3GTJI

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtjI02
3VMHA 4QTTA 1Y1VS 5C44I 2E2II 3I4MI 3GTMI 2VUMI 2JR6A 2KPIA 3LUSA 3VMIA 2JA7I 2DE7A 3I07A 4X6AI 3S17I 3HOUI 3PO2I 3HOVI 4Y7NI 3I4NI 2RBLA 3D6WA 3GKQA 4A3CI 3EERA 4A93I 3GCFA 1R9TI 1TWCI 4A3GI 2DE6A 2NVQI 2YU9I 3GTOI 1LQLA 1USPA 1WW9A 3S2DI 1X3WA 1USPB 1ZB9A 2F4MA 3GTQI 1YUAA 1N2FA 2JA6I 2JA5I 1TWHI 1I6HI 3S1QI 1Y1WI 2NVTI 4QTUA 4BBSI 3PO3I 4A3DI 4BXXI 1TWAI 3ESWA 5FLMI 5C4XI 2NVYI 3GTJI 4A3II 2R92I 3HOZI 4NB9A 3FKII 3HOWI 3S1MI 1WCMI 2B63I 5C3EI 3RZDI 4NBFA 5C4JI 3HOXI 4A3LI 1X3ZA 4MH4A 2BJOA 4NB8A 1ML8A 2JA8I 4Y52I 3CQZI 1I3QI 1SFOI 1L1OC 3GTPI 1ZB8A 3HOYI 4NBEA 4NBCA 2E2JI 3GTMS 1I50I 4NBAA 2R7ZI 1QYPA 1TWGI 3H3VJ 3S1NI 4XX2A 3VMGA 2E2HI 3Q87A 4NBGA 4A3BI 5IP7I 1RO4A 3K7AI 2NVXI 4NBHA 3S2HI 4A3MI 3GTGI 2JS4A 2PK7A 3M4OI 1Y1VI 4BBRI 4A3JI 2K5RA 2J6AA 2R93I 2P3YA 2AKLA 4BY1I 1VLAA 2JNYA 5CM2M 1DL6A 1TWFI 1K83I 4NBBA 4BY7I 3S1RI 4A3KI 2F4OA 3GTLI 4A3FI 1PFTA 4A3EI 3U50C 5IP9I 3PO3S 1NUIA 3S14I 3S15I 3H0GI 2HF1A 1RLYA 3M3YI 1TFIA 3RZOI 3VB9A 3GTKI 4NBDA 3S16I 4NOZA 2DE5A
chains in the Genus database with same CATH superfamily
2QRDB 3G71Z 2E2II 3OW2Y 2JR6A 2RPRA 3LUSA 2OTLZ 3CC41 3NH5A 4X6AI 4HGYA 1YIJZ 1KC81 3HOUI 3PO2I 3J80b 4A93I 1RO0A 2M48A 2G2KA 2Q4ZA 1YJW1 2NVQI 3GTOI 1USPA 3TE5B 3S2DI 5AN9F 5FLXb 1USPB 1ZB9A 1YUAA 1N2FA 1VQ4Z 2JA5I 2V8JA 2HU9A 1I6HI 1K9M1 1Y1WI 3J81f 2JIQA 3CC4Z 1VQ71 5C4XI 3CCM1 4A3II 1KQSZ 1YJWZ 2P28A 3HOWI 1VQ91 4E30A 1K732 2GTIA 2YADA 5A2Qf 1WZNA 3CC71 3P5JB 3F3FC 3MONA 4Y52I 3CMA1 1L1OC 4NBEA 4NBCA 2E2JI 3GTMS 1I50I 4NBAA 2JIPA 3H3VJ 3S1NI 1RNIA 1VQN1 4A3BI 3CCMZ 2JUBA 1KQSY 4E2XA 2R6MA 1Z01A 1VQ9Z 2VPZA 4A3JI 1Q16A 2VF1A 1M902 4E2YA 2R93I 2JNYA 1VQ51 2I3CA 1Q812 3CC7Z 1NJI2 4BY7I 3IR7A 2W04A 1M1K1 3CMAZ 2PMZA 4A3FI 4TNUA 1Q7Y1 2QKDA 3S14I 1WIIA 3H0GI 1N8R1 3GTKI 3MZKB 1SIWA 3VMHA 1Y1VS 1FDOA 3GTMI 2JIRA 1VQ5Z 2JA7I 3NH8A 2K3RA 4S1TA 2QRCB 1VQK1 3S17I 2V8IA 1QF8A 1P9NA 3GKQA 3EERA 3CCR1 3GCFA 2W03A 2E7ZA 1RO2A 2JA6I 2O4HA 3S1QI 3KIFA 1S7MA 4BXXI 1KD12 1TWAI 3ESWA 1VQKZ 4E2WA 2H85A 2NVYI 2PM9A 3CCRZ 2GTHA 3HOZI 2AYDA 3J80f 3FKII 1WCMI 2B63I 5C3EI 3CCQ1 