3GTJI

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI02
2JA7I 3PO3S 3GTPI 1R9TI 1USPA 4NB9A 4BBRI 3HOYI 3S1QI 1Y1VI 3GCFA 1DL6A 4NBCA 4BXXI 3GTMS 3S17I 3VMGA 3D6WA 5C4XI 1X3WA 3VB9A 4A3FI 5IP7I 3GTKI 4NBEA 2E2HI 2NVQI 3HOVI 3HOUI 3GKQA 2E2JI 2YU9I 4QTUA 1VLAA 2JR6A 1I3QI 2JS4A 1TWCI 3VMHA 4A3DI 3Q87A 3S1RI 4NBBA 3PO3I 1QYPA 3VMIA 3RZOI 4BBSI 3K7AI 3EERA 1ML8A 4A3EI 5C4JI 4BY7I 1TFIA 4X6AI 2DE6A 1YUAA 1L1OC 3HOXI 4XX2A 3H3VJ 5FLMI 3CQZI 1RLYA 3LUSA 1N2FA 4NB8A 2P3YA 4A3KI 2NVXI 2B63I 3I4MI 2VUMI 2E2II 1TWGI 2BJOA 3I4NI 3FKII 2F4OA 4Y52I 1WCMI 4NBFA 1WW9A 4A3CI 4BY1I 3S1MI 4A3GI 4A3JI 1Y1WI 3U50C 2R92I 5IP9I 3M3YI 3S2HI 1X3ZA 1TWAI 3GTMI 2K5RA 4A3II 2JNYA 4NBDA 4MH4A 1I50I 2DE5A 2JA6I 4A93I 4A3MI 2R93I 3S14I 2KPIA 5CM2M 2HF1A 3H0GI 3S2DI 3GTJI 1K83I 1PFTA 2R7ZI 3S1NI 3RZDI 3S16I 2DE7A 2PK7A 3M4OI 2NVTI 2F4MA 4A3LI 3GTOI 3GTQI 5C3EI 1Y1VS 3PO2I 1TWFI 3I07A 1TWHI 3S15I 2JA5I 2AKLA 1LQLA 4NBHA 4QTTA 4NBAA 2RBLA 1RO4A 2J6AA 1I6HI 3GTLI 1ZB8A 4A3BI 3GTGI 2JA8I 4NOZA 1SFOI 1NUIA 4Y7NI 5C44I 1USPB 2NVYI 3HOWI 3HOZI 3ESWA 4NBGA 1ZB9A
chains in the Genus database with same CATH superfamily
3PO3S 1YIT1 3D9XA 1FDOA 4NB9A 4BBRI 3CC21 3HOYI 2PMZA 4HH4A 4NBCA 2JIPA 3GTMS 3S17I 3D2LA 2VUGA 4A3FI 3CMAZ 2NAPA 4S1TA 1YIJ1 3NDJA 5LL6f 3GTKI 1Q7Y2 1VQ7Z 5A2Qf 4MRIA 2M6NA 2GU2A 1VLAA 1I3QI 1KC82 3MONA 3JAMf 3CXCY 3PO3I 1Z03A 1QYPA 2QLVB 1VQPZ 3VMIA 4BBSI 3EERA 1KQSY 1L1OC 3I56Z 3CCQZ 5T67A 4XX2A 3G71Z 1VQ81 1S7MA 1RLYA 3LUSA 1N2FA 1K8A1 2K3RA 1QXFA 1S721 2B63I 3I4MI 3QWUA 1KD12 2VUMI 1VQ4Z 2OTJZ 1K9M2 1WCMI 3J81b 3S1MI 2E9HA 2R92I 4MD9A 1VQLZ 4DK1A 1YJNZ 1VQK1 4RVGA 3KIHA 1AA6A 2OTL1 1YJW1 1NJI1 4E2XA 4A93I 3CCEZ 4HGYA 1N8R2 2HF1A 5FLXf 3GTJI 2V45A 2OOYB 2DE7A 3M4OI 2NVTI 2KI7B 2G2KA 1M1K1 2QA41 2E7ZA 3I07A 3CCMZ 5IT9b 1Z02A 2GTHA 4NBHA 2RBLA 1ZB8A 3GTGI 2RIQA 3NFZA 1USPB 2NVYI 3CC4Z 2RHBA 2JA7I 1QVGZ 1R9TI 2VPZA 3CCVZ 1DL6A 3CMEZ 4BXXI 3CCJ1 3OW2Z 3D6WA 2W03A 1P9NA 2WB1A 2E2HI 4CL1A 4EWCA 2E2JI 2JR6A 1KRLA 1VQ51 4A3DI 3CD61 3IF8A 2EGTA 3RZOI 3K7AI 4A3EI 3CCU1 5C4JI 4BY7I 1RO0A 3G6E1 1YJ9Z 1TFIA 4X6AI 2DE6A 3HOXI 3F3FC 3H3VJ 3CQZI 1M902 2QRCB 5T64A 4A3KI 