3GTJI

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna-rna hybrid
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI02
1I3QI 1X3ZA 3D6WA 5IP7I 3HOXI 3I4MI 2NVTI 4Y7NI 3VMIA 4NB8A 1SFOI 1WW9A 3PO3I 1Y1VS 2JA5I 4NBDA 3S1MI 2B63I 3CQZI 3FKII 2JA7I 3H3VJ 1ZB8A 3GTMI 3H0GI 2K5RA 5IP9I 2J6AA 1K83I 4A93I 3S1QI 4A3LI 1LQLA 1RO4A 1WCMI 2JS4A 1RLYA 1Y1WI 5FLMI 3HOUI 2NVQI 3HOZI 4QTTA 3S15I 1L1OC 1TWAI 1N2FA 3S14I 2R7ZI 4A3KI 2HF1A 4A3MI 3GTPI 2E2HI 1USPB 2JA6I 5C3EI 3S16I 4A3GI 4MH4A 4A3JI 4BBRI 3RZDI 1TWGI 2P3YA 4BXXI 4BBSI 3K7AI 1PFTA 3U50C 3I4NI 3EERA 5C4JI 2DE7A 2NVYI 3LUSA 3S2HI 1I6HI 1VLAA 3GKQA 4Y52I 2R93I 2E2II 1TWHI 3GTKI 1Y1VI 1R9TI 3GCFA 3VMHA 2E2JI 3S1NI 2YU9I 2JR6A 3VB9A 1ZB9A 2DE5A 3HOYI 4A3EI 3PO3S 2AKLA 5C4XI 1TFIA 3M3YI 3GTJI 4NB9A 3GTLI 2JNYA 3S1RI 3M4OI 3GTQI 1I50I 2NVXI 1DL6A 5CM2M 4A3DI 2F4MA 4NOZA 2DE6A 2KPIA 4X6AI 4NBEA 1TWFI 1YUAA 1X3WA 2RBLA 4XX2A 2VUMI 4A3BI 2JA8I 2BJOA 3GTMS 4BY7I 4NBBA 3ESWA 4A3II 3GTOI 4NBCA 3RZOI 1TWCI 4A3CI 1QYPA 3GTGI 3S17I 3S2DI 1ML8A 1NUIA 3PO2I 3VMGA 3HOVI 4NBHA 4NBFA 4NBGA 1USPA 2F4OA 4QTUA 3HOWI 3Q87A 4A3FI 4NBAA 2R92I 2PK7A 4BY1I 3I07A 5C44I
chains in the Genus database with same CATH superfamily
1Z02A 5IP7I 3CME1 3CCQ1 1Q821 3KIHA 3CCJ1 2Q51A 2GU2A 4NB8A 2V8KA 1SFOI 4DK1A 1VQ9Z 1VQP1 3I56Z 3P5JB 3T4NB 2ZAEB 1ZB8A 1K8A1 1N8R2 4RVHA 4MD9A 3S1QI 4MONA 3CCRZ 1LQLA 3CPWY 1Q7Y1 2JMOA 2R6MA 3NH4A 3G4S1 1M1K2 3HOUI 2V45A 4S1TA 1M901 2W04A 2VF1A 3S15I 1TWAI 1YITZ 4DQYB 1KD12 2JA6I 4A3JI 3NH5A 4BBRI 1YJ91 3CMAZ 1YIT1 3CCUZ 3VTNA 1K732 5T6BA 4MD7A 2EGTA 3EERA 2QREB 3KIFA 2PMZA 1Z01A 3LUSA 2JIPA 1Y1VI 2OTL1 3IFUA 1N8R1 2JR6A 2WAQA 2JIRA 3NFZA 4A3EI 4RVFA 2OOYB 2VPXA 1WIIA 2RIQA 1Q7Y2 2IZ4A 1Z03A 5CM2M 4A3DI 5A2Qf 3CCM1 4E2WA 4X6AI 5FLXb 1YUAA 1S721 2RBLA 4HGZA 4MXUA 2VUMI 2BJOA 4BY7I 2OOXB 2QR1B 3IX0A 2VPWA 3RZOI 3J80b 1TWCI 3D9XA 2M6NA 2QA4Z 2HU9A 2VUGA 4QTUA 3HOWI 4NBAA 2PK7A 3IF8A 1S7MA 2QEXZ 1VQ61 2NVTI 4Y7NI 3VMIA 3CD61 3PO3I 3CCL1 2NAPA 3CC4Z 3CXCY 2QEX1 1FDIA 4E31A 3JAMb 2B63I 1QVGY 2AYDA 3NH8A 3CC21 3CCLZ 1VQ81 1YIJ1 3GTMI 2K5RA 2JIQA 2QRDB 1KRLA 1K9M1 4A93I 2LIYA 1WCMI 2NVQI 3HOZI 1NJI1 4QTTA 5IT9f 