3BG1B 2LEXA 1Y8CA 1X3ZA 4MH4A 1S721 2EGTA 2VPYA 5FLXf 3EEDA 2JA8I 3G6E1 4MXUA 1SFOI 3CC21 2OOXB 5T64A 1QYPA 4XX2A 3Q87A 4NBGA 3CME1 3CXCZ 2NVXI 4NBHA 3IFUA 2JS4A 2OZKA 1VQO1 5D1PA 3D9XA 3CCQZ 2K5RA 4RVDA 2J6AA 1VLAA 5CM2M 4NBBA 3G6EZ 3S1RI 3CC2Z 3CCJ1 5IT9b 4RV9A 3MZLB 2JMOA 4E2ZA 3U50C 4A3EI 4E31A 1NUIA 1VQ7Z 1K9M2 3CCV1 3CCE1 1Q811 3CXCY 1NP6A 3CMEZ 1NJI1 3M3YI 1YI21 3VB9A 5D1OA 3S16I 1VQOZ 4NOZA 2DE5A 5D1OB 4QTTA 3QWUA 2QA41 1YHQ1 2Y0SA 3I551 2VUMI 2JIOA 2RIQA 1KRLA 2DE7A 3NDJA 3CCJZ 3I07A 3IF8A 1Q822 3HOVI 4Y7NI 2RBLA 1Z02A 1R9TI 1TWCI 5T67A 4A3GI 2KI7B 3CCVZ 3CCEZ 1VQNZ 1LQLA 1X3WA 2QR1B 2RHBA 1VQL1 1VQ81 3FQQA 3GTQI 1K8A1 1YHQZ 2QA4Z 1TWHI 4RVFA 1QVGZ 3F3PC 3I55Z 2V8KA 4NFRA 4QTUA 3D2LA 4BBSI 4A3DI 3CPWZ 4HGZA 5FLMI 2V3VA 3TDHB 1X0TA 3CCL1 1YUKA 2O53A 2R92I 4NB9A 3S1MI 4RVGA 4CL1A 1KD11 1VQLZ 3JAMb 1VQ8Z 4HH4A 4NB8A 1VQP1 1RQFA 1N8R2 4DQYB 3NDIA 3GTPI 1ZB8A 1QVGY 2LIYA 4MD9A 3CPWY 1TWGI 1YJ91 3VMGA 2E2HI 1Q862 5IP7I 4DK1A 3CCLZ 1W2BZ 1YJN1 4A3MI 1QVFZ 2PK7A 3M4OI 1Y1VI 4BBRI 3G4S1 2P3YA 4BY1I 5T6BA 3CCS1 1VQPZ 4A3KI 2F4OA 1PFTA 4MRIA 4RVHA 2M6NA 2RT9A 1YJ9Z 3PO3S 1K731 1JWHC 3BG0B 3S15I 1W2BY 1WJ2A 2IZ4A 4E32A 1YJNZ 1QVFY 2E9HA 1KC82 2OTJ1 3K7AI 2ZAEB 5LL6f 3G4SZ 5C44I 3J81b 3I4MI 3CCSZ 1S72Z 2KPIA 3VMIA 2IV2X 2VPXA 4DGLA 1VQM1 3I4NI 3D6WA 4A3CI 5IT9f 2QLVB 1M901 2DE6A 2YU9I 1WW9A 1FDIA 5A2Qb 2JIMA 3CCU1 2F4MA 1Q821 2OTJZ 1ZH1A 2QEX1 3I561 2NVTI 3PO3I 3IX0A 2IZ3A 1VQMZ 3FQMA 3GTJI 2WB1A 4MD8A 3NFZA 2GU2A 2OOYB 3T4NB 1YI2Z 2LFUA 3RZDI 3CCUZ 1YIT1 1VQ61 4NBFA 5C4JI 3CD61 3HOXI 4A3LI 2BJOA 1ML8A 3KIHA 3CQZI 1I3QI 2VUGA 2QEXZ 3HOYI 3I56Z 3HKZA 2R7ZI 3VTNA 4NH1C 1JJ2Z 1RO4A 4MD7A 1AA6A 3S2HI 1M1K2 3GTGI 3J7A4 2WAQA 1Q7Y2 3G711 1YITZ 1VQ6Z 1Z03A 2QREB 2AKLA 3CD6Z 2Q51A 4RS4A 1DL6A 1TWFI 1K83I 1Q861 3OW2Z 3JAMf 2NAPA 2OTL1 4EWCA 3GTLI 1YIJ1 3NH4A 5IP9I 4MONA 1K8A2 2VPWA 4E33A 1QXFA 1JJ2Y 2HF1A 1RLYA 1TFIA 3RZOI 4NBDA 4AYBA 2V45A 1VQ41
chains in the Genus database with same CATH topology