5A2Qb 2P28A 2QEX1 1YUKA 5T6BA 1NP6A 2BJOA 3JAMb 1QVFY 1Q862 1K731 1VQ6Z 2JIQA 1WW9A 4A3CI 3MZKB 4A3GI 1Y1WI 1X0TA 3I551 3S2HI 3CC71 4NFRA 2R6MA 3GTMI 2HU9A 1SIWA 1JWHC 1YI21 2ZAEB 4NBDA 2V3VA 4MH4A 3OW2Y 1I50I 2RT9A 1W2BY 1Q821 3F3PC 1M1K2 3J80f 2R93I 2IZ4A 2KPIA 4DQYB 2I3CA 5CM2M 1Q16A 1WZNA 3CCLZ 4A3LI 2VPXA 3GTQI 1Y1VS 3G4S1 4E30A 2OZKA 1VQO1 1TWHI 3S15I 2JA5I 5D1PA 1LQLA 4NBAA 3GTLI 1VQN1 4NOZA 1NUIA 1VQMZ 4Y7NI 3HOZI 5D1OB 1YHQZ 4RVDA 5FLXb 1Q7Y1 2H85A 3GTPI 3NH5A 1USPA 3BG1B 1VQ5Z 1Y1VI 3CMA1 3GCFA 1KC81 4RVHA 1YITZ 1VQ71 3CC2Z 5C4XI 2VPYA 4RVFA 3G6EZ 2YADA 3HOVI 3GKQA 4E31A 2JIOA 2QREB 1YIJZ 3EEDA 2JS4A 3Q87A 3NH8A 3CCR1 3S1RI 2Y0SA 3I561 3CCQ1 1KD11 3G711 1ML8A 1RO2A 2RPRA 2QKDA 1K9M1 5IT9f 1YUAA 5FLMI 3CPWZ 1VQ41 2P3YA 1K732 4NH1C 3CCS1 1VQ91 2NVXI 2OTJ1 1VQ8Z 3TE5B 1TWGI 4HGZA 4Y52I 1YJN1 2QR1B 1S72Z 1RQFA 4A3JI 1ZH1A 4DGLA 4E33A 1WJ2A 1TWAI 1RNIA 1K8A2 2K5RA 4A3II 4MXUA 3CCE1 2JNYA 1VQKZ 2OOXB 3MZLB 4MONA 2PM9A 2JUBA 1FDIA 3S14I 2OTLZ 1VQNZ 1YJWZ 3S2DI 1PFTA 2R7ZI 3S1NI 2Q4ZA 2IZ3A 3CCM1 2Q51A 1Q811 3GTOI 5C3EI 3J7A4 3PO2I 1TWFI 3VTNA 2QRDB 1NJI2 1QVGY 2QA4Z 4QTTA 3CC41 1RO4A 2J6AA 1I6HI 1SFOI 3NH4A 5C44I 3J80b 2V8IA 3CCV1 3ESWA 3CPWY 4NBGA 1ZB9A 4E2ZA 3CME1 5D1OA 3S1QI 1QF8A 3IR7A 3CCRZ 3TDHB 4E2YA 3VMGA 3FQQA 1X3WA 3VB9A 3IFUA 1JJ2Z 5IP7I 1WIIA 2AYDA 3CCJZ 4NBEA 2NVQI 3HOUI 4E32A 2W04A 2YU9I 4QTUA 3IX0A 1M901 1TWCI 3VMHA 2V8KA 3CCSZ 1VQ9Z 1YJ91 4NBBA 2LFUA 4TNUA 3J81f 1Y8CA 3CD6Z 1Q861 2JMOA 2O4HA 3T4NB 4RS4A 4RV9A 3CCUZ 4NB8A 4E2WA 2V8JA 1VQ61 2LIYA 3FQMA 1VQP1 3BG0B 2E2II 3I4NI 3FKII 2F4OA 3NDIA 2O53A 2QEXZ 4NBFA 4BY1I 4AYBA 2LEXA 3U50C 3HKZA 5IP9I 1Z01A 3M3YI 1X3ZA 2VF1A 3I55Z 3CC7Z 3P5JB 1QVFZ 4MD7A 3CXCZ 2DE5A 1YI2Z 1Q812 2JA6I 4A3MI 3CCL1 1JJ2Y 1KQSZ 3H0GI 2JIMA 1K83I 3RZDI 3S16I 2PK7A 1VQL1 2F4MA 4MD8A 1N8R1 3KIFA 1W2BZ 2VPWA 1Q822 2AKLA 1VQM1 3G4SZ 2GTIA 2IV2X 1YHQ1 1VQOZ 4A3BI 2WAQA 5AN9F 2JA8I 2M48A 3HOWI 2JIRA
chains in the Genus database with same CATH topology