2R7ZI 2O4HA 2E2HI 1VQ51 5C3EI 3S16I 1WZNA 4HH4A 3RZDI 3QWUA 4E2ZA 3K7AI 4DGLA 2E9HA 3CD6Z 3CMEZ 3U50C 5IT9b 5C4JI 1VQ5Z 1WJ2A 2NVYI 3S2HI 2QRCB 2E2II 2JUBA 3GTKI 2E2JI 2KI7B 1VQNZ 3VB9A 1YHQ1 2DE5A 1VQL1 1YUKA 1VQ71 1ZH1A 4E2YA 4RS4A 3I551 3GTJI 2RHBA 3CC2Z 2F4MA 3I55Z 1VQ4Z 3MZLB 3I561 2DE6A 2LEXA 2V8IA 1Q862 1X3WA 1NP6A 1FDOA 3GTMS 1P9NA 3CMA1 4AYBA 3NDIA 3CCSZ 3CCR1 4NBBA 3ESWA 1VQKZ 2K3RA 1QYPA 2LFUA 4HGYA 1RO0A 2V8JA 3VMGA 4NBHA 3J81f 4TNUA 1VQK1 3I07A 1AA6A 2JIMA 1VQLZ 1VQO1 1I3QI 1X3ZA 3D6WA 2VPYA 3I4MI 1VQPZ 4E30A 1Y1VS 1Y8CA 3J81b 3CCJZ 2JA5I 3S1MI 3CQZI 5LL6f 4RVGA 3CCE1 3H3VJ 1JWHC 1VQN1 3CCMZ 1RQFA 3H0GI 3G4SZ 1NJI2 1W2BY 2OTLZ 1KQSZ 4A3LI 1RNIA 3TDHB 2Q4ZA 1KC82 2P28A 3CPWZ 5FLMI 2W03A 3HKZA 1N2FA 4A3KI 4A3MI 3GTPI 1USPB 2VPZA 4RV9A 1W2BZ 4A3GI 4MH4A 2GTIA 2P3YA 3MZKB 4BXXI 2QKDA 5D1OB 1JJ2Y 3OW2Z 1M902 3CCU1 5D1PA 1KC81 4Y52I 2H85A 4E33A 1R9TI 3VMHA 2YU9I 3CCQZ 3MONA 1Q861 2JIOA 3GTLI 3TE5B 1VQ91 2JNYA 3IR7A 3S1RI 3M4OI 3GTQI 1I50I 3BG0B 2NVXI 1DL6A 3F3PC 1S72Z 4NBEA 2YADA 4XX2A 2JA8I 2M48A 3FQMA 4RVDA 3F3FC 2QA41 1QVFZ 4MRIA 2PM9A 3GTOI 4NBCA 3OW2Y 3G711 5T64A 3S2DI 3EEDA 1ML8A 3FQQA 3HOVI 4NBFA 4NBGA 4CL1A 3Q87A 2R92I 1YJ9Z 4MD8A 1Q16A 1QF8A 3HOXI 1YIJZ 1WW9A 2OTJZ 4NBDA 1X0TA 3FKII 1VQ6Z 3CC7Z 3JAMf 1YJNZ 2JA7I 1K8A2 3CC41 1YJW1 1K731 2O53A 2OTJ1 3BG1B 2J6AA 5IP9I 1QVFY 1K83I 3J80f 2WB1A 1VQ8Z 2OZKA 3CC71 1KD11 1RO4A 2JS4A 3G71Z 1RLYA 1Y1WI 5A2Qb 1L1OC 3S14I 1RO2A 2HF1A 1Q811 1SIWA 5D1OA 3G6EZ 1Q822 3J7A4 1TWGI 4BBSI 2E7ZA 1VQMZ 1QVGZ 2G2KA 1PFTA 3G6E1 3I4NI 2DE7A 2QLVB 2IV2X 1VQ7Z 2Y0SA 2IZ3A 1VLAA 1I6HI 3GKQA 1YHQZ 2R93I 1TWHI 1VQM1 1QXFA 3CCVZ 1YI21 1M1K1 3GCFA 3S1NI 1ZB9A 3HOYI 3PO3S 2AKLA 4EWCA 1VQOZ 5C4XI 1JJ2Z 3D2LA 1TFIA 3M3YI 2GTHA 2RPRA 4NB9A 4E32A 1Q812 3CXCZ 1YJN1 4NOZA 1YJWZ 3NDJA 1K9M2 2KPIA 5AN9F 3CCEZ 3CCS1 1TWFI 2V3VA 5FLXf 1VQ41 4A3BI 4E2XA 1KQSY 4A3II 2RT9A 4A3CI 2I3CA 3GTGI 3S17I 1NUIA 3PO2I 3CCV1 1YI2Z 1USPA 4NH1C 2F4OA 4NFRA 4A3FI 5T67A 4BY1I 5C44I
chains in the Genus database with same CATH topology
