1M902

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m90200
2QA4Z 3CC21 3G6E1 1VQ7Z 1K9M2 3CCR1 1JJ2Z 1NJI2 1VQ4Z 3CXCY 1VQKZ 1VQOZ 1VQ41 1VQ9Z 1KQSZ 3CCEZ 1VQ5Z 3CC2Z 3I551 1YJWZ 1K9M1 3CCLZ 1VQL1 1K731 1M901 3CME1 3CCSZ 3G4S1 1VQK1 3CCL1 1VQN1 1KD12 1YI21 2OTJ1 3CD6Z 1YITZ 3G711 3CMEZ 2QA41 3OW2Z 1YJW1 3G71Z 1QVFY 1Q811 1Q7Y2 3CC4Z 3CCJ1 3CCS1 1VQO1 2QEX1 1JJ2Y 3CCM1 1K8A1 1W2BY 1M902 1YJN1 1VQPZ 1KQSY 3CCE1 1Q812 1VQ8Z 3G4SZ 3CCJZ 1YJNZ 3CMA1 3CCQ1 1QVGY 3CC7Z 1VQ61 3CCUZ 1YHQZ 1Q822 1NJI1 3G6EZ 1KC81 1VQ71 1VQ6Z 1YJ9Z 1M1K1 3CPWY 2QEXZ 3I55Z 1KC82 1QVFZ 3CC41 1YIJ1 1M1K2 1N8R1 3CPWZ 1YI2Z 1VQMZ 1VQ91 1Q821 1YJ91 1W2BZ 3I561 1S72Z 1VQNZ 3CCVZ 1VQP1 2OTLZ 1YIJZ 3CC71 1QVGZ 3CCQZ 3CCU1 1K8A2 3CD61 1Q7Y1 1Q862 3CCV1 1VQLZ 3CCMZ 1VQ51 2OTL1 1KD11 1Q861 1YIT1 2OTJZ 1YHQ1 1VQ81 1N8R2 1K732 3OW2Y 1S721 3I56Z 3CMAZ 1VQM1 3CXCZ 3CCRZ
chains in the Genus database with same CATH superfamily
2QA4Z 3EEDA 2NVQI 1NJI2 1VQ4Z 3GTQI 2JIMA 1ZB8A 1Y1WI 4MH4A 1Z01A 1KRLA 3VMHA 1KQSZ 3M4OI 3PO3S 2RHBA 2E2JI 4NBBA 1X3WA 3VTNA 3I551 2JMOA 4XX2A 2R93I 1M901 3S2HI 2GTHA 3VB9A 2ZAEB 1VQK1 3CCL1 5A2Qf 3CD6Z 3GTOI 1WZNA 5D1OB 1TFIA 2E2HI 5C3EI 2VPWA 3GTGI 2JIRA 3TE5B 2EGTA 2QEX1 4NB9A 2JIQA 1AA6A 4E2YA 1VQ8Z 1WW9A 2R6MA 4BY1I 4A93I 2F4MA 4Y7NI 1YJNZ 1QVGY 2K3RA 3FQMA 4MXUA 2VUMI 2PM9A 1NJI1 1VQ6Z 4A3GI 4A3FI 2QEXZ 1USPA 1WIIA 1Q16A 3NH5A 3S1MI 3HOUI 1Q821 2QLVB 1RLYA 3Q87A 1W2BZ 2AKLA 2NVTI 3NDIA 3CC71 2VUGA 2JA6I 2JIPA 4NBFA 2M48A 4E33A 2I3CA 3CCMZ 2E7ZA 4RVHA 3MZLB 1Q861 1YIT1 3PO2I 2F4OA 3TDHB 1K732 3S1NI 2GU2A 3CMAZ 3VMGA 3F3FC 5FLXb 3CXCZ 3HOXI 2E9HA 4MRIA 2GTIA 1JJ2Z 3P5JB 2QRCB 1VQKZ 2LIYA 3GTJI 4A3CI 2B63I 2OZKA 3D6WA 2R7ZI 4BBSI 1QXFA 3CC2Z 1K9M1 3IFUA 1KD12 3D2LA 4A3JI 1YI21 3CMEZ 1QYPA 4RVGA 2Y0SA 4CL1A 3KIFA 1Q811 4NH1C 4RV9A 1Y1VS 3CC4Z 3CCS1 3H0GI 1SFOI 4A3EI 1I6HI 3PO3I 4QTTA 1K83I 