3PO3S 1YIT1 3D9XA 4NB9A 4BBRI 3CC21 3HOYI 2PMZA 4HH4A 4NBCA 3GTMS 3S17I 2VUGA 4A3FI 3CMAZ 4S1TA 1YIJ1 3NDJA 5LL6f 3GTKI 1Q7Y2 1VQ7Z 5A2Qf 4MRIA 2M6NA 2GU2A 1VLAA 1I3QI 1KC82 3MONA 3JAMf 3CXCY 3PO3I 1Z03A 1QYPA 2QLVB 1VQPZ 3VMIA 4BBSI 3EERA 1KQSY 1L1OC 3I56Z 3CCQZ 5T67A 4XX2A 3G71Z 1VQ81 1S7MA 1RLYA 3LUSA 1N2FA 1K8A1 2K3RA 1S721 2B63I 3I4MI 3QWUA 1KD12 2VUMI 1VQ4Z 2OTJZ 1K9M2 1WCMI 3J81b 3S1MI 2E9HA 2R92I 4MD9A 1VQLZ 4DK1A 1YJNZ 1VQK1 4RVGA 3KIHA 2OTL1 1YJW1 1NJI1 4E2XA 4A93I 3CCEZ 4HGYA 1N8R2 2HF1A 5FLXf 3GTJI 2OOYB 2DE7A 3M4OI 2NVTI 2KI7B 2G2KA 1M1K1 2QA41 3I07A 3CCMZ 5IT9b 1Z02A 2GTHA 4NBHA 2RBLA 1ZB8A 3GTGI 2RIQA 3NFZA 1USPB 2NVYI 3CC4Z 2RHBA 2JA7I 1QVGZ 1R9TI 3CCVZ 1DL6A 3CMEZ 4BXXI 3CCJ1 3OW2Z 3D6WA 2W03A 1P9NA 2WB1A 2E2HI 4CL1A 4EWCA 2E2JI 2JR6A 1KRLA 1VQ51 4A3DI 3CD61 3IF8A 2EGTA 3RZOI 3K7AI 4A3EI 3CCU1 5C4JI 4BY7I 1RO0A 3G6E1 1YJ9Z 1TFIA 4X6AI 2DE6A 3HOXI 3F3FC 3H3VJ 3CQZI 1M902 2QRCB 5T64A 4A3KI 5A2Qb 2P28A 2QEX1 1YUKA 5T6BA 1NP6A 2BJOA 3JAMb 1QVFY 1Q862 1K731 1VQ6Z 1WW9A 4A3CI 3MZKB 4A3GI 1Y1WI 1X0TA 3I551 3S2HI 3CC71 4NFRA 2R6MA 3GTMI 2HU9A 1JWHC 1YI21 2ZAEB 4NBDA 4MH4A 3OW2Y 1I50I 2RT9A 1W2BY 1Q821 3F3PC 1M1K2 3J80f 2R93I 2IZ4A 2KPIA 4DQYB 2I3CA 5CM2M 3CCLZ 4A3LI 3GTQI 1Y1VS 3G4S1 4E30A 2OZKA 1VQO1 1TWHI 3S15I 2JA5I 5D1PA 1LQLA 4NBAA 3GTLI 1VQN1 4NOZA 1NUIA 1VQMZ 4Y7NI 3HOZI 5D1OB 1YHQZ 4RVDA 5FLXb 1Q7Y1 2H85A 3GTPI 3NH5A 1USPA 3BG1B 1VQ5Z 1Y1VI 3CMA1 3GCFA 1KC81 4RVHA 1YITZ 1VQ71 3CC2Z 5C4XI 4RVFA 3G6EZ 2YADA 3HOVI 3GKQA 4E31A 2QREB 1YIJZ 3EEDA 2JS4A 3Q87A 3NH8A 3CCR1 3S1RI 2Y0SA 3I561 3CCQ1 1KD11 3G711 1ML8A 1RO2A 2RPRA 2QKDA 1K9M1 5IT9f 1YUAA 5FLMI 3CPWZ 1VQ41 2P3YA 1K732 4NH1C 3CCS1 1VQ91 2NVXI 2OTJ1 1VQ8Z 3TE5B 1TWGI 4HGZA 4Y52I 1YJN1 2QR1B 1S72Z 1RQFA 4A3JI 1ZH1A 4DGLA 4E33A 1TWAI 1RNIA 1K8A2 2K5RA 4A3II 4MXUA 3CCE1 2JNYA 1VQKZ 2OOXB 3MZLB 4MONA 2PM9A 2JUBA 3S14I 2OTLZ 1VQNZ 1YJWZ 3S2DI 1PFTA 2R7ZI 3S1NI 2Q4ZA 2IZ3A 3CCM1 2Q51A 1Q811 3GTOI 5C3EI 3J7A4 3PO2I 1TWFI 3VTNA 2QRDB 1NJI2 1QVGY 2QA4Z 4QTTA 3CC41 1RO4A 2J6AA 1I6HI 1SFOI 3NH4A 5C44I 3J80b 2V8IA 3CCV1 3ESWA 3CPWY 4NBGA 1ZB9A 4E2ZA 3CME1 5D1OA 3S1QI 1QF8A 3CCRZ 3TDHB 4E2YA 3VMGA 3FQQA 1X3WA 3VB9A 3IFUA 1JJ2Z 5IP7I 1WIIA 3CCJZ 4NBEA 2NVQI 3HOUI 4E32A 2W04A 2YU9I 4QTUA 3IX0A 1M901 1TWCI 3VMHA 2V8KA 3CCSZ 1VQ9Z 1YJ91 4NBBA 2LFUA 