3GTJI

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna-rna hybrid
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI02
1Y1VS 3M4OI 2NVYI 4A3GI 4Y7NI 2JA5I 3I4NI 3S1MI 1I3QI 3GCFA 4NBCA 3GTLI 1VLAA 4A93I 1SFOI 4A3BI 1NUIA 3GTJI 2PK7A 2J6AA 3H0GI 4A3CI 2JNYA 3S15I 3PO3S 4BY1I 3U50C 3GTMI 2DE5A 5C4JI 1TWCI 3I4MI 3VMHA 5IP7I 3GTKI 5IP9I 3S1NI 4BXXI 1YUAA 5FLMI 3PO2I 4MH4A 3CQZI 1TWFI 1ZB8A 4X6AI 5C4XI 1ML8A 2BJOA 1N2FA 3D6WA 2F4MA 4NBAA 4BY7I 3VB9A 2E2HI 3S1QI 3HOXI 3GTGI 3S17I 4NOZA 4A3II 5C3EI 4NBEA 3Q87A 5C44I 2YU9I 2KPIA 1L1OC 3S2HI 1Y1VI 3HOVI 2NVXI 4NB9A 4A3DI 3H3VJ 3PO3I 4NBBA 1R9TI 3FKII 3M3YI 3HOWI 1WW9A 3S2DI 1X3ZA 2F4OA 4QTTA 2DE6A 3K7AI 4NBDA 3GTOI 2JA7I 3GTMS 2AKLA 1USPA 1USPB 4Y52I 4A3EI 2E2II 2P3YA 1RO4A 1TWGI 1DL6A 1Y1WI 3I07A 3S1RI 3RZDI 4A3JI 4BBSI 2NVQI 2HF1A 2R7ZI 1TWAI 3HOZI 3VMIA 3HOUI 3RZOI 4NBHA 4QTUA 1I6HI 3GKQA 3S14I 1TFIA 1QYPA 2K5RA 1TWHI 3LUSA 4A3KI 1WCMI 3GTPI 4NB8A 4A3FI 2RBLA 2JR6A 4A3MI 3VMGA 2DE7A 2R93I 1LQLA 3HOYI 2JA6I 1X3WA 3S16I 4A3LI 1ZB9A 2JA8I 4NBGA 4NBFA 1K83I 4XX2A 4BBRI 2E2JI 3GTQI 2R92I 2NVTI 1I50I 3EERA 1RLYA 1PFTA 2JS4A 2B63I 2VUMI 5CM2M 3ESWA
chains in the Genus database with same CATH superfamily
5A2Qb 3IX0A 1SIWA 2NVYI 1YJ91 1QVGY 1YJ9Z 1VQLZ 2JA5I 3CC4Z 3GTLI 2GU2A 3TDHB 4A3BI 1VQMZ 1K8A2 3S15I 4BY1I 4E2WA 3GTMI 4MD9A 2DE5A 5C4JI 2QA41 1YI21 4AYBA 2QA4Z 3GTKI 1K8A1 3S1NI 3PO2I 1NJI2 4BXXI 1TWFI 3CCS1 3I551 3CCSZ 4RS4A 2V3VA 1N2FA 2VUGA 3D6WA 3VB9A 2E2HI 2QREB 3HOXI 2JIQA 3D9XA 1NJI1 3S17I 4NOZA 3G4S1 4A3II 1S7MA 2VPWA 1VQ91 2OZKA 4TNUA 3F3PC 3OW2Z 5LL6f 4NBBA 1X0TA 5IT9b 1YJN1 1Q862 3K7AI 3GTOI 5D1OB 1YHQZ 1USPA 2E9HA 4Y52I 2WB1A 2VPXA 1RO4A 3FQMA 3CC21 2O53A 1Q861 3S1RI 3RZDI 2QKDA 4A3JI 2JIRA 4BBSI 4E31A 2NVQI 2HF1A 2WAQA 2R7ZI 3CCR1 3VMIA 3CXCZ 3RZOI 2OTJZ 1KRLA 4MD7A 3GKQA 2LFUA 1TFIA 1KD12 1VQPZ 4A3KI 3GTPI 5D1OA 2GTIA 5FLXf 2R93I 3I561 1LQLA 2G2KA 2RHBA 1KD11 2Y0SA 1M1K1 2JA8I 4NBFA 1NP6A 2I3CA 4BBRI 2OOXB 3TE5B 2E2JI 2R92I 2V8JA 4MD8A 4E2ZA 1PFTA 2QLVB 1KC82 3G711 4RV9A 3S1MI 3GCFA 4NBCA 1VQ8Z 1SFOI 3H0GI 2JNYA 4S1TA 3CMAZ 3T4NB 3U50C 2JMOA 3JAMf 3CC71 2IZ3A 2V8KA 5IP9I 3G6E1 2IV2X 4EWCA 