1Z02A 5IP7I 3CME1 3CCQ1 1Q821 3KIHA 3CCJ1 2Q51A 2GU2A 4NB8A 2V8KA 1SFOI 4DK1A 1VQ9Z 1VQP1 3I56Z 3P5JB 3T4NB 2ZAEB 1ZB8A 1K8A1 1N8R2 4RVHA 4MD9A 3S1QI 4MONA 3CCRZ 1LQLA 3CPWY 1Q7Y1 2JMOA 2R6MA 3NH4A 3G4S1 1M1K2 3HOUI 4S1TA 1M901 2W04A 2VF1A 3S15I 1TWAI 1YITZ 4DQYB 1KD12 2JA6I 4A3JI 3NH5A 4BBRI 1YJ91 3CMAZ 1YIT1 3CCUZ 3VTNA 1K732 5T6BA 4MD7A 2EGTA 3EERA 2QREB 3KIFA 2PMZA 1Z01A 3LUSA 1Y1VI 2OTL1 3IFUA 1N8R1 2JR6A 2WAQA 3NFZA 4A3EI 4RVFA 2OOYB 1WIIA 2RIQA 1Q7Y2 2IZ4A 1Z03A 5CM2M 4A3DI 5A2Qf 3CCM1 4E2WA 4X6AI 5FLXb 1YUAA 1S721 2RBLA 4HGZA 4MXUA 2VUMI 2BJOA 4BY7I 2OOXB 2QR1B 3IX0A 3RZOI 3J80b 1TWCI 3D9XA 2M6NA 2QA4Z 2HU9A 2VUGA 4QTUA 3HOWI 4NBAA 2PK7A 3IF8A 1S7MA 2QEXZ 1VQ61 2NVTI 4Y7NI 3VMIA 3CD61 3PO3I 3CCL1 3CC4Z 3CXCY 2QEX1 4E31A 3JAMb 2B63I 1QVGY 3NH8A 3CC21 3CCLZ 1VQ81 1YIJ1 3GTMI 2K5RA 2QRDB 1KRLA 1K9M1 4A93I 2LIYA 1WCMI 2NVQI 3HOZI 1NJI1 4QTTA 5IT9f 2R7ZI 2O4HA 2E2HI 1VQ51 5C3EI 3S16I 4HH4A 3RZDI 3QWUA 4E2ZA 3K7AI 4DGLA 2E9HA 3CD6Z 3CMEZ 3U50C 5IT9b 5C4JI 1VQ5Z 2NVYI 3S2HI 2QRCB 2E2II 2JUBA 3GTKI 2E2JI 2KI7B 1VQNZ 3VB9A 1YHQ1 2DE5A 1VQL1 1YUKA 1VQ71 1ZH1A 4E2YA 4RS4A 3I551 3GTJI 2RHBA 3CC2Z 2F4MA 3I55Z 1VQ4Z 3MZLB 3I561 2DE6A 2V8IA 1Q862 1X3WA 1NP6A 3GTMS 1P9NA 3CMA1 4AYBA 3NDIA 3CCSZ 3CCR1 4NBBA 3ESWA 1VQKZ 2K3RA 1QYPA 2LFUA 4HGYA 1RO0A 2V8JA 3VMGA 4NBHA 3J81f 4TNUA 1VQK1 3I07A 1VQLZ 1VQO1 1I3QI 1X3ZA 3D6WA 3I4MI 1VQPZ 4E30A 1Y1VS 3J81b 3CCJZ 2JA5I 3S1MI 3CQZI 5LL6f 4RVGA 3CCE1 3H3VJ 1JWHC 1VQN1 3CCMZ 1RQFA 3H0GI 3G4SZ 1NJI2 1W2BY 2OTLZ 1KQSZ 4A3LI 1RNIA 3TDHB 2Q4ZA 1KC82 2P28A 3CPWZ 5FLMI 2W03A 3HKZA 1N2FA 4A3KI 4A3MI 3GTPI 1USPB 4RV9A 1W2BZ 4A3GI 4MH4A 2GTIA 2P3YA 3MZKB 4BXXI 2QKDA 5D1OB 1JJ2Y 3OW2Z 1M902 3CCU1 5D1PA 1KC81 4Y52I 2H85A 4E33A 1R9TI 3VMHA 2YU9I 3CCQZ 3MONA 1Q861 3GTLI 3TE5B 1VQ91 2JNYA 3S1RI 3M4OI 3GTQI 1I50I 3BG0B 2NVXI 1DL6A 3F3PC 1S72Z 4NBEA 2YADA 4XX2A 2JA8I 2M48A 3FQMA 4RVDA 3F3FC 2QA41 1QVFZ 4MRIA 2PM9A 3GTOI 4NBCA 3OW2Y 3G711 5T64A 3S2DI 3EEDA 1ML8A 3FQQA 3HOVI 4NBFA 4NBGA 4CL1A 3Q87A 2R92I 1YJ9Z 4MD8A 1QF8A 3HOXI 1YIJZ 1WW9A 2OTJZ 4NBDA 1X0TA 3FKII 1VQ6Z 3CC7Z 3JAMf 1YJNZ 2JA7I 1K8A2 3CC41 1YJW1 1K731 2O53A 2OTJ1 3BG1B 2J6AA 5IP9I 1QVFY 1K83I 3J80f 2WB1A 1VQ8Z 2OZKA 3CC71 1KD11 1RO4A 2JS4A 3G71Z 1RLYA 1Y1WI 5A2Qb 1L1OC 3S14I 1RO2A 