4TNUA 3J81f 3CD6Z 1Q861 2JMOA 2O4HA 3T4NB 4RS4A 4RV9A 3CCUZ 4NB8A 4E2WA 2V8JA 1VQ61 2LIYA 3FQMA 1VQP1 3BG0B 2E2II 3I4NI 3FKII 2F4OA 3NDIA 2O53A 2QEXZ 4NBFA 4BY1I 4AYBA 3U50C 3HKZA 5IP9I 1Z01A 3M3YI 1X3ZA 2VF1A 3I55Z 3CC7Z 3P5JB 1QVFZ 4MD7A 3CXCZ 2DE5A 1YI2Z 1Q812 2JA6I 4A3MI 3CCL1 1JJ2Y 1KQSZ 3H0GI 1K83I 3RZDI 3S16I 2PK7A 1VQL1 2F4MA 4MD8A 1N8R1 3KIFA 1W2BZ 1Q822 2AKLA 1VQM1 3G4SZ 2GTIA 1YHQ1 1VQOZ 4A3BI 2WAQA 5AN9F 2JA8I 2M48A 3HOWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA7 I;  3PO3 S;  3GTP I;  1R9T I;  1USP A;  4NB9 A;  4BBR I;  3HOY I;  3S1Q I;  1Y1V I;  3GCF A;  1DL6 A;  4NBC A;  4BXX I;  3GTM S;  3S17 I;  3VMG A;  3D6W A;  5C4X I;  1X3W A;  3VB9 A;  4A3F I;  5IP7 I;  3GTK I;  4NBE A;  2E2H I;  2NVQ I;  3HOV I;  3HOU I;  3GKQ A;  2E2J I;  2YU9 I;  4QTU A;  1VLA A;  2JR6 A;  1I3Q I;  2JS4 A;  1TWC I;  3VMH A;  4A3D I;  3Q87 A;  3S1R I;  4NBB A;  3PO3 I;  1QYP A;  3VMI A;  3RZO I;  4BBS I;  3K7A I;  3EER A;  1ML8 A;  4A3E I;  5C4J I;  4BY7 I;  1TFI A;  4X6A I;  2DE6 A;  1YUA A;  1L1O C;  3HOX I;  4XX2 A;  3H3V J;  5FLM I;  3CQZ I;  1RLY A;  3LUS A;  1N2F A;  4NB8 A;  2P3Y A;  4A3K I;  2NVX I;  2B63 I;  3I4M I;  2VUM I;  2E2I I;  1TWG I;  2BJO A;  3I4N I;  3FKI I;  2F4O A;  4Y52 I;  1WCM I;  4NBF A;  1WW9 A;  4A3C I;  4BY1 I;  3S1M I;  4A3G I;  4A3J I;  1Y1W I;  3U50 C;  2R92 I;  5IP9 I;  3M3Y I;  3S2H I;  1X3Z A;  1TWA I;  3GTM I;  2K5R A;  4A3I I;  2JNY A;  4NBD A;  4MH4 A;  1I50 I;  2DE5 A;  2JA6 I;  4A93 I;  4A3M I;  2R93 I;  3S14 I;  2KPI A;  5CM2 M;  2HF1 A;  3H0G I;  3S2D I;  3GTJ I;  1K83 I;  1PFT A;  2R7Z I;  3S1N I;  3RZD I;  3S16 I;  2DE7 A;  2PK7 A;  3M4O I;  2NVT I;  2F4M A;  4A3L I;  3GTO I;  3GTQ I;  5C3E I;  1Y1V S;  3PO2 I;  1TWF I;  3I07 A;  1TWH I;  3S15 I;  2JA5 I;  2AKL A;  1LQL A;  4NBH A;  4QTT A;  4NBA A;  2RBL A;  1RO4 A;  2J6A A;  1I6H I;  3GTL I;  1ZB8 A;  4A3B I;  3GTG I;  2JA8 I;  4NOZ A;  1SFO I;  1NUI A;  4Y7N I;  5C44 I;  1USP B;  2NVY I;  3HOW I;  3HOZ I;  3ESW A;  4NBG A;  1ZB9 A; 
#chains in the Genus database with same CATH topology