2QRDB 3G71Z 2E2II 3OW2Y 2JR6A 2RPRA 3LUSA 2OTLZ 3CC41 3NH5A 4X6AI 4HGYA 1YIJZ 1KC81 3HOUI 3PO2I 3J80b 4A93I 1RO0A 2M48A 2G2KA 2Q4ZA 1YJW1 2NVQI 3GTOI 1USPA 3TE5B 3S2DI 5AN9F 5FLXb 1USPB 1ZB9A 1YUAA 1N2FA 1VQ4Z 2JA5I 2V8JA 2HU9A 1I6HI 1K9M1 1Y1WI 3J81f 3CC4Z 1VQ71 5C4XI 3CCM1 4A3II 1KQSZ 1YJWZ 2P28A 3HOWI 1VQ91 4E30A 1K732 2GTIA 2YADA 5A2Qf 3CC71 3P5JB 3F3FC 3MONA 4Y52I 3CMA1 1L1OC 4NBEA 4NBCA 2E2JI 3GTMS 1I50I 4NBAA 3H3VJ 3S1NI 1RNIA 1VQN1 4A3BI 3CCMZ 2JUBA 1KQSY 4E2XA 2R6MA 1Z01A 1VQ9Z 4A3JI 2VF1A 1M902 2R93I 4E2YA 1VQ51 2JNYA 2I3CA 1Q812 3CC7Z 1NJI2 4BY7I 2W04A 1M1K1 3CMAZ 2PMZA 4A3FI 4TNUA 1Q7Y1 2QKDA 3S14I 1WIIA 3H0GI 1N8R1 3GTKI 3MZKB 3VMHA 1Y1VS 3GTMI 1VQ5Z 2JA7I 3NH8A 2K3RA 4S1TA 2QRCB 1VQK1 3S17I 2V8IA 1QF8A 1P9NA 3GKQA 3EERA 3CCR1 3GCFA 2W03A 1RO2A 2JA6I 2O4HA 3S1QI 3KIFA 1S7MA 4BXXI 1KD12 1TWAI 3ESWA 1VQKZ 4E2WA 2H85A 2NVYI 2PM9A 3CCRZ 2GTHA 3HOZI 3J80f 3FKII 1WCMI 2B63I 5C3EI 3CCQ1 3BG1B 1X3ZA 4MH4A 1S721 2EGTA 5FLXf 3EEDA 2JA8I 3G6E1 4MXUA 1SFOI 3CC21 2OOXB 5T64A 1QYPA 4XX2A 3Q87A 4NBGA 3CME1 3CXCZ 2NVXI 4NBHA 3IFUA 2JS4A 2OZKA 1VQO1 5D1PA 3D9XA 3CCQZ 2K5RA 4RVDA 2J6AA 1VLAA 5CM2M 4NBBA 3G6EZ 3S1RI 3CC2Z 3CCJ1 5IT9b 4RV9A 3MZLB 2JMOA 4E2ZA 3U50C 4A3EI 4E31A 1NUIA 1VQ7Z 1K9M2 3CCV1 3CCE1 1Q811 3CXCY 1NP6A 3CMEZ 1NJI1 3M3YI 1YI21 3VB9A 5D1OA 3S16I 1VQOZ 4NOZA 2DE5A 5D1OB 4QTTA 3QWUA 2QA41 1YHQ1 2Y0SA 3I551 2VUMI 2RIQA 1KRLA 2DE7A 3NDJA 3CCJZ 3I07A 3IF8A 1Q822 3HOVI 4Y7NI 2RBLA 1Z02A 1R9TI 1TWCI 5T67A 4A3GI 2KI7B 3CCVZ 3CCEZ 1VQNZ 1LQLA 1X3WA 2QR1B 2RHBA 1VQL1 1VQ81 3FQQA 3GTQI 1K8A1 1YHQZ 2QA4Z 1TWHI 4RVFA 1QVGZ 3F3PC 3I55Z 2V8KA 4NFRA 4QTUA 4BBSI 4A3DI 3CPWZ 4HGZA 5FLMI 3TDHB 1X0TA 3CCL1 1YUKA 2O53A 2R92I 4NB9A 3S1MI 4RVGA 4CL1A 1KD11 1VQLZ 3JAMb 1VQ8Z 4HH4A 4NB8A 1VQP1 1RQFA 1N8R2 4DQYB 3NDIA 3GTPI 1ZB8A 1QVGY 2LIYA 4MD9A 3CPWY 1TWGI 1YJ91 3VMGA 2E2HI 1Q862 5IP7I 4DK1A 3CCLZ 1W2BZ 1YJN1 4A3MI 1QVFZ 2PK7A 3M4OI 1Y1VI 4BBRI 3G4S1 2P3YA 4BY1I 5T6BA 3CCS1 1VQPZ 4A3KI 2F4OA 1PFTA 4MRIA 4RVHA 2M6NA 2RT9A 1YJ9Z 3PO3S 1K731 1JWHC 3BG0B 3S15I 1W2BY 2IZ4A 4E32A 1YJNZ 1QVFY 2E9HA 1KC82 2OTJ1 3K7AI 2ZAEB 5LL6f 3G4SZ 5C44I 3J81b 3I4MI 3CCSZ 1S72Z 2KPIA 3VMIA 4DGLA 1VQM1 3I4NI 3D6WA 4A3CI 5IT9f 2QLVB 1M901 2DE6A 2YU9I 1WW9A 5A2Qb 3CCU1 2F4MA 1Q821 2OTJZ 1ZH1A 2QEX1 3I561 2NVTI 3PO3I 3IX0A 2IZ3A 1VQMZ 