1ZB8A 4X6AI 3IFUA 2PMZA 1ML8A 2YADA 2BJOA 2IZ4A 2NAPA 5C44I 4RVGA 3HOVI 2NVXI 5T67A 4A3DI 1YI2Z 1Q821 5FLXb 1Q812 2M6NA 2W03A 1WW9A 3S2DI 2F4OA 4QTTA 3I55Z 3GTMS 4NBDA 2E7ZA 3F3FC 1YJW1 1USPB 4NFRA 3J81f 4A3EI 1Q811 1S721 1YIJ1 1VQ71 1YIJZ 3G4SZ 3CME1 3BG1B 3CMEZ 1Z02A 3I07A 1Q7Y2 3FQQA 1QXFA 1VQ9Z 2H85A 3CCQ1 4MXUA 3CCQZ 1WIIA 2GTHA 1JWHC 3HOUI 3J80f 3OW2Y 1I6HI 2JIOA 1Q7Y1 3HKZA 1TWHI 1YJNZ 3BG0B 3JAMb 1N8R2 2RBLA 4RVFA 1VQN1 1VQ41 1VQO1 3CC2Z 1X3WA 3CCM1 2PM9A 1ZB9A 3CCL1 2R6MA 1N8R1 3CCLZ 3EEDA 1VQK1 1K83I 2JUBA 2Q51A 3CCRZ 3CD61 1RLYA 2B63I 3CXCY 5CM2M 3ESWA 1Y1VS 1M1K2 2V45A 4A3GI 4Y7NI 3I4NI 4A93I 5T6BA 2O4HA 1NUIA 2QEX1 3I56Z 1K731 3PO3S 1FDIA 5A2Qf 5T64A 3I4MI 4CL1A 2LIYA 3VMHA 5AN9F 4HGZA 3J81b 3NFZA 5FLMI 4MH4A 2HU9A 3CCU1 4E2YA 2AYDA 2EGTA 3G71Z 3S1QI 2OTL1 3GTGI 2OTLZ 1P9NA 5C3EI 4NBEA 3Q87A 2VPYA 3J7A4 1RQFA 1L1OC 2KPIA 3S2HI 1YUKA 1Z01A 3NDIA 3CC7Z 1FDOA 3G6EZ 1RNIA 1WZNA 3M3YI 2LEXA 1Q16A 3CCE1 2E2II 1W2BZ 3NH4A 1Q822 1TWGI 1DL6A 1Y1WI 3CCV1 1VQ61 1TWAI 3CCJ1 3NH8A 4MRIA 1VQ51 4QTUA 3D2LA 3MZKB 3IF8A 1VQL1 4NB8A 4A3FI 2JR6A 3CC41 1VQM1 4A3MI 1YJWZ 2QRCB 2DE7A 4HGYA 3NDJA 1S72Z 2JA6I 1VQ7Z 2K3RA 3S16I 3VTNA 2RIQA 2QR1B 1RO0A 4XX2A 2W04A 3IR7A 1M902 1WJ2A 3GTQI 2M48A 2JIMA 3EERA 2JS4A 3M4OI 1M901 1I3QI 1QF8A 1VLAA 2VPZA 2PK7A 2J6AA 3GTJI 1VQNZ 4A3CI 5D1PA 1VQ4Z 3KIHA 1VQOZ 4E32A 3CCMZ 2QRDB 1VQKZ 1TWCI 5IP7I 1YUAA 3CQZI 3CD6Z 5C4XI 1K732 4DGLA 1YHQ1 4DK1A 2F4MA 1YIT1 4NBAA 4BY7I 1YITZ 1QVFZ 2YU9I 1Z03A 1Y1VI 1JJ2Z 2QEXZ 1QVFY 1JJ2Y 4E33A 4NB9A 3MONA 1ZH1A 3H3VJ 2ZAEB 2OTJ1 3PO3I 1R9TI 3FKII 1VQP1 4E30A 3HOWI 1X3ZA 3CCUZ 2DE6A 1Y8CA 2OOYB 4RVDA 2JA7I 1K9M2 2RT9A 2AKLA 2P3YA 4NH1C 4MONA 2Q4ZA 2V8IA 3J80b 2P28A 1K9M1 3P5JB 3MZLB 3QWUA 3HOZI 4DQYB 2RPRA 4NBHA 4HH4A 1AA6A 3S14I 1QYPA 2K5RA 3LUSA 1WCMI 3CCEZ 1VQ81 1KQSZ 3VMGA 1KQSY 5IT9f 3CMA1 3HOYI 3CPWZ 1KC81 4A3LI 1W2BY 4NBGA 3CPWY 3CCVZ 2KI7B 4E2XA 1RO2A 3NH5A 2VF1A 1VQ6Z 2JIPA 3KIFA 3CCJZ 2NVTI 1I50I 1VQ5Z 4RVHA 1QVGZ 2VUMI
chains in the Genus database with same CATH topology