2HF1A 1Q811 5D1OA 3G6EZ 1Q822 3J7A4 1TWGI 4BBSI 1VQMZ 1QVGZ 2G2KA 1PFTA 3G6E1 3I4NI 2DE7A 2QLVB 1VQ7Z 2Y0SA 2IZ3A 1VLAA 1I6HI 3GKQA 1YHQZ 2R93I 1TWHI 1VQM1 3CCVZ 1YI21 1M1K1 3GCFA 3S1NI 1ZB9A 3HOYI 3PO3S 2AKLA 4EWCA 1VQOZ 5C4XI 1JJ2Z 1TFIA 3M3YI 2GTHA 2RPRA 4NB9A 4E32A 1Q812 3CXCZ 1YJN1 4NOZA 1YJWZ 3NDJA 1K9M2 2KPIA 5AN9F 3CCEZ 3CCS1 1TWFI 5FLXf 1VQ41 4A3BI 4E2XA 1KQSY 4A3II 2RT9A 4A3CI 2I3CA 3GTGI 3S17I 1NUIA 3PO2I 3CCV1 1YI2Z 1USPA 4NH1C 2F4OA 4NFRA 4A3FI 5T67A 4BY1I 5C44I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q I;  1X3Z A;  3D6W A;  5IP7 I;  3HOX I;  3I4M I;  2NVT I;  4Y7N I;  3VMI A;  4NB8 A;  1SFO I;  1WW9 A;  3PO3 I;  1Y1V S;  2JA5 I;  4NBD A;  3S1M I;  2B63 I;  3CQZ I;  3FKI I;  2JA7 I;  3H3V J;  1ZB8 A;  3GTM I;  3H0G I;  2K5R A;  5IP9 I;  2J6A A;  1K83 I;  4A93 I;  3S1Q I;  4A3L I;  1LQL A;  1RO4 A;  1WCM I;  2JS4 A;  1RLY A;  1Y1W I;  5FLM I;  3HOU I;  2NVQ I;  3HOZ I;  4QTT A;  3S15 I;  1L1O C;  1TWA I;  1N2F A;  3S14 I;  2R7Z I;  4A3K I;  2HF1 A;  4A3M I;  3GTP I;  2E2H I;  1USP B;  2JA6 I;  5C3E I;  3S16 I;  4A3G I;  4MH4 A;  4A3J I;  4BBR I;  3RZD I;  1TWG I;  2P3Y A;  4BXX I;  4BBS I;  3K7A I;  1PFT A;  3U50 C;  3I4N I;  3EER A;  5C4J I;  2DE7 A;  2NVY I;  3LUS A;  3S2H I;  1I6H I;  1VLA A;  3GKQ A;  4Y52 I;  2R93 I;  2E2I I;  1TWH I;  3GTK I;  1Y1V I;  1R9T I;  3GCF A;  3VMH A;  2E2J I;  3S1N I;  2YU9 I;  2JR6 A;  3VB9 A;  1ZB9 A;  2DE5 A;  3HOY I;  4A3E I;  3PO3 S;  2AKL A;  5C4X I;  1TFI A;  3M3Y I;  3GTJ I;  4NB9 A;  3GTL I;  2JNY A;  3S1R I;  3M4O I;  3GTQ I;  1I50 I;  2NVX I;  1DL6 A;  5CM2 M;  4A3D I;  2F4M A;  4NOZ A;  2DE6 A;  2KPI A;  4X6A I;  4NBE A;  1TWF I;  1YUA A;  1X3W A;  2RBL A;  4XX2 A;  2VUM I;  4A3B I;  2JA8 I;  2BJO A;  3GTM S;  4BY7 I;  4NBB A;  3ESW A;  4A3I I;  3GTO I;  4NBC A;  3RZO I;  1TWC I;  4A3C I;  1QYP A;  3GTG I;  3S17 I;  3S2D I;  1ML8 A;  1NUI A;  3PO2 I;  3VMG A;  3HOV I;  4NBH A;  4NBF A;  4NBG A;  1USP A;  2F4O A;  4QTU A;  3HOW I;  3Q87 A;  4A3F I;  4NBA A;  2R92 I;  2PK7 A;  4BY1 I;  3I07 A;  5C44 I; 
#chains in the Genus database with same CATH topology