3FQMA 3GTJI 2WB1A 4MD8A 3NFZA 2GU2A 2OOYB 3T4NB 1YI2Z 2LFUA 3RZDI 3CCUZ 1YIT1 1VQ61 4NBFA 5C4JI 3CD61 3HOXI 4A3LI 2BJOA 1ML8A 3KIHA 3CQZI 1I3QI 2VUGA 2QEXZ 3HOYI 3I56Z 3HKZA 2R7ZI 3VTNA 4NH1C 1JJ2Z 1RO4A 4MD7A 3S2HI 1M1K2 3GTGI 3J7A4 2WAQA 1Q7Y2 3G711 1YITZ 1VQ6Z 1Z03A 2QREB 2AKLA 3CD6Z 2Q51A 4RS4A 1DL6A 1TWFI 1K83I 1Q861 3OW2Z 3JAMf 2OTL1 4EWCA 3GTLI 1YIJ1 3NH4A 5IP9I 4MONA 1K8A2 4E33A 1JJ2Y 2HF1A 1RLYA 1TFIA 3RZOI 4NBDA 4AYBA 1VQ41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMH A;  4QTT A;  1Y1V S;  5C44 I;  2E2I I;  3I4M I;  3GTM I;  2VUM I;  2JR6 A;  2KPI A;  3LUS A;  3VMI A;  2JA7 I;  2DE7 A;  3I07 A;  4X6A I;  3S17 I;  3HOU I;  3PO2 I;  3HOV I;  4Y7N I;  3I4N I;  2RBL A;  3D6W A;  3GKQ A;  4A3C I;  3EER A;  4A93 I;  3GCF A;  1R9T I;  1TWC I;  4A3G I;  2DE6 A;  2NVQ I;  2YU9 I;  3GTO I;  1LQL A;  1USP A;  1WW9 A;  3S2D I;  1X3W A;  1USP B;  1ZB9 A;  2F4M A;  3GTQ I;  1YUA A;  1N2F A;  2JA6 I;  2JA5 I;  1TWH I;  1I6H I;  3S1Q I;  1Y1W I;  2NVT I;  4QTU A;  4BBS I;  3PO3 I;  4A3D I;  4BXX I;  1TWA I;  3ESW A;  5FLM I;  5C4X I;  2NVY I;  3GTJ I;  4A3I I;  2R92 I;  3HOZ I;  4NB9 A;  3FKI I;  3HOW I;  3S1M I;  1WCM I;  2B63 I;  5C3E I;  3RZD I;  4NBF A;  5C4J I;  3HOX I;  4A3L I;  1X3Z A;  4MH4 A;  2BJO A;  4NB8 A;  1ML8 A;  2JA8 I;  4Y52 I;  3CQZ I;  1I3Q I;  1SFO I;  1L1O C;  3GTP I;  1ZB8 A;  3HOY I;  4NBE A;  4NBC A;  2E2J I;  3GTM S;  1I50 I;  4NBA A;  2R7Z I;  1QYP A;  1TWG I;  3H3V J;  3S1N I;  4XX2 A;  3VMG A;  2E2H I;  3Q87 A;  4NBG A;  4A3B I;  5IP7 I;  1RO4 A;  3K7A I;  2NVX I;  4NBH A;  3S2H I;  4A3M I;  3GTG I;  2JS4 A;  2PK7 A;  3M4O I;  1Y1V I;  4BBR I;  4A3J I;  2K5R A;  2J6A A;  2R93 I;  2P3Y A;  2AKL A;  4BY1 I;  1VLA A;  2JNY A;  5CM2 M;  1DL6 A;  1TWF I;  1K83 I;  4NBB A;  4BY7 I;  3S1R I;  4A3K I;  2F4O A;  3GTL I;  4A3F I;  1PFT A;  4A3E I;  3U50 C;  5IP9 I;  3PO3 S;  1NUI A;  3S14 I;  3S15 I;  3H0G I;  2HF1 A;  1RLY A;  3M3Y I;  1TFI A;  3RZO I;  3VB9 A;  3GTK I;  4NBD A;  3S16 I;  4NOZ A;  2DE5 A; 
#chains in the Genus database with same CATH topology