5A2Qb 3IX0A 2NVYI 1YJ91 1QVGY 1YJ9Z 1VQLZ 2JA5I 3CC4Z 3GTLI 2GU2A 3TDHB 4A3BI 1VQMZ 1K8A2 3S15I 4BY1I 4E2WA 3GTMI 4MD9A 2DE5A 5C4JI 2QA41 1YI21 4AYBA 2QA4Z 3GTKI 1K8A1 3S1NI 3PO2I 1NJI2 4BXXI 1TWFI 3CCS1 3I551 3CCSZ 4RS4A 1N2FA 2VUGA 3D6WA 3VB9A 2E2HI 2QREB 3HOXI 3D9XA 1NJI1 3S17I 4NOZA 3G4S1 4A3II 1S7MA 1VQ91 2OZKA 4TNUA 3F3PC 3OW2Z 5LL6f 4NBBA 1X0TA 5IT9b 1YJN1 1Q862 3K7AI 3GTOI 5D1OB 1YHQZ 1USPA 2E9HA 4Y52I 2WB1A 1RO4A 3FQMA 3CC21 2O53A 1Q861 3S1RI 3RZDI 2QKDA 4A3JI 4BBSI 4E31A 2NVQI 2HF1A 2WAQA 2R7ZI 3CCR1 3VMIA 3CXCZ 3RZOI 2OTJZ 1KRLA 4MD7A 3GKQA 2LFUA 1TFIA 1KD12 1VQPZ 4A3KI 3GTPI 5D1OA 2GTIA 5FLXf 2R93I 3I561 1LQLA 2G2KA 2RHBA 1KD11 2Y0SA 1M1K1 2JA8I 4NBFA 1NP6A 2I3CA 4BBRI 2OOXB 3TE5B 2E2JI 2R92I 2V8JA 4MD8A 4E2ZA 1PFTA 2QLVB 1KC82 3G711 4RV9A 3S1MI 3GCFA 4NBCA 1VQ8Z 1SFOI 3H0GI 2JNYA 4S1TA 3CMAZ 3T4NB 3U50C 2JMOA 3JAMf 3CC71 2IZ3A 2V8KA 5IP9I 3G6E1 4EWCA 1ZB8A 4X6AI 3IFUA 2PMZA 1ML8A 2YADA 2BJOA 2IZ4A 5C44I 4RVGA 3HOVI 2NVXI 5T67A 4A3DI 1YI2Z 1Q821 5FLXb 1Q812 2M6NA 2W03A 1WW9A 3S2DI 2F4OA 4QTTA 3I55Z 3GTMS 4NBDA 3F3FC 1YJW1 1USPB 4NFRA 3J81f 4A3EI 1Q811 1S721 1YIJ1 1VQ71 1YIJZ 3G4SZ 3CME1 3BG1B 3CMEZ 1Z02A 3I07A 1Q7Y2 3FQQA 1VQ9Z 2H85A 3CCQ1 4MXUA 3CCQZ 1WIIA 2GTHA 1JWHC 3HOUI 3J80f 3OW2Y 1I6HI 1Q7Y1 3HKZA 1TWHI 1YJNZ 3BG0B 3JAMb 1N8R2 2RBLA 4RVFA 1VQN1 1VQ41 1VQO1 3CC2Z 1X3WA 3CCM1 2PM9A 1ZB9A 3CCL1 2R6MA 1N8R1 3CCLZ 3EEDA 1VQK1 1K83I 2JUBA 2Q51A 3CCRZ 3CD61 1RLYA 2B63I 3CXCY 5CM2M 3ESWA 1Y1VS 1M1K2 4A3GI 4Y7NI 3I4NI 4A93I 5T6BA 2O4HA 1NUIA 2QEX1 3I56Z 1K731 3PO3S 5A2Qf 5T64A 3I4MI 4CL1A 2LIYA 3VMHA 5AN9F 4HGZA 3J81b 3NFZA 5FLMI 4MH4A 2HU9A 3CCU1 4E2YA 2EGTA 3G71Z 3S1QI 2OTL1 3GTGI 2OTLZ 1P9NA 5C3EI 4NBEA 3Q87A 3J7A4 1RQFA 1L1OC 2KPIA 3S2HI 1YUKA 1Z01A 3NDIA 3CC7Z 3G6EZ 1RNIA 3M3YI 3CCE1 2E2II 1W2BZ 3NH4A 1Q822 1TWGI 1DL6A 1Y1WI 3CCV1 1VQ61 1TWAI 3CCJ1 3NH8A 4MRIA 1VQ51 4QTUA 3MZKB 3IF8A 1VQL1 4NB8A 4A3FI 2JR6A 3CC41 1VQM1 4A3MI 1YJWZ 2QRCB 2DE7A 4HGYA 3NDJA 1S72Z 2JA6I 1VQ7Z 2K3RA 3S16I 3VTNA 2RIQA 2QR1B 1RO0A 4XX2A 2W04A 1M902 3GTQI 2M48A 3EERA 2JS4A 3M4OI 1M901 1I3QI 1QF8A 1VLAA 3GTJI 2PK7A 2J6AA 1VQNZ 4A3CI 5D1PA 1VQ4Z 3KIHA 1VQOZ 4E32A 3CCMZ 2QRDB 1VQKZ 1TWCI 5IP7I 1YUAA 3CQZI 3CD6Z 5C4XI 1K732 4DGLA 1YHQ1 4DK1A 2F4MA 1YIT1 4NBAA 4BY7I 1YITZ 