 1Z02 A;  5IP7 I;  3CME 1;  3CCQ 1;  1Q82 1;  3KIH A;  3CCJ 1;  2Q51 A;  2GU2 A;  4NB8 A;  2V8K A;  1SFO I;  4DK1 A;  1VQ9 Z;  1VQP 1;  3I56 Z;  3P5J B;  3T4N B;  2ZAE B;  1ZB8 A;  1K8A 1;  1N8R 2;  4RVH A;  4MD9 A;  3S1Q I;  4MON A;  3CCR Z;  1LQL A;  3CPW Y;  1Q7Y 1;  2JMO A;  2R6M A;  3NH4 A;  3G4S 1;  1M1K 2;  3HOU I;  2V45 A;  4S1T A;  1M90 1;  2W04 A;  2VF1 A;  3S15 I;  1TWA I;  1YIT Z;  4DQY B;  1KD1 2;  2JA6 I;  4A3J I;  3NH5 A;  4BBR I;  1YJ9 1;  3CMA Z;  1YIT 1;  3CCU Z;  3VTN A;  1K73 2;  5T6B A;  4MD7 A;  2EGT A;  3EER A;  2QRE B;  3KIF A;  2PMZ A;  1Z01 A;  3LUS A;  2JIP A;  1Y1V I;  2OTL 1;  3IFU A;  1N8R 1;  2JR6 A;  2WAQ A;  2JIR A;  3NFZ A;  4A3E I;  4RVF A;  2OOY B;  2VPX A;  1WII A;  2RIQ A;  1Q7Y 2;  2IZ4 A;  1Z03 A;  5CM2 M;  4A3D I;  5A2Q f;  3CCM 1;  4E2W A;  4X6A I;  5FLX b;  1YUA A;  1S72 1;  2RBL A;  4HGZ A;  4MXU A;  2VUM I;  2BJO A;  4BY7 I;  2OOX B;  2QR1 B;  3IX0 A;  2VPW A;  3RZO I;  3J80 b;  1TWC I;  3D9X A;  2M6N A;  2QA4 Z;  2HU9 A;  2VUG A;  4QTU A;  3HOW I;  4NBA A;  2PK7 A;  3IF8 A;  1S7M A;  2QEX Z;  1VQ6 1;  2NVT I;  4Y7N I;  3VMI A;  3CD6 1;  3PO3 I;  3CCL 1;  2NAP A;  3CC4 Z;  3CXC Y;  2QEX 1;  1FDI A;  4E31 A;  3JAM b;  2B63 I;  1QVG Y;  2AYD A;  3NH8 A;  3CC2 1;  3CCL Z;  1VQ8 1;  1YIJ 1;  3GTM I;  2K5R A;  2JIQ A;  2QRD B;  1KRL A;  1K9M 1;  4A93 I;  2LIY A;  1WCM I;  2NVQ I;  3HOZ I;  1NJI 1;  4QTT A;  5IT9 f;  2R7Z I;  2O4H A;  2E2H I;  1VQ5 1;  5C3E I;  3S16 I;  1WZN A;  4HH4 A;  3RZD I;  3QWU A;  4E2Z A;  3K7A I;  4DGL A;  2E9H A;  3CD6 Z;  3CME Z;  3U50 C;  5IT9 b;  5C4J I;  1VQ5 Z;  1WJ2 A;  2NVY I;  3S2H I;  2QRC B;  2E2I I;  2JUB A;  3GTK I;  2E2J I;  2KI7 B;  1VQN Z;  3VB9 A;  1YHQ 1;  2DE5 A;  1VQL 1;  1YUK A;  1VQ7 1;  1ZH1 A;  4E2Y A;  4RS4 A;  3I55 1;  3GTJ I;  2RHB A;  3CC2 Z;  2F4M A;  3I55 Z;  1VQ4 Z;  3MZL B;  3I56 1;  2DE6 A;  2LEX A;  2V8I A;  1Q86 2;  1X3W A;  1NP6 A;  1FDO A;  3GTM S;  1P9N A;  3CMA 1;  4AYB A;  3NDI A;  3CCS Z;  3CCR 1;  4NBB A;  3ESW A;  1VQK Z;  2K3R A;  1QYP A;  2LFU A;  4HGY A;  1RO0 A;  2V8J A;  3VMG A;  4NBH A;  3J81 f;  4TNU A;  1VQK 1;  3I07 A;  1AA6 A;  2JIM A;  1VQL Z;  1VQO 1;  1I3Q I;  