 2QRD B;  3G71 Z;  2E2I I;  3OW2 Y;  2JR6 A;  2RPR A;  3LUS A;  2OTL Z;  3CC4 1;  3NH5 A;  4X6A I;  4HGY A;  1YIJ Z;  1KC8 1;  3HOU I;  3PO2 I;  3J80 b;  4A93 I;  1RO0 A;  2M48 A;  2G2K A;  2Q4Z A;  1YJW 1;  2NVQ I;  3GTO I;  1USP A;  3TE5 B;  3S2D I;  5AN9 F;  5FLX b;  1USP B;  1ZB9 A;  1YUA A;  1N2F A;  1VQ4 Z;  2JA5 I;  2V8J A;  2HU9 A;  1I6H I;  1K9M 1;  1Y1W I;  3J81 f;  2JIQ A;  3CC4 Z;  1VQ7 1;  5C4X I;  3CCM 1;  4A3I I;  1KQS Z;  1YJW Z;  2P28 A;  3HOW I;  1VQ9 1;  4E30 A;  1K73 2;  2GTI A;  2YAD A;  5A2Q f;  1WZN A;  3CC7 1;  3P5J B;  3F3F C;  3MON A;  4Y52 I;  3CMA 1;  1L1O C;  4NBE A;  4NBC A;  2E2J I;  3GTM S;  1I50 I;  4NBA A;  2JIP A;  3H3V J;  3S1N I;  1RNI A;  1VQN 1;  4A3B I;  3CCM Z;  2JUB A;  1KQS Y;  4E2X A;  2R6M A;  1Z01 A;  1VQ9 Z;  2VPZ A;  4A3J I;  1Q16 A;  2VF1 A;  1M90 2;  4E2Y A;  2R93 I;  2JNY A;  1VQ5 1;  2I3C A;  1Q81 2;  3CC7 Z;  1NJI 2;  4BY7 I;  3IR7 A;  2W04 A;  1M1K 1;  3CMA Z;  2PMZ A;  4A3F I;  4TNU A;  1Q7Y 1;  2QKD A;  3S14 I;  1WII A;  3H0G I;  1N8R 1;  3GTK I;  3MZK B;  1SIW A;  3VMH A;  1Y1V S;  1FDO A;  3GTM I;  2JIR A;  1VQ5 Z;  2JA7 I;  3NH8 A;  2K3R A;  4S1T A;  2QRC B;  1VQK 1;  3S17 I;  2V8I A;  1QF8 A;  1P9N A;  3GKQ A;  3EER A;  3CCR 1;  3GCF A;  2W03 A;  2E7Z A;  1RO2 A;  2JA6 I;  2O4H A;  3S1Q I;  3KIF A;  1S7M A;  4BXX I;  1KD1 2;  1TWA I;  3ESW A;  1VQK Z;  4E2W A;  2H85 A;  2NVY I;  2PM9 A;  3CCR Z;  2GTH A;  3HOZ I;  2AYD A;  3J80 f;  3FKI I;  1WCM I;  2B63 I;  5C3E I;  3CCQ 1;  3BG1 B;  2LEX A;  1Y8C A;  1X3Z A;  4MH4 A;  1S72 1;  2EGT A;  2VPY A;  5FLX f;  3EED A;  2JA8 I;  3G6E 1;  4MXU A;  1SFO I;  3CC2 1;  2OOX B;  5T64 A;  1QYP A;  4XX2 A;  3Q87 A;  4NBG A;  3CME 1;  3CXC Z;  2NVX I;  4NBH A;  3IFU A;  2JS4 A;  2OZK A;  1VQO 1;  5D1P A;  3D9X A;  3CCQ Z;  2K5R A;  4RVD A;  2J6A A;  1VLA A;  5CM2 M;  4NBB A;  3G6E Z;  3S1R I;  3CC2 Z;  3CCJ 1;  5IT9 b;  4RV9 A;  3MZL B;  2JMO A;  4E2Z A;  3U50 C;  4A3E I;  4E31 A;  1NUI A;  1VQ7 Z;  1K9M 2;  3CCV 1;  3CCE 1;  1Q81 1;  3CXC Y;  1NP6 A;  3CME Z;  1NJI 1;  3M3Y I;  1YI2 1;  3VB9 A;  5D1O A;  3S16 I;  1VQO Z;  4NOZ A;  2DE5 A;  5D1O B;  4QTT A;  3QWU A;  2QA4 1;  1YHQ 1;  2Y0S A;  3I55 1;  2VUM I;  