 3PO3 S;  1YIT 1;  3D9X A;  1FDO A;  4NB9 A;  4BBR I;  3CC2 1;  3HOY I;  2PMZ A;  4HH4 A;  4NBC A;  2JIP A;  3GTM S;  3S17 I;  3D2L A;  2VUG A;  4A3F I;  3CMA Z;  2NAP A;  4S1T A;  1YIJ 1;  3NDJ A;  5LL6 f;  3GTK I;  1Q7Y 2;  1VQ7 Z;  5A2Q f;  4MRI A;  2M6N A;  2GU2 A;  1VLA A;  1I3Q I;  1KC8 2;  3MON A;  3JAM f;  3CXC Y;  3PO3 I;  1Z03 A;  1QYP A;  2QLV B;  1VQP Z;  3VMI A;  4BBS I;  3EER A;  1KQS Y;  1L1O C;  3I56 Z;  3CCQ Z;  5T67 A;  4XX2 A;  3G71 Z;  1VQ8 1;  1S7M A;  1RLY A;  3LUS A;  1N2F A;  1K8A 1;  2K3R A;  1QXF A;  1S72 1;  2B63 I;  3I4M I;  3QWU A;  1KD1 2;  2VUM I;  1VQ4 Z;  2OTJ Z;  1K9M 2;  1WCM I;  3J81 b;  3S1M I;  2E9H A;  2R92 I;  4MD9 A;  1VQL Z;  4DK1 A;  1YJN Z;  1VQK 1;  4RVG A;  3KIH A;  1AA6 A;  2OTL 1;  1YJW 1;  1NJI 1;  4E2X A;  4A93 I;  3CCE Z;  4HGY A;  1N8R 2;  2HF1 A;  5FLX f;  3GTJ I;  2V45 A;  2OOY B;  2DE7 A;  3M4O I;  2NVT I;  2KI7 B;  2G2K A;  1M1K 1;  2QA4 1;  2E7Z A;  3I07 A;  3CCM Z;  5IT9 b;  1Z02 A;  2GTH A;  4NBH A;  2RBL A;  1ZB8 A;  3GTG I;  2RIQ A;  3NFZ A;  1USP B;  2NVY I;  3CC4 Z;  2RHB A;  2JA7 I;  1QVG Z;  1R9T I;  2VPZ A;  3CCV Z;  1DL6 A;  3CME Z;  4BXX I;  3CCJ 1;  3OW2 Z;  3D6W A;  2W03 A;  1P9N A;  2WB1 A;  2E2H I;  4CL1 A;  4EWC A;  2E2J I;  2JR6 A;  1KRL A;  1VQ5 1;  4A3D I;  3CD6 1;  3IF8 A;  2EGT A;  3RZO I;  3K7A I;  4A3E I;  3CCU 1;  5C4J I;  4BY7 I;  1RO0 A;  3G6E 1;  1YJ9 Z;  1TFI A;  4X6A I;  2DE6 A;  3HOX I;  3F3F C;  3H3V J;  3CQZ I;  1M90 2;  2QRC B;  5T64 A;  4A3K I;  5A2Q b;  2P28 A;  2QEX 1;  1YUK A;  5T6B A;  1NP6 A;  2BJO A;  3JAM b;  1QVF Y;  1Q86 2;  1K73 1;  1VQ6 Z;  2JIQ A;  1WW9 A;  4A3C I;  3MZK B;  4A3G I;  1Y1W I;  1X0T A;  3I55 1;  3S2H I;  3CC7 1;  4NFR A;  2R6M A;  3GTM I;  2HU9 A;  1SIW A;  1JWH C;  1YI2 1;  2ZAE B;  4NBD A;  2V3V A;  4MH4 A;  3OW2 Y;  1I50 I;  2RT9 A;  1W2B Y;  1Q82 1;  3F3P C;  1M1K 2;  3J80 f;  2R93 I;  2IZ4 A;  2KPI A;  4DQY B;  2I3C A;  5CM2 M;  1Q16 A;  1WZN A;  3CCL Z;  4A3L I;  2VPX A;  3GTQ I;  1Y1V S;  3G4S 1;  4E30 A;  2OZK A;  1VQO 1;  1TWH I;  3S15 I;  2JA5 I;  5D1P A;  1LQL A;  4NBA A;  3GTL I;  1VQN 1;  4NOZ A;  1NUI A;  1VQM Z;  4Y7N I;  3HOZ I;  5D1O B;  1YHQ Z;  4RVD A;  5FLX b;  1Q7Y 1;  