1X3Z A;  3D6W A;  2VPY A;  3I4M I;  1VQP Z;  4E30 A;  1Y1V S;  1Y8C A;  3J81 b;  3CCJ Z;  2JA5 I;  3S1M I;  3CQZ I;  5LL6 f;  4RVG A;  3CCE 1;  3H3V J;  1JWH C;  1VQN 1;  3CCM Z;  1RQF A;  3H0G I;  3G4S Z;  1NJI 2;  1W2B Y;  2OTL Z;  1KQS Z;  4A3L I;  1RNI A;  3TDH B;  2Q4Z A;  1KC8 2;  2P28 A;  3CPW Z;  5FLM I;  2W03 A;  3HKZ A;  1N2F A;  4A3K I;  4A3M I;  3GTP I;  1USP B;  2VPZ A;  4RV9 A;  1W2B Z;  4A3G I;  4MH4 A;  2GTI A;  2P3Y A;  3MZK B;  4BXX I;  2QKD A;  5D1O B;  1JJ2 Y;  3OW2 Z;  1M90 2;  3CCU 1;  5D1P A;  1KC8 1;  4Y52 I;  2H85 A;  4E33 A;  1R9T I;  3VMH A;  2YU9 I;  3CCQ Z;  3MON A;  1Q86 1;  2JIO A;  3GTL I;  3TE5 B;  1VQ9 1;  2JNY A;  3IR7 A;  3S1R I;  3M4O I;  3GTQ I;  1I50 I;  3BG0 B;  2NVX I;  1DL6 A;  3F3P C;  1S72 Z;  4NBE A;  2YAD A;  4XX2 A;  2JA8 I;  2M48 A;  3FQM A;  4RVD A;  3F3F C;  2QA4 1;  1QVF Z;  4MRI A;  2PM9 A;  3GTO I;  4NBC A;  3OW2 Y;  3G71 1;  5T64 A;  3S2D I;  3EED A;  1ML8 A;  3FQQ A;  3HOV I;  4NBF A;  4NBG A;  4CL1 A;  3Q87 A;  2R92 I;  1YJ9 Z;  4MD8 A;  1Q16 A;  1QF8 A;  3HOX I;  1YIJ Z;  1WW9 A;  2OTJ Z;  4NBD A;  1X0T A;  3FKI I;  1VQ6 Z;  3CC7 Z;  3JAM f;  1YJN Z;  2JA7 I;  1K8A 2;  3CC4 1;  1YJW 1;  1K73 1;  2O53 A;  2OTJ 1;  3BG1 B;  2J6A A;  5IP9 I;  1QVF Y;  1K83 I;  3J80 f;  2WB1 A;  1VQ8 Z;  2OZK A;  3CC7 1;  1KD1 1;  1RO4 A;  2JS4 A;  3G71 Z;  1RLY A;  1Y1W I;  5A2Q b;  1L1O C;  3S14 I;  1RO2 A;  2HF1 A;  1Q81 1;  1SIW A;  5D1O A;  3G6E Z;  1Q82 2;  3J7A 4;  1TWG I;  4BBS I;  2E7Z A;  1VQM Z;  1QVG Z;  2G2K A;  1PFT A;  3G6E 1;  3I4N I;  2DE7 A;  2QLV B;  2IV2 X;  1VQ7 Z;  2Y0S A;  2IZ3 A;  1VLA A;  1I6H I;  3GKQ A;  1YHQ Z;  2R93 I;  1TWH I;  1VQM 1;  1QXF A;  3CCV Z;  1YI2 1;  1M1K 1;  3GCF A;  3S1N I;  1ZB9 A;  3HOY I;  3PO3 S;  2AKL A;  4EWC A;  1VQO Z;  5C4X I;  1JJ2 Z;  3D2L A;  1TFI A;  3M3Y I;  2GTH A;  2RPR A;  4NB9 A;  4E32 A;  1Q81 2;  3CXC Z;  1YJN 1;  4NOZ A;  1YJW Z;  3NDJ A;  1K9M 2;  2KPI A;  5AN9 F;  3CCE Z;  3CCS 1;  1TWF I;  2V3V A;  5FLX f;  1VQ4 1;  4A3B I;  4E2X A;  1KQS Y;  4A3I I;  2RT9 A;  4A3C I;  2I3C A;  3GTG I;  3S17 I;  1NUI A;  3PO2 I;  3CCV 1;  1YI2 Z;  1USP A;  4NH1 C;  2F4O A;  4NFR A;  4A3F I;  5T67 A;  4BY1 I;  5C44 I; 