2JIO A;  2RIQ A;  1KRL A;  2DE7 A;  3NDJ A;  3CCJ Z;  3I07 A;  3IF8 A;  1Q82 2;  3HOV I;  4Y7N I;  2RBL A;  1Z02 A;  1R9T I;  1TWC I;  5T67 A;  4A3G I;  2KI7 B;  3CCV Z;  3CCE Z;  1VQN Z;  1LQL A;  1X3W A;  2QR1 B;  2RHB A;  1VQL 1;  1VQ8 1;  3FQQ A;  3GTQ I;  1K8A 1;  1YHQ Z;  2QA4 Z;  1TWH I;  4RVF A;  1QVG Z;  3F3P C;  3I55 Z;  2V8K A;  4NFR A;  4QTU A;  3D2L A;  4BBS I;  4A3D I;  3CPW Z;  4HGZ A;  5FLM I;  2V3V A;  3TDH B;  1X0T A;  3CCL 1;  1YUK A;  2O53 A;  2R92 I;  4NB9 A;  3S1M I;  4RVG A;  4CL1 A;  1KD1 1;  1VQL Z;  3JAM b;  1VQ8 Z;  4HH4 A;  4NB8 A;  1VQP 1;  1RQF A;  1N8R 2;  4DQY B;  3NDI A;  3GTP I;  1ZB8 A;  1QVG Y;  2LIY A;  4MD9 A;  3CPW Y;  1TWG I;  1YJ9 1;  3VMG A;  2E2H I;  1Q86 2;  5IP7 I;  4DK1 A;  3CCL Z;  1W2B Z;  1YJN 1;  4A3M I;  1QVF Z;  2PK7 A;  3M4O I;  1Y1V I;  4BBR I;  3G4S 1;  2P3Y A;  4BY1 I;  5T6B A;  3CCS 1;  1VQP Z;  4A3K I;  2F4O A;  1PFT A;  4MRI A;  4RVH A;  2M6N A;  2RT9 A;  1YJ9 Z;  3PO3 S;  1K73 1;  1JWH C;  3BG0 B;  3S15 I;  1W2B Y;  1WJ2 A;  2IZ4 A;  4E32 A;  1YJN Z;  1QVF Y;  2E9H A;  1KC8 2;  2OTJ 1;  3K7A I;  2ZAE B;  5LL6 f;  3G4S Z;  5C44 I;  3J81 b;  3I4M I;  3CCS Z;  1S72 Z;  2KPI A;  3VMI A;  2IV2 X;  2VPX A;  4DGL A;  1VQM 1;  3I4N I;  3D6W A;  4A3C I;  5IT9 f;  2QLV B;  1M90 1;  2DE6 A;  2YU9 I;  1WW9 A;  1FDI A;  5A2Q b;  2JIM A;  3CCU 1;  2F4M A;  1Q82 1;  2OTJ Z;  1ZH1 A;  2QEX 1;  3I56 1;  2NVT I;  3PO3 I;  3IX0 A;  2IZ3 A;  1VQM Z;  3FQM A;  3GTJ I;  2WB1 A;  4MD8 A;  3NFZ A;  2GU2 A;  2OOY B;  3T4N B;  1YI2 Z;  2LFU A;  3RZD I;  3CCU Z;  1YIT 1;  1VQ6 1;  4NBF A;  5C4J I;  3CD6 1;  3HOX I;  4A3L I;  2BJO A;  1ML8 A;  3KIH A;  3CQZ I;  1I3Q I;  2VUG A;  2QEX Z;  3HOY I;  3I56 Z;  3HKZ A;  2R7Z I;  3VTN A;  4NH1 C;  1JJ2 Z;  1RO4 A;  4MD7 A;  1AA6 A;  3S2H I;  1M1K 2;  3GTG I;  3J7A 4;  2WAQ A;  1Q7Y 2;  3G71 1;  1YIT Z;  1VQ6 Z;  1Z03 A;  2QRE B;  2AKL A;  3CD6 Z;  2Q51 A;  4RS4 A;  1DL6 A;  1TWF I;  1K83 I;  1Q86 1;  3OW2 Z;  3JAM f;  2NAP A;  2OTL 1;  4EWC A;  3GTL I;  1YIJ 1;  3NH4 A;  5IP9 I;  4MON A;  1K8A 2;  2VPW A;  4E33 A;  1QXF A;  1JJ2 Y;  2HF1 A;  1RLY A;  1TFI A;  3RZO I;  4NBD A;  4AYB A;  2V45 A;  1VQ4 1; 