1VQPZ 1KQSY 3CCE1 1Q812 2NVYI 1QF8A 3CCJZ 4A3KI 3CCQ1 2VPYA 1VQ61 3U50C 3J80b 2Q51A 2VF1A 3HOVI 3G6EZ 5D1PA 2JR6A 1VQ71 3QWUA 1YJ9Z 1Y1VI 4NBCA 1KC82 1RNIA 1PFTA 3K7AI 4A3MI 1M1K2 1N8R1 3HOWI 3GTLI 4QTUA 1YJ91 2J6AA 1S72Z 1NP6A 3CCU1 3CD61 4AYBA 5D1OA 3I4MI 2JS4A 4NBDA 2JA7I 2W04A 1VQ51 2IZ3A 1RQFA 5AN9F 1X0TA 2OTJZ 4HH4A 3OW2Y 1S721 3BG0B 3GTMI 4RS4A 1RO4A 4DQYB 5IP7I 1VQM1 3HOZI 3I4NI 4EWCA 1FDOA 2IZ4A 3CC21 3VMIA 1K9M2 3CCR1 4HGZA 5A2Qb 2DE6A 3FQQA 1ML8A 1VQ41 5C44I 1VQ9Z 3S15I 2OOXB 4NBEA 1VQ5Z 4NOZA 2DE7A 2NVXI 1YJWZ 3CCLZ 1VQL1 4NBGA 3KIHA 3CCSZ 5IT9f 5FLXf 1VQN1 1WCMI 2QKDA 1TWHI 2RIQA 3GTKI 1ZB9A 5LL6f 4RVFA 2LEXA 1YJW1 1P9NA 2H85A 3G71Z 1QVFY 3HOYI 2JA8I 2P28A 3M3YI 3CCJ1 3F3PC 1JJ2Y 3CCM1 2DE5A 1K8A1 1M902 1YJN1 3S1QI 1TWFI 2K5RA 2HF1A 2YADA 3GKQA 3NH8A 4NFRA 4A3BI 2QRDB 3G4SZ 4MD9A 3ESWA 1L1OC 3GTMS 3CC7Z 4MONA 1RO2A 1YUKA 1JWHC 3FKII 1YHQZ 3S14I 1Q822 1KC81 4NBHA 4HGYA 4TNUA 4E2XA 3CPWY 3D9XA 2E2II 3I55Z 1RO0A 1R9TI 2VPZA 2JUBA 3RZDI 4BBRI 3J81b 2VPXA 3CPWZ 3EERA 3I561 4A3II 2RT9A 2W03A 1VQNZ 3S17I 5T6BA 5CM2M 3IX0A 1USPB 1YIJZ 2NAPA 3GTPI 1LQLA 1K8A2 2QR1B 1Q7Y1 1TWCI 2JIOA 2PK7A 1TWAI 3CCV1 1ZH1A 4E2ZA 4Y52I 2V8KA 3S1RI 4DGLA 1N2FA 4A3LI 4RVDA 1KD11 1FDIA 1I50I 2O4HA 2G2KA 4E31A 1N8R2 3I56Z 1YUAA 3S16I 4BY7I 3NFZA 5T67A 3MZKB 4BXXI 3G6E1 3T4NB 1VQ7Z 1S7MA 3CXCY 1VQOZ 2BJOA 3BG1B 3CCEZ 4NBAA 3RZOI 1Y8CA 3J80f 3J81f 3I07A 1K731 3IF8A 2QREB 3CME1 3G4S1 2OTJ1 1X3ZA 1YITZ 3G711 4E32A 2QA41 2KI7B 1NUIA 3OW2Z 4MD8A 2JA5I 1SIWA 1Q7Y2 5C4JI 2HU9A 2KPIA 3IR7A 1VQO1 3JAMb 1Z02A 2WAQA 2LFUA 4A3DI 1W2BY 4MD7A 2IV2X 3GCFA 5IT9b 3S2DI 3CMA1 4E30A 2AYDA 2PMZA 3NDJA 3CCUZ 3H3VJ 2M6NA 2P3YA 1M1K1 1VLAA 3NH4A 4X6AI 1QVFZ 2V3VA 2RBLA 3CC41 1YIJ1 5T64A 1YI2Z 1VQMZ 1VQ91 2O53A 2OOYB 4E2WA 3JAMf 2V8JA 3CCVZ 5IP9I 1VQP1 2RPRA 1DL6A 5C4XI 1I3QI 2OTLZ 2V8IA 3HKZA 1QVGZ 3CCQZ 2WB1A 2Q4ZA 3J7A4 1WJ2A 1Q862 5FLMI 1VQLZ 2R92I 1Z03A 4NB8A 2JNYA 2OTL1 2V45A 2YU9I 3CQZI 1YHQ1 1VQ81 4DK1A 4S1TA 3LUSA 1TWGI 3MONA 3CCRZ