1QVFZ 2YU9I 1Z03A 1Y1VI 1JJ2Z 2QEXZ 1QVFY 1JJ2Y 4E33A 4NB9A 3MONA 1ZH1A 3H3VJ 2ZAEB 2OTJ1 3PO3I 1R9TI 3FKII 1VQP1 4E30A 3HOWI 1X3ZA 3CCUZ 2DE6A 2OOYB 4RVDA 2JA7I 1K9M2 2RT9A 2AKLA 2P3YA 4NH1C 4MONA 2Q4ZA 2V8IA 3J80b 2P28A 1K9M1 3P5JB 3MZLB 3QWUA 3HOZI 4DQYB 2RPRA 4NBHA 4HH4A 3S14I 1QYPA 2K5RA 3LUSA 1WCMI 3CCEZ 1VQ81 1KQSZ 3VMGA 1KQSY 5IT9f 3CMA1 3HOYI 3CPWZ 1KC81 4A3LI 1W2BY 4NBGA 3CPWY 3CCVZ 2KI7B 4E2XA 1RO2A 3NH5A 2VF1A 1VQ6Z 3KIFA 3CCJZ 2NVTI 1I50I 1VQ5Z 4RVHA 1QVGZ 2VUMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V S;  3M4O I;  2NVY I;  4A3G I;  4Y7N I;  2JA5 I;  3I4N I;  3S1M I;  1I3Q I;  3GCF A;  4NBC A;  3GTL I;  1VLA A;  4A93 I;  1SFO I;  4A3B I;  1NUI A;  3GTJ I;  2PK7 A;  2J6A A;  3H0G I;  4A3C I;  2JNY A;  3S15 I;  3PO3 S;  4BY1 I;  3U50 C;  3GTM I;  2DE5 A;  5C4J I;  1TWC I;  3I4M I;  3VMH A;  5IP7 I;  3GTK I;  5IP9 I;  3S1N I;  4BXX I;  1YUA A;  5FLM I;  3PO2 I;  4MH4 A;  3CQZ I;  1TWF I;  1ZB8 A;  4X6A I;  5C4X I;  1ML8 A;  2BJO A;  1N2F A;  3D6W A;  2F4M A;  4NBA A;  4BY7 I;  3VB9 A;  2E2H I;  3S1Q I;  3HOX I;  3GTG I;  3S17 I;  4NOZ A;  4A3I I;  5C3E I;  4NBE A;  3Q87 A;  5C44 I;  2YU9 I;  2KPI A;  1L1O C;  3S2H I;  1Y1V I;  3HOV I;  2NVX I;  4NB9 A;  4A3D I;  3H3V J;  3PO3 I;  4NBB A;  1R9T I;  3FKI I;  3M3Y I;  3HOW I;  1WW9 A;  3S2D I;  1X3Z A;  2F4O A;  4QTT A;  2DE6 A;  3K7A I;  4NBD A;  3GTO I;  2JA7 I;  3GTM S;  2AKL A;  1USP A;  1USP B;  4Y52 I;  4A3E I;  2E2I I;  2P3Y A;  1RO4 A;  1TWG I;  1DL6 A;  1Y1W I;  3I07 A;  3S1R I;  3RZD I;  4A3J I;  4BBS I;  2NVQ I;  2HF1 A;  2R7Z I;  1TWA I;  3HOZ I;  3VMI A;  3HOU I;  3RZO I;  4NBH A;  4QTU A;  1I6H I;  3GKQ A;  3S14 I;  1TFI A;  1QYP A;  2K5R A;  1TWH I;  3LUS A;  4A3K I;  1WCM I;  3GTP I;  4NB8 A;  4A3F I;  2RBL A;  2JR6 A;  4A3M I;  3VMG A;  2DE7 A;  2R93 I;  1LQL A;  3HOY I;  2JA6 I;  1X3W A;  3S16 I;  4A3L I;  1ZB9 A;  2JA8 I;  4NBG A;  4NBF A;  1K83 I;  4XX2 A;  4BBR I;  2E2J I;  3GTQ I;  2R92 I;  2NVT I;  1I50 I;  3EER A;  1RLY A;  1PFT A;  2JS4 A;  2B63 I;  2VUM I;  5CM2 M;  3ESW A; 
#chains in the Genus database with same CATH topology