#chains in the Genus database with same CATH homology
 2QRD B;  3G71 Z;  2E2I I;  3OW2 Y;  2JR6 A;  2RPR A;  3LUS A;  2OTL Z;  3CC4 1;  3NH5 A;  4X6A I;  4HGY A;  1YIJ Z;  1KC8 1;  3HOU I;  3PO2 I;  3J80 b;  4A93 I;  1RO0 A;  2M48 A;  2G2K A;  2Q4Z A;  1YJW 1;  2NVQ I;  3GTO I;  1USP A;  3TE5 B;  3S2D I;  5AN9 F;  5FLX b;  1USP B;  1ZB9 A;  1YUA A;  1N2F A;  1VQ4 Z;  2JA5 I;  2V8J A;  2HU9 A;  1I6H I;  1K9M 1;  1Y1W I;  3J81 f;  3CC4 Z;  1VQ7 1;  5C4X I;  3CCM 1;  4A3I I;  1KQS Z;  1YJW Z;  2P28 A;  3HOW I;  1VQ9 1;  4E30 A;  1K73 2;  2GTI A;  2YAD A;  5A2Q f;  3CC7 1;  3P5J B;  3F3F C;  3MON A;  4Y52 I;  3CMA 1;  1L1O C;  4NBE A;  4NBC A;  2E2J I;  3GTM S;  1I50 I;  4NBA A;  3H3V J;  3S1N I;  1RNI A;  1VQN 1;  4A3B I;  3CCM Z;  2JUB A;  1KQS Y;  4E2X A;  2R6M A;  1Z01 A;  1VQ9 Z;  4A3J I;  2VF1 A;  1M90 2;  2R93 I;  4E2Y A;  1VQ5 1;  2JNY A;  2I3C A;  1Q81 2;  3CC7 Z;  1NJI 2;  4BY7 I;  2W04 A;  1M1K 1;  3CMA Z;  2PMZ A;  4A3F I;  4TNU A;  1Q7Y 1;  2QKD A;  3S14 I;  1WII A;  3H0G I;  1N8R 1;  3GTK I;  3MZK B;  3VMH A;  1Y1V S;  3GTM I;  1VQ5 Z;  2JA7 I;  3NH8 A;  2K3R A;  4S1T A;  2QRC B;  1VQK 1;  3S17 I;  2V8I A;  1QF8 A;  1P9N A;  3GKQ A;  3EER A;  3CCR 1;  3GCF A;  2W03 A;  1RO2 A;  2JA6 I;  2O4H A;  3S1Q I;  3KIF A;  1S7M A;  4BXX I;  1KD1 2;  1TWA I;  3ESW A;  1VQK Z;  4E2W A;  2H85 A;  2NVY I;  2PM9 A;  3CCR Z;  2GTH A;  3HOZ I;  3J80 f;  3FKI I;  1WCM I;  2B63 I;  5C3E I;  3CCQ 1;  3BG1 B;  1X3Z A;  4MH4 A;  1S72 1;  2EGT A;  5FLX f;  3EED A;  2JA8 I;  3G6E 1;  4MXU A;  1SFO I;  3CC2 1;  2OOX B;  5T64 A;  1QYP A;  4XX2 A;  3Q87 A;  4NBG A;  3CME 1;  3CXC Z;  2NVX I;  4NBH A;  3IFU A;  2JS4 A;  2OZK A;  1VQO 1;  5D1P A;  3D9X A;  3CCQ Z;  2K5R A;  4RVD A;  2J6A A;  1VLA A;  5CM2 M;  4NBB A;  3G6E Z;  3S1R I;  3CC2 Z;  3CCJ 1;  5IT9 b;  4RV9 A;  3MZL B;  2JMO A;  4E2Z A;  3U50 C;  4A3E I;  4E31 A;  1NUI A;  1VQ7 Z;  1K9M 2;  3CCV 1;  3CCE 1;  1Q81 1;  3CXC Y;  1NP6 A;  3CME Z;  1NJI 1;  3M3Y I;  1YI2 1;  3VB9 A;  5D1O A;  3S16 I;  1VQO Z;  4NOZ A;  2DE5 A;  5D1O B;  4QTT A;  3QWU A;  2QA4 1;  1YHQ 