2H85 A;  3GTP I;  3NH5 A;  1USP A;  3BG1 B;  1VQ5 Z;  1Y1V I;  3CMA 1;  3GCF A;  1KC8 1;  4RVH A;  1YIT Z;  1VQ7 1;  3CC2 Z;  5C4X I;  2VPY A;  4RVF A;  3G6E Z;  2YAD A;  3HOV I;  3GKQ A;  4E31 A;  2JIO A;  2QRE B;  1YIJ Z;  3EED A;  2JS4 A;  3Q87 A;  3NH8 A;  3CCR 1;  3S1R I;  2Y0S A;  3I56 1;  3CCQ 1;  1KD1 1;  3G71 1;  1ML8 A;  1RO2 A;  2RPR A;  2QKD A;  1K9M 1;  5IT9 f;  1YUA A;  5FLM I;  3CPW Z;  1VQ4 1;  2P3Y A;  1K73 2;  4NH1 C;  3CCS 1;  1VQ9 1;  2NVX I;  2OTJ 1;  1VQ8 Z;  3TE5 B;  1TWG I;  4HGZ A;  4Y52 I;  1YJN 1;  2QR1 B;  1S72 Z;  1RQF A;  4A3J I;  1ZH1 A;  4DGL A;  4E33 A;  1WJ2 A;  1TWA I;  1RNI A;  1K8A 2;  2K5R A;  4A3I I;  4MXU A;  3CCE 1;  2JNY A;  1VQK Z;  2OOX B;  3MZL B;  4MON A;  2PM9 A;  2JUB A;  1FDI A;  3S14 I;  2OTL Z;  1VQN Z;  1YJW Z;  3S2D I;  1PFT A;  2R7Z I;  3S1N I;  2Q4Z A;  2IZ3 A;  3CCM 1;  2Q51 A;  1Q81 1;  3GTO I;  5C3E I;  3J7A 4;  3PO2 I;  1TWF I;  3VTN A;  2QRD B;  1NJI 2;  1QVG Y;  2QA4 Z;  4QTT A;  3CC4 1;  1RO4 A;  2J6A A;  1I6H I;  1SFO I;  3NH4 A;  5C44 I;  3J80 b;  2V8I A;  3CCV 1;  3ESW A;  3CPW Y;  4NBG A;  1ZB9 A;  4E2Z A;  3CME 1;  5D1O A;  3S1Q I;  1QF8 A;  3IR7 A;  3CCR Z;  3TDH B;  4E2Y A;  3VMG A;  3FQQ A;  1X3W A;  3VB9 A;  3IFU A;  1JJ2 Z;  5IP7 I;  1WII A;  2AYD A;  3CCJ Z;  4NBE A;  2NVQ I;  3HOU I;  4E32 A;  2W04 A;  2YU9 I;  4QTU A;  3IX0 A;  1M90 1;  1TWC I;  3VMH A;  2V8K A;  3CCS Z;  1VQ9 Z;  1YJ9 1;  4NBB A;  2LFU A;  4TNU A;  3J81 f;  1Y8C A;  3CD6 Z;  1Q86 1;  2JMO A;  2O4H A;  3T4N B;  4RS4 A;  4RV9 A;  3CCU Z;  4NB8 A;  4E2W A;  2V8J A;  1VQ6 1;  2LIY A;  3FQM A;  1VQP 1;  3BG0 B;  2E2I I;  3I4N I;  3FKI I;  2F4O A;  3NDI A;  2O53 A;  2QEX Z;  4NBF A;  4BY1 I;  4AYB A;  2LEX A;  3U50 C;  3HKZ A;  5IP9 I;  1Z01 A;  3M3Y I;  1X3Z A;  2VF1 A;  3I55 Z;  3CC7 Z;  3P5J B;  1QVF Z;  4MD7 A;  3CXC Z;  2DE5 A;  1YI2 Z;  1Q81 2;  2JA6 I;  4A3M I;  3CCL 1;  1JJ2 Y;  1KQS Z;  3H0G I;  2JIM A;  1K83 I;  3RZD I;  3S16 I;  2PK7 A;  1VQL 1;  2F4M A;  4MD8 A;  1N8R 1;  3KIF A;  1W2B Z;  2VPW A;  1Q82 2;  2AKL A;  1VQM 1;  3G4S Z;  2GTI A;  2IV2 X;  1YHQ 1;  1VQO Z;  4A3B I;  2WAQ A;  5AN9 F;  2JA8 I;  2M48 A;  3HOW I;  2JIR A; 