 5A2Q b;  3IX0 A;  1SIW A;  2NVY I;  1YJ9 1;  1QVG Y;  1YJ9 Z;  1VQL Z;  2JA5 I;  3CC4 Z;  3GTL I;  2GU2 A;  3TDH B;  4A3B I;  1VQM Z;  1K8A 2;  3S15 I;  4BY1 I;  4E2W A;  3GTM I;  4MD9 A;  2DE5 A;  5C4J I;  2QA4 1;  1YI2 1;  4AYB A;  2QA4 Z;  3GTK I;  1K8A 1;  3S1N I;  3PO2 I;  1NJI 2;  4BXX I;  1TWF I;  3CCS 1;  3I55 1;  3CCS Z;  4RS4 A;  2V3V A;  1N2F A;  2VUG A;  3D6W A;  3VB9 A;  2E2H I;  2QRE B;  3HOX I;  2JIQ A;  3D9X A;  1NJI 1;  3S17 I;  4NOZ A;  3G4S 1;  4A3I I;  1S7M A;  2VPW A;  1VQ9 1;  2OZK A;  4TNU A;  3F3P C;  3OW2 Z;  5LL6 f;  4NBB A;  1X0T A;  5IT9 b;  1YJN 1;  1Q86 2;  3K7A I;  3GTO I;  5D1O B;  1YHQ Z;  1USP A;  2E9H A;  4Y52 I;  2WB1 A;  2VPX A;  1RO4 A;  3FQM A;  3CC2 1;  2O53 A;  1Q86 1;  3S1R I;  3RZD I;  2QKD A;  4A3J I;  2JIR A;  4BBS I;  4E31 A;  2NVQ I;  2HF1 A;  2WAQ A;  2R7Z I;  3CCR 1;  3VMI A;  3CXC Z;  3RZO I;  2OTJ Z;  1KRL A;  4MD7 A;  3GKQ A;  2LFU A;  1TFI A;  1KD1 2;  1VQP Z;  4A3K I;  3GTP I;  5D1O A;  2GTI A;  5FLX f;  2R93 I;  3I56 1;  1LQL A;  2G2K A;  2RHB A;  1KD1 1;  2Y0S A;  1M1K 1;  2JA8 I;  4NBF A;  1NP6 A;  2I3C A;  4BBR I;  2OOX B;  3TE5 B;  2E2J I;  2R92 I;  2V8J A;  4MD8 A;  4E2Z A;  1PFT A;  2QLV B;  1KC8 2;  3G71 1;  4RV9 A;  3S1M I;  3GCF A;  4NBC A;  1VQ8 Z;  1SFO I;  3H0G I;  2JNY A;  4S1T A;  3CMA Z;  3T4N B;  3U50 C;  2JMO A;  3JAM f;  3CC7 1;  2IZ3 A;  2V8K A;  5IP9 I;  3G6E 1;  2IV2 X;  4EWC A;  1ZB8 A;  4X6A I;  3IFU A;  2PMZ A;  1ML8 A;  2YAD A;  2BJO A;  2IZ4 A;  2NAP A;  5C44 I;  4RVG A;  3HOV I;  2NVX I;  5T67 A;  4A3D I;  1YI2 Z;  1Q82 1;  5FLX b;  1Q81 2;  2M6N A;  2W03 A;  1WW9 A;  3S2D I;  2F4O A;  4QTT A;  3I55 Z;  3GTM S;  4NBD A;  2E7Z A;  3F3F C;  1YJW 1;  1USP B;  4NFR A;  3J81 f;  4A3E I;  1Q81 1;  1S72 1;  1YIJ 1;  1VQ7 1;  1YIJ Z;  3G4S Z;  3CME 1;  3BG1 B;  3CME Z;  1Z02 A;  3I07 A;  1Q7Y 2;  3FQQ A;  1QXF A;  1VQ9 Z;  2H85 A;  3CCQ 1;  4MXU A;  3CCQ Z;  1WII A;  2GTH A;  1JWH C;  3HOU I;  3J80 f;  3OW2 Y;  1I6H I;  2JIO A;  1Q7Y 1;  3HKZ A;  1TWH I;  1YJN Z;  3BG0 B;  3JAM b;  1N8R 2;  2RBL A;  4RVF A;  1VQN 1;  1VQ4 1;  1VQO 1;  3CC2 Z;  1X3W A;  3CCM 1;  2PM9 A;  1ZB9 A;  3CCL 1;  2R6M A;  1N8R 1;  