#chains in the Genus database with same CATH homology
 1Z02 A;  5IP7 I;  3CME 1;  3CCQ 1;  1Q82 1;  3KIH A;  3CCJ 1;  2Q51 A;  2GU2 A;  4NB8 A;  2V8K A;  1SFO I;  4DK1 A;  1VQ9 Z;  1VQP 1;  3I56 Z;  3P5J B;  3T4N B;  2ZAE B;  1ZB8 A;  1K8A 1;  1N8R 2;  4RVH A;  4MD9 A;  3S1Q I;  4MON A;  3CCR Z;  1LQL A;  3CPW Y;  1Q7Y 1;  2JMO A;  2R6M A;  3NH4 A;  3G4S 1;  1M1K 2;  3HOU I;  4S1T A;  1M90 1;  2W04 A;  2VF1 A;  3S15 I;  1TWA I;  1YIT Z;  4DQY B;  1KD1 2;  2JA6 I;  4A3J I;  3NH5 A;  4BBR I;  1YJ9 1;  3CMA Z;  1YIT 1;  3CCU Z;  3VTN A;  1K73 2;  5T6B A;  4MD7 A;  2EGT A;  3EER A;  2QRE B;  3KIF A;  2PMZ A;  1Z01 A;  3LUS A;  1Y1V I;  2OTL 1;  3IFU A;  1N8R 1;  2JR6 A;  2WAQ A;  3NFZ A;  4A3E I;  4RVF A;  2OOY B;  1WII A;  2RIQ A;  1Q7Y 2;  2IZ4 A;  1Z03 A;  5CM2 M;  4A3D I;  5A2Q f;  3CCM 1;  4E2W A;  4X6A I;  5FLX b;  1YUA A;  1S72 1;  2RBL A;  4HGZ A;  4MXU A;  2VUM I;  2BJO A;  4BY7 I;  2OOX B;  2QR1 B;  3IX0 A;  3RZO I;  3J80 b;  1TWC I;  3D9X A;  2M6N A;  2QA4 Z;  2HU9 A;  2VUG A;  4QTU A;  3HOW I;  4NBA A;  2PK7 A;  3IF8 A;  1S7M A;  2QEX Z;  1VQ6 1;  2NVT I;  4Y7N I;  3VMI A;  3CD6 1;  3PO3 I;  3CCL 1;  3CC4 Z;  3CXC Y;  2QEX 1;  4E31 A;  3JAM b;  2B63 I;  1QVG Y;  3NH8 A;  3CC2 1;  3CCL Z;  1VQ8 1;  1YIJ 1;  3GTM I;  2K5R A;  2QRD B;  1KRL A;  1K9M 1;  4A93 I;  2LIY A;  1WCM I;  2NVQ I;  3HOZ I;  1NJI 1;  4QTT A;  5IT9 f;  2R7Z I;  2O4H A;  2E2H I;  1VQ5 1;  5C3E I;  3S16 I;  4HH4 A;  3RZD I;  3QWU A;  4E2Z A;  3K7A I;  4DGL A;  2E9H A;  3CD6 Z;  3CME Z;  3U50 C;  5IT9 b;  5C4J I;  1VQ5 Z;  2NVY I;  3S2H I;  2QRC B;  2E2I I;  2JUB A;  3GTK I;  2E2J I;  2KI7 B;  1VQN Z;  3VB9 A;  1YHQ 1;  2DE5 A;  1VQL 1;  1YUK A;  1VQ7 1;  1ZH1 A;  4E2Y A;  4RS4 A;  3I55 1;  3GTJ I;  2RHB A;  3CC2 Z;  2F4M A;  3I55 Z;  1VQ4 Z;  3MZL B;  3I56 1;  2DE6 A;  2V8I A;  1Q86 2;  1X3W A;  1NP6 A;  3GTM S;  1P9N A;  3CMA 1;  4AYB A;  3NDI A;  3CCS Z;  3CCR 1;  4NBB A;  3ESW A;  1VQK Z;  2K3R A;  1QYP A;  2LFU A;  4HGY A;  1RO0 A;  2V8J A;  3VMG A;  4NBH A;  3J81 f;  4TNU A;  1VQK 1;  3I07 A;  1VQL Z;  1VQO 1;  1I3Q I;  