1;  2Y0S A;  3I55 1;  2VUM I;  2RIQ A;  1KRL A;  2DE7 A;  3NDJ A;  3CCJ Z;  3I07 A;  3IF8 A;  1Q82 2;  3HOV I;  4Y7N I;  2RBL A;  1Z02 A;  1R9T I;  1TWC I;  5T67 A;  4A3G I;  2KI7 B;  3CCV Z;  3CCE Z;  1VQN Z;  1LQL A;  1X3W A;  2QR1 B;  2RHB A;  1VQL 1;  1VQ8 1;  3FQQ A;  3GTQ I;  1K8A 1;  1YHQ Z;  2QA4 Z;  1TWH I;  4RVF A;  1QVG Z;  3F3P C;  3I55 Z;  2V8K A;  4NFR A;  4QTU A;  4BBS I;  4A3D I;  3CPW Z;  4HGZ A;  5FLM I;  3TDH B;  1X0T A;  3CCL 1;  1YUK A;  2O53 A;  2R92 I;  4NB9 A;  3S1M I;  4RVG A;  4CL1 A;  1KD1 1;  1VQL Z;  3JAM b;  1VQ8 Z;  4HH4 A;  4NB8 A;  1VQP 1;  1RQF A;  1N8R 2;  4DQY B;  3NDI A;  3GTP I;  1ZB8 A;  1QVG Y;  2LIY A;  4MD9 A;  3CPW Y;  1TWG I;  1YJ9 1;  3VMG A;  2E2H I;  1Q86 2;  5IP7 I;  4DK1 A;  3CCL Z;  1W2B Z;  1YJN 1;  4A3M I;  1QVF Z;  2PK7 A;  3M4O I;  1Y1V I;  4BBR I;  3G4S 1;  2P3Y A;  4BY1 I;  5T6B A;  3CCS 1;  1VQP Z;  4A3K I;  2F4O A;  1PFT A;  4MRI A;  4RVH A;  2M6N A;  2RT9 A;  1YJ9 Z;  3PO3 S;  1K73 1;  1JWH C;  3BG0 B;  3S15 I;  1W2B Y;  2IZ4 A;  4E32 A;  1YJN Z;  1QVF Y;  2E9H A;  1KC8 2;  2OTJ 1;  3K7A I;  2ZAE B;  5LL6 f;  3G4S Z;  5C44 I;  3J81 b;  3I4M I;  3CCS Z;  1S72 Z;  2KPI A;  3VMI A;  4DGL A;  1VQM 1;  3I4N I;  3D6W A;  4A3C I;  5IT9 f;  2QLV B;  1M90 1;  2DE6 A;  2YU9 I;  1WW9 A;  5A2Q b;  3CCU 1;  2F4M A;  1Q82 1;  2OTJ Z;  1ZH1 A;  2QEX 1;  3I56 1;  2NVT I;  3PO3 I;  3IX0 A;  2IZ3 A;  1VQM Z;  3FQM A;  3GTJ I;  2WB1 A;  4MD8 A;  3NFZ A;  2GU2 A;  2OOY B;  3T4N B;  1YI2 Z;  2LFU A;  3RZD I;  3CCU Z;  1YIT 1;  1VQ6 1;  4NBF A;  5C4J I;  3CD6 1;  3HOX I;  4A3L I;  2BJO A;  1ML8 A;  3KIH A;  3CQZ I;  1I3Q I;  2VUG A;  2QEX Z;  3HOY I;  3I56 Z;  3HKZ A;  2R7Z I;  3VTN A;  4NH1 C;  1JJ2 Z;  1RO4 A;  4MD7 A;  3S2H I;  1M1K 2;  3GTG I;  3J7A 4;  2WAQ A;  1Q7Y 2;  3G71 1;  1YIT Z;  1VQ6 Z;  1Z03 A;  2QRE B;  2AKL A;  3CD6 Z;  2Q51 A;  4RS4 A;  1DL6 A;  1TWF I;  1K83 I;  1Q86 1;  3OW2 Z;  3JAM f;  2OTL 1;  4EWC A;  3GTL I;  1YIJ 1;  3NH4 A;  5IP9 I;  4MON A;  1K8A 2;  4E33 A;  1JJ2 Y;  2HF1 A;  1RLY A;  1TFI A;  3RZO I;  4NBD A;  4AYB A;  1VQ4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...