3CCL Z;  3EED A;  1VQK 1;  1K83 I;  2JUB A;  2Q51 A;  3CCR Z;  3CD6 1;  1RLY A;  2B63 I;  3CXC Y;  5CM2 M;  3ESW A;  1Y1V S;  1M1K 2;  2V45 A;  4A3G I;  4Y7N I;  3I4N I;  4A93 I;  5T6B A;  2O4H A;  1NUI A;  2QEX 1;  3I56 Z;  1K73 1;  3PO3 S;  1FDI A;  5A2Q f;  5T64 A;  3I4M I;  4CL1 A;  2LIY A;  3VMH A;  5AN9 F;  4HGZ A;  3J81 b;  3NFZ A;  5FLM I;  4MH4 A;  2HU9 A;  3CCU 1;  4E2Y A;  2AYD A;  2EGT A;  3G71 Z;  3S1Q I;  2OTL 1;  3GTG I;  2OTL Z;  1P9N A;  5C3E I;  4NBE A;  3Q87 A;  2VPY A;  3J7A 4;  1RQF A;  1L1O C;  2KPI A;  3S2H I;  1YUK A;  1Z01 A;  3NDI A;  3CC7 Z;  1FDO A;  3G6E Z;  1RNI A;  1WZN A;  3M3Y I;  2LEX A;  1Q16 A;  3CCE 1;  2E2I I;  1W2B Z;  3NH4 A;  1Q82 2;  1TWG I;  1DL6 A;  1Y1W I;  3CCV 1;  1VQ6 1;  1TWA I;  3CCJ 1;  3NH8 A;  4MRI A;  1VQ5 1;  4QTU A;  3D2L A;  3MZK B;  3IF8 A;  1VQL 1;  4NB8 A;  4A3F I;  2JR6 A;  3CC4 1;  1VQM 1;  4A3M I;  1YJW Z;  2QRC B;  2DE7 A;  4HGY A;  3NDJ A;  1S72 Z;  2JA6 I;  1VQ7 Z;  2K3R A;  3S16 I;  3VTN A;  2RIQ A;  2QR1 B;  1RO0 A;  4XX2 A;  2W04 A;  3IR7 A;  1M90 2;  1WJ2 A;  3GTQ I;  2M48 A;  2JIM A;  3EER A;  2JS4 A;  3M4O I;  1M90 1;  1I3Q I;  1QF8 A;  1VLA A;  2VPZ A;  2PK7 A;  2J6A A;  3GTJ I;  1VQN Z;  4A3C I;  5D1P A;  1VQ4 Z;  3KIH A;  1VQO Z;  4E32 A;  3CCM Z;  2QRD B;  1VQK Z;  1TWC I;  5IP7 I;  1YUA A;  3CQZ I;  3CD6 Z;  5C4X I;  1K73 2;  4DGL A;  1YHQ 1;  4DK1 A;  2F4M A;  1YIT 1;  4NBA A;  4BY7 I;  1YIT Z;  1QVF Z;  2YU9 I;  1Z03 A;  1Y1V I;  1JJ2 Z;  2QEX Z;  1QVF Y;  1JJ2 Y;  4E33 A;  4NB9 A;  3MON A;  1ZH1 A;  3H3V J;  2ZAE B;  2OTJ 1;  3PO3 I;  1R9T I;  3FKI I;  1VQP 1;  4E30 A;  3HOW I;  1X3Z A;  3CCU Z;  2DE6 A;  1Y8C A;  2OOY B;  4RVD A;  2JA7 I;  1K9M 2;  2RT9 A;  2AKL A;  2P3Y A;  4NH1 C;  4MON A;  2Q4Z A;  2V8I A;  3J80 b;  2P28 A;  1K9M 1;  3P5J B;  3MZL B;  3QWU A;  3HOZ I;  4DQY B;  2RPR A;  4NBH A;  4HH4 A;  1AA6 A;  3S14 I;  1QYP A;  2K5R A;  3LUS A;  1WCM I;  3CCE Z;  1VQ8 1;  1KQS Z;  3VMG A;  1KQS Y;  5IT9 f;  3CMA 1;  3HOY I;  3CPW Z;  1KC8 1;  4A3L I;  1W2B Y;  4NBG A;  3CPW Y;  3CCV Z;  2KI7 B;  4E2X A;  1RO2 A;  3NH5 A;  2VF1 A;  1VQ6 Z;  2JIP A;  3KIF A;  3CCJ Z;  2NVT I;  1I50 I;  1VQ5 Z;  4RVH A;  1QVG Z;  2VUM I; 