#chains in the Genus database with same CATH homology
 3PO3 S;  1YIT 1;  3D9X A;  4NB9 A;  4BBR I;  3CC2 1;  3HOY I;  2PMZ A;  4HH4 A;  4NBC A;  3GTM S;  3S17 I;  2VUG A;  4A3F I;  3CMA Z;  4S1T A;  1YIJ 1;  3NDJ A;  5LL6 f;  3GTK I;  1Q7Y 2;  1VQ7 Z;  5A2Q f;  4MRI A;  2M6N A;  2GU2 A;  1VLA A;  1I3Q I;  1KC8 2;  3MON A;  3JAM f;  3CXC Y;  3PO3 I;  1Z03 A;  1QYP A;  2QLV B;  1VQP Z;  3VMI A;  4BBS I;  3EER A;  1KQS Y;  1L1O C;  3I56 Z;  3CCQ Z;  5T67 A;  4XX2 A;  3G71 Z;  1VQ8 1;  1S7M A;  1RLY A;  3LUS A;  1N2F A;  1K8A 1;  2K3R A;  1S72 1;  2B63 I;  3I4M I;  3QWU A;  1KD1 2;  2VUM I;  1VQ4 Z;  2OTJ Z;  1K9M 2;  1WCM I;  3J81 b;  3S1M I;  2E9H A;  2R92 I;  4MD9 A;  1VQL Z;  4DK1 A;  1YJN Z;  1VQK 1;  4RVG A;  3KIH A;  2OTL 1;  1YJW 1;  1NJI 1;  4E2X A;  4A93 I;  3CCE Z;  4HGY A;  1N8R 2;  2HF1 A;  5FLX f;  3GTJ I;  2OOY B;  2DE7 A;  3M4O I;  2NVT I;  2KI7 B;  2G2K A;  1M1K 1;  2QA4 1;  3I07 A;  3CCM Z;  5IT9 b;  1Z02 A;  2GTH A;  4NBH A;  2RBL A;  1ZB8 A;  3GTG I;  2RIQ A;  3NFZ A;  1USP B;  2NVY I;  3CC4 Z;  2RHB A;  2JA7 I;  1QVG Z;  1R9T I;  3CCV Z;  1DL6 A;  3CME Z;  4BXX I;  3CCJ 1;  3OW2 Z;  3D6W A;  2W03 A;  1P9N A;  2WB1 A;  2E2H I;  4CL1 A;  4EWC A;  2E2J I;  2JR6 A;  1KRL A;  1VQ5 1;  4A3D I;  3CD6 1;  3IF8 A;  2EGT A;  3RZO I;  3K7A I;  4A3E I;  3CCU 1;  5C4J I;  4BY7 I;  1RO0 A;  3G6E 1;  1YJ9 Z;  1TFI A;  4X6A I;  2DE6 A;  3HOX I;  3F3F C;  3H3V J;  3CQZ I;  1M90 2;  2QRC B;  5T64 A;  4A3K I;  5A2Q b;  2P28 A;  2QEX 1;  1YUK A;  5T6B A;  1NP6 A;  2BJO A;  3JAM b;  1QVF Y;  1Q86 2;  1K73 1;  1VQ6 Z;  1WW9 A;  4A3C I;  3MZK B;  4A3G I;  1Y1W I;  1X0T A;  3I55 1;  3S2H I;  3CC7 1;  4NFR A;  2R6M A;  3GTM I;  2HU9 A;  1JWH C;  1YI2 1;  2ZAE B;  4NBD A;  4MH4 A;  3OW2 Y;  1I50 I;  2RT9 A;  1W2B Y;  1Q82 1;  3F3P C;  1M1K 2;  3J80 f;  2R93 I;  2IZ4 A;  2KPI A;  4DQY B;  2I3C A;  5CM2 M;  3CCL Z;  4A3L I;  3GTQ I;  1Y1V S;  3G4S 1;  4E30 A;  2OZK A;  1VQO 1;  1TWH I;  3S15 I;  2JA5 I;  5D1P A;  1LQL A;  4NBA A;  3GTL I;  1VQN 1;  4NOZ A;  1NUI A;  1VQM Z;  4Y7N I;  3HOZ I;  5D1O B;  1YHQ Z;  4RVD