chains in the Genus database with same CATH topology
2QA4Z 3EEDA 2NVQI 1NJI2 1VQ4Z 3GTQI 1ZB8A 1Y1WI 4MH4A 1Z01A 1KRLA 3VMHA 1KQSZ 3M4OI 3PO3S 2RHBA 2E2JI 4NBBA 1X3WA 3VTNA 3I551 2JMOA 4XX2A 2R93I 1M901 3S2HI 2GTHA 3VB9A 2ZAEB 1VQK1 3CCL1 5A2Qf 3CD6Z 3GTOI 5D1OB 1TFIA 2E2HI 5C3EI 3GTGI 3TE5B 2EGTA 2QEX1 4NB9A 4E2YA 1VQ8Z 1WW9A 2R6MA 4BY1I 4A93I 2F4MA 4Y7NI 1YJNZ 1QVGY 2K3RA 3FQMA 4MXUA 2VUMI 2PM9A 1NJI1 1VQ6Z 4A3GI 4A3FI 2QEXZ 1USPA 1WIIA 3NH5A 3S1MI 3HOUI 1Q821 2QLVB 1RLYA 3Q87A 1W2BZ 2AKLA 2NVTI 3NDIA 3CC71 2VUGA 2JA6I 4NBFA 2M48A 4E33A 2I3CA 3CCMZ 4RVHA 3MZLB 1Q861 1YIT1 3PO2I 2F4OA 3TDHB 1K732 3S1NI 2GU2A 3CMAZ 3VMGA 3F3FC 5FLXb 3CXCZ 3HOXI 2E9HA 4MRIA 2GTIA 1JJ2Z 3P5JB 2QRCB 1VQKZ 2LIYA 3GTJI 4A3CI 2B63I 2OZKA 3D6WA 2R7ZI 4BBSI 3CC2Z 1K9M1 3IFUA 1KD12 4A3JI 1YI21 3CMEZ 1QYPA 4RVGA 2Y0SA 4CL1A 3KIFA 1Q811 4NH1C 4RV9A 1Y1VS 3CC4Z 3CCS1 3H0GI 1SFOI 4A3EI 1I6HI 3PO3I 4QTTA 1K83I 1VQPZ 1KQSY 3CCE1 1Q812 2NVYI 1QF8A 3CCJZ 4A3KI 3CCQ1 1VQ61 3U50C 3J80b 2Q51A 2VF1A 3HOVI 3G6EZ 5D1PA 2JR6A 1VQ71 3QWUA 1YJ9Z 1Y1VI 4NBCA 1KC82 1RNIA 1PFTA 3K7AI 4A3MI 1M1K2 1N8R1 3HOWI 3GTLI 4QTUA 1YJ91 2J6AA 1S72Z 1NP6A 3CCU1 3CD61 4AYBA 5D1OA 3I4MI 2JS4A 4NBDA 2JA7I 2W04A 1VQ51 2IZ3A 1RQFA 5AN9F 1X0TA 2OTJZ 4HH4A 3OW2Y 1S721 3BG0B 3GTMI 4RS4A 1RO4A 4DQYB 5IP7I 1VQM1 3HOZI 3I4NI 4EWCA 2IZ4A 3CC21 3VMIA 1K9M2 3CCR1 4HGZA 5A2Qb 2DE6A 3FQQA 1ML8A 1VQ41 5C44I 1VQ9Z 3S15I 2OOXB 4NBEA 1VQ5Z 4NOZA 2DE7A 2NVXI 1YJWZ 3CCLZ 1VQL1 4NBGA 3KIHA 3CCSZ 5IT9f 5FLXf 1VQN1 1WCMI 2QKDA 1TWHI 2RIQA 3GTKI 1ZB9A 5LL6f 4RVFA 1YJW1 1P9NA 2H85A 3G71Z 1QVFY 3HOYI 2JA8I 2P28A 3M3YI 3CCJ1 3F3PC 1JJ2Y 3CCM1 2DE5A 1K8A1 1M902 1YJN1 3S1QI 1TWFI 2K5RA 2HF1A 2YADA 3GKQA 3NH8A 4NFRA 4A3BI 2QRDB 3G4SZ 4MD9A 3ESWA 1L1