#chains in the Genus database with same CATH homology
 5A2Q b;  3IX0 A;  2NVY I;  1YJ9 1;  1QVG Y;  1YJ9 Z;  1VQL Z;  2JA5 I;  3CC4 Z;  3GTL I;  2GU2 A;  3TDH B;  4A3B I;  1VQM Z;  1K8A 2;  3S15 I;  4BY1 I;  4E2W A;  3GTM I;  4MD9 A;  2DE5 A;  5C4J I;  2QA4 1;  1YI2 1;  4AYB A;  2QA4 Z;  3GTK I;  1K8A 1;  3S1N I;  3PO2 I;  1NJI 2;  4BXX I;  1TWF I;  3CCS 1;  3I55 1;  3CCS Z;  4RS4 A;  1N2F A;  2VUG A;  3D6W A;  3VB9 A;  2E2H I;  2QRE B;  3HOX I;  3D9X A;  1NJI 1;  3S17 I;  4NOZ A;  3G4S 1;  4A3I I;  1S7M A;  1VQ9 1;  2OZK A;  4TNU A;  3F3P C;  3OW2 Z;  5LL6 f;  4NBB A;  1X0T A;  5IT9 b;  1YJN 1;  1Q86 2;  3K7A I;  3GTO I;  5D1O B;  1YHQ Z;  1USP A;  2E9H A;  4Y52 I;  2WB1 A;  1RO4 A;  3FQM A;  3CC2 1;  2O53 A;  1Q86 1;  3S1R I;  3RZD I;  2QKD A;  4A3J I;  4BBS I;  4E31 A;  2NVQ I;  2HF1 A;  2WAQ A;  2R7Z I;  3CCR 1;  3VMI A;  3CXC Z;  3RZO I;  2OTJ Z;  1KRL A;  4MD7 A;  3GKQ A;  2LFU A;  1TFI A;  1KD1 2;  1VQP Z;  4A3K I;  3GTP I;  5D1O A;  2GTI A;  5FLX f;  2R93 I;  3I56 1;  1LQL A;  2G2K A;  2RHB A;  1KD1 1;  2Y0S A;  1M1K 1;  2JA8 I;  4NBF A;  1NP6 A;  2I3C A;  4BBR I;  2OOX B;  3TE5 B;  2E2J I;  2R92 I;  2V8J A;  4MD8 A;  4E2Z A;  1PFT A;  2QLV B;  1KC8 2;  3G71 1;  4RV9 A;  3S1M I;  3GCF A;  4NBC A;  1VQ8 Z;  1SFO I;  3H0G I;  2JNY A;  4S1T A;  3CMA Z;  3T4N B;  3U50 C;  2JMO A;  3JAM f;  3CC7 1;  2IZ3 A;  2V8K A;  5IP9 I;  3G6E 1;  4EWC A;  1ZB8 A;  4X6A I;  3IFU A;  2PMZ A;  1ML8 A;  2YAD A;  2BJO A;  2IZ4 A;  5C44 I;  4RVG A;  3HOV I;  2NVX I;  5T67 A;  4A3D I;  1YI2 Z;  1Q82 1;  5FLX b;  1Q81 2;  2M6N A;  2W03 A;  1WW9 A;  3S2D I;  2F4O A;  4QTT A;  3I55 Z;  3GTM S;  4NBD A;  3F3F C;  1YJW 1;  1USP B;  4NFR A;  3J81 f;  4A3E I;  1Q81 1;  1S72 1;  1YIJ 1;  1VQ7 1;  1YIJ Z;  3G4S Z;  3CME 1;  3BG1 B;  3CME Z;  1Z02 A;  3I07 A;  1Q7Y 2;  3FQQ A;  1VQ9 Z;  2H85 A;  3CCQ 1;  4MXU A;  3CCQ Z;  1WII A;  2GTH A;  1JWH C;  3HOU I;  3J80 f;  3OW2 Y;  1I6H I;  1Q7Y 1;  3HKZ A;  1TWH I;  1YJN Z;  3BG0 B;  3JAM b;  1N8R 2;  2RBL A;  4RVF A;  1VQN 1;  1VQ4 1;  1VQO 1;  3CC2 Z;  1X3W A;  3CCM 1;  2PM9 A;  