1;  3CCM Z;  3H0G I;  3QWU A;  4QTT A;  2R93 I;  4MD7 A;  2PK7 A;  2AKL A;  2Q51 A;  3IX0 A;  2QLV B;  4RS4 A;  3I55 1;  5T64 A;  3S1N I;  3MZK B;  1KQS Y;  1Q7Y 2;  1JJ2 Y;  1YJW Z;  3CCU Z;  2IZ4 A;  3GCF A;  4E32 A;  1VQN 1;  1Y1V S;  5A2Q f;  1K73 1;  4A3F I;  3NH8 A;  3F3P C;  4HH4 A;  2NVX I;  2J6A A;  3VMH A;  3LUS A;  2WAQ A;  1TWG I;  3NH4 A;  1M90 1;  2JMO A;  2QRC B;  1YJ9 Z;  1YIT 1;  1VQ9 Z;  3CCS 1;  1VQ8 Z;  3CMA 1;  1S72 Z;  3S2D I;  1VQK Z;  1RO0 A;  4XX2 A;  3VMI A;  3EED A;  4A93 I;  3GTK I;  3CCJ Z;  3T4N B;  2W04 A;  4HGY A;  3I4M I;  3HOY I;  5D1O B;  3CPW Y;  5IT9 f;  4A3M I;  3CXC Z;  1VQ5 Z;  1JWH C;  2JA5 I;  3M3Y I;  3GTJ I;  1QVG Y;  4CL1 A;  3GTQ I;  3U50 C;  3RZO I;  3ESW A;  3I56 1;  3H3V J;  3I55 Z;  3CME 1;  3CCL 1;  5A2Q b;  4NB8 A;  3S17 I;  1KD1 1;  3GTP I;  2W03 A;  1SFO I;  5LL6 f;  2YU9 I;  1VQO 1;  1VQN Z;  1VQP 1;  3CC7 1;  2OOY B;  3J80 f;  1W2B Y;  2OZK A;  4NB9 A;  4QTU A;  1VQL 1;  4A3K I;  4MD9 A;  2M6N A;  1K73 2;  4EWC A;  1VQ4 1;  1YIT Z;  4AYB A;  4NFR A;  2PMZ A;  2JA6 I;  3CD6 1;  4DGL A;  2HF1 A;  1VQM 1;  1K9M 1;  3CCS Z;  1M90 2;  2E2I I;  5C44 I;  3CMA Z;  5IT9 b;  3JAM f;  2E2H I;  1PFT A;  2JNY A;  2E9H A;  4NOZ A;  2G2K A;  1I50 I;  2JA7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...