A;  5FLX b;  1Q7Y 1;  2H85 A;  3GTP I;  3NH5 A;  1USP A;  3BG1 B;  1VQ5 Z;  1Y1V I;  3CMA 1;  3GCF A;  1KC8 1;  4RVH A;  1YIT Z;  1VQ7 1;  3CC2 Z;  5C4X I;  4RVF A;  3G6E Z;  2YAD A;  3HOV I;  3GKQ A;  4E31 A;  2QRE B;  1YIJ Z;  3EED A;  2JS4 A;  3Q87 A;  3NH8 A;  3CCR 1;  3S1R I;  2Y0S A;  3I56 1;  3CCQ 1;  1KD1 1;  3G71 1;  1ML8 A;  1RO2 A;  2RPR A;  2QKD A;  1K9M 1;  5IT9 f;  1YUA A;  5FLM I;  3CPW Z;  1VQ4 1;  2P3Y A;  1K73 2;  4NH1 C;  3CCS 1;  1VQ9 1;  2NVX I;  2OTJ 1;  1VQ8 Z;  3TE5 B;  1TWG I;  4HGZ A;  4Y52 I;  1YJN 1;  2QR1 B;  1S72 Z;  1RQF A;  4A3J I;  1ZH1 A;  4DGL A;  4E33 A;  1TWA I;  1RNI A;  1K8A 2;  2K5R A;  4A3I I;  4MXU A;  3CCE 1;  2JNY A;  1VQK Z;  2OOX B;  3MZL B;  4MON A;  2PM9 A;  2JUB A;  3S14 I;  2OTL Z;  1VQN Z;  1YJW Z;  3S2D I;  1PFT A;  2R7Z I;  3S1N I;  2Q4Z A;  2IZ3 A;  3CCM 1;  2Q51 A;  1Q81 1;  3GTO I;  5C3E I;  3J7A 4;  3PO2 I;  1TWF I;  3VTN A;  2QRD B;  1NJI 2;  1QVG Y;  2QA4 Z;  4QTT A;  3CC4 1;  1RO4 A;  2J6A A;  1I6H I;  1SFO I;  3NH4 A;  5C44 I;  3J80 b;  2V8I A;  3CCV 1;  3ESW A;  3CPW Y;  4NBG A;  1ZB9 A;  4E2Z A;  3CME 1;  5D1O A;  3S1Q I;  1QF8 A;  3CCR Z;  3TDH B;  4E2Y A;  3VMG A;  3FQQ A;  1X3W A;  3VB9 A;  3IFU A;  1JJ2 Z;  5IP7 I;  1WII A;  3CCJ Z;  4NBE A;  2NVQ I;  3HOU I;  4E32 A;  2W04 A;  2YU9 I;  4QTU A;  3IX0 A;  1M90 1;  1TWC I;  3VMH A;  2V8K A;  3CCS Z;  1VQ9 Z;  1YJ9 1;  4NBB A;  2LFU A;  4TNU A;  3J81 f;  3CD6 Z;  1Q86 1;  2JMO A;  2O4H A;  3T4N B;  4RS4 A;  4RV9 A;  3CCU Z;  4NB8 A;  4E2W A;  2V8J A;  1VQ6 1;  2LIY A;  3FQM A;  1VQP 1;  3BG0 B;  2E2I I;  3I4N I;  3FKI I;  2F4O A;  3NDI A;  2O53 A;  2QEX Z;  4NBF A;  4BY1 I;  4AYB A;  3U50 C;  3HKZ A;  5IP9 I;  1Z01 A;  3M3Y I;  1X3Z A;  2VF1 A;  3I55 Z;  3CC7 Z;  3P5J B;  1QVF Z;  4MD7 A;  3CXC Z;  2DE5 A;  1YI2 Z;  1Q81 2;  2JA6 I;  4A3M I;  3CCL 1;  1JJ2 Y;  1KQS Z;  3H0G I;  1K83 I;  3RZD I;  3S16 I;  2PK7 A;  1VQL 1;  2F4M A;  4MD8 A;  1N8R 1;  3KIF A;  1W2B Z;  1Q82 2;  2AKL A;  1VQM 1;  3G4S Z;  2GTI A;  1YHQ 1;  1VQO Z;  4A3B I;  2WAQ A;  5AN9 F;  2JA8 I;  2M48 A;  3HOW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...