1ZB9 A;  3CCL 1;  2R6M A;  1N8R 1;  3CCL Z;  3EED A;  1VQK 1;  1K83 I;  2JUB A;  2Q51 A;  3CCR Z;  3CD6 1;  1RLY A;  2B63 I;  3CXC Y;  5CM2 M;  3ESW A;  1Y1V S;  1M1K 2;  4A3G I;  4Y7N I;  3I4N I;  4A93 I;  5T6B A;  2O4H A;  1NUI A;  2QEX 1;  3I56 Z;  1K73 1;  3PO3 S;  5A2Q f;  5T64 A;  3I4M I;  4CL1 A;  2LIY A;  3VMH A;  5AN9 F;  4HGZ A;  3J81 b;  3NFZ A;  5FLM I;  4MH4 A;  2HU9 A;  3CCU 1;  4E2Y A;  2EGT A;  3G71 Z;  3S1Q I;  2OTL 1;  3GTG I;  2OTL Z;  1P9N A;  5C3E I;  4NBE A;  3Q87 A;  3J7A 4;  1RQF A;  1L1O C;  2KPI A;  3S2H I;  1YUK A;  1Z01 A;  3NDI A;  3CC7 Z;  3G6E Z;  1RNI A;  3M3Y I;  3CCE 1;  2E2I I;  1W2B Z;  3NH4 A;  1Q82 2;  1TWG I;  1DL6 A;  1Y1W I;  3CCV 1;  1VQ6 1;  1TWA I;  3CCJ 1;  3NH8 A;  4MRI A;  1VQ5 1;  4QTU A;  3MZK B;  3IF8 A;  1VQL 1;  4NB8 A;  4A3F I;  2JR6 A;  3CC4 1;  1VQM 1;  4A3M I;  1YJW Z;  2QRC B;  2DE7 A;  4HGY A;  3NDJ A;  1S72 Z;  2JA6 I;  1VQ7 Z;  2K3R A;  3S16 I;  3VTN A;  2RIQ A;  2QR1 B;  1RO0 A;  4XX2 A;  2W04 A;  1M90 2;  3GTQ I;  2M48 A;  3EER A;  2JS4 A;  3M4O I;  1M90 1;  1I3Q I;  1QF8 A;  1VLA A;  3GTJ I;  2PK7 A;  2J6A A;  1VQN Z;  4A3C I;  5D1P A;  1VQ4 Z;  3KIH A;  1VQO Z;  4E32 A;  3CCM Z;  2QRD B;  1VQK Z;  1TWC I;  5IP7 I;  1YUA A;  3CQZ I;  3CD6 Z;  5C4X I;  1K73 2;  4DGL A;  1YHQ 1;  4DK1 A;  2F4M A;  1YIT 1;  4NBA A;  4BY7 I;  1YIT Z;  1QVF Z;  2YU9 I;  1Z03 A;  1Y1V I;  1JJ2 Z;  2QEX Z;  1QVF Y;  1JJ2 Y;  4E33 A;  4NB9 A;  3MON A;  1ZH1 A;  3H3V J;  2ZAE B;  2OTJ 1;  3PO3 I;  1R9T I;  3FKI I;  1VQP 1;  4E30 A;  3HOW I;  1X3Z A;  3CCU Z;  2DE6 A;  2OOY B;  4RVD A;  2JA7 I;  1K9M 2;  2RT9 A;  2AKL A;  2P3Y A;  4NH1 C;  4MON A;  2Q4Z A;  2V8I A;  3J80 b;  2P28 A;  1K9M 1;  3P5J B;  3MZL B;  3QWU A;  3HOZ I;  4DQY B;  2RPR A;  4NBH A;  4HH4 A;  3S14 I;  1QYP A;  2K5R A;  3LUS A;  1WCM I;  3CCE Z;  1VQ8 1;  1KQS Z;  3VMG A;  1KQS Y;  5IT9 f;  3CMA 1;  3HOY I;  3CPW Z;  1KC8 1;  4A3L I;  1W2B Y;  4NBG A;  3CPW Y;  3CCV Z;  2KI7 B;  4E2X A;  1RO2 A;  3NH5 A;  2VF1 A;  1VQ6 Z;  3KIF A;  3CCJ Z;  2NVT I;  1I50 I;  1VQ5 Z;  4RVH A;  1QVG Z;  2VUM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...