1X3Z A;  3D6W A;  3I4M I;  1VQP Z;  4E30 A;  1Y1V S;  3J81 b;  3CCJ Z;  2JA5 I;  3S1M I;  3CQZ I;  5LL6 f;  4RVG A;  3CCE 1;  3H3V J;  1JWH C;  1VQN 1;  3CCM Z;  1RQF A;  3H0G I;  3G4S Z;  1NJI 2;  1W2B Y;  2OTL Z;  1KQS Z;  4A3L I;  1RNI A;  3TDH B;  2Q4Z A;  1KC8 2;  2P28 A;  3CPW Z;  5FLM I;  2W03 A;  3HKZ A;  1N2F A;  4A3K I;  4A3M I;  3GTP I;  1USP B;  4RV9 A;  1W2B Z;  4A3G I;  4MH4 A;  2GTI A;  2P3Y A;  3MZK B;  4BXX I;  2QKD A;  5D1O B;  1JJ2 Y;  3OW2 Z;  1M90 2;  3CCU 1;  5D1P A;  1KC8 1;  4Y52 I;  2H85 A;  4E33 A;  1R9T I;  3VMH A;  2YU9 I;  3CCQ Z;  3MON A;  1Q86 1;  3GTL I;  3TE5 B;  1VQ9 1;  2JNY A;  3S1R I;  3M4O I;  3GTQ I;  1I50 I;  3BG0 B;  2NVX I;  1DL6 A;  3F3P C;  1S72 Z;  4NBE A;  2YAD A;  4XX2 A;  2JA8 I;  2M48 A;  3FQM A;  4RVD A;  3F3F C;  2QA4 1;  1QVF Z;  4MRI A;  2PM9 A;  3GTO I;  4NBC A;  3OW2 Y;  3G71 1;  5T64 A;  3S2D I;  3EED A;  1ML8 A;  3FQQ A;  3HOV I;  4NBF A;  4NBG A;  4CL1 A;  3Q87 A;  2R92 I;  1YJ9 Z;  4MD8 A;  1QF8 A;  3HOX I;  1YIJ Z;  1WW9 A;  2OTJ Z;  4NBD A;  1X0T A;  3FKI I;  1VQ6 Z;  3CC7 Z;  3JAM f;  1YJN Z;  2JA7 I;  1K8A 2;  3CC4 1;  1YJW 1;  1K73 1;  2O53 A;  2OTJ 1;  3BG1 B;  2J6A A;  5IP9 I;  1QVF Y;  1K83 I;  3J80 f;  2WB1 A;  1VQ8 Z;  2OZK A;  3CC7 1;  1KD1 1;  1RO4 A;  2JS4 A;  3G71 Z;  1RLY A;  1Y1W I;  5A2Q b;  1L1O C;  3S14 I;  1RO2 A;  2HF1 A;  1Q81 1;  5D1O A;  3G6E Z;  1Q82 2;  3J7A 4;  1TWG I;  4BBS I;  1VQM Z;  1QVG Z;  2G2K A;  1PFT A;  3G6E 1;  3I4N I;  2DE7 A;  2QLV B;  1VQ7 Z;  2Y0S A;  2IZ3 A;  1VLA A;  1I6H I;  3GKQ A;  1YHQ Z;  2R93 I;  1TWH I;  1VQM 1;  3CCV Z;  1YI2 1;  1M1K 1;  3GCF A;  3S1N I;  1ZB9 A;  3HOY I;  3PO3 S;  2AKL A;  4EWC A;  1VQO Z;  5C4X I;  1JJ2 Z;  1TFI A;  3M3Y I;  2GTH A;  2RPR A;  4NB9 A;  4E32 A;  1Q81 2;  3CXC Z;  1YJN 1;  4NOZ A;  1YJW Z;  3NDJ A;  1K9M 2;  2KPI A;  5AN9 F;  3CCE Z;  3CCS 1;  1TWF I;  5FLX f;  1VQ4 1;  4A3B I;  4E2X A;  1KQS Y;  4A3I I;  2RT9 A;  4A3C I;  2I3C A;  3GTG I;  3S17 I;  1NUI A;  3PO2 I;  3CCV 1;  1YI2 Z;  1USP A;  4NH1 C;  2F4O A;  4NFR A;  4A3F I;  5T67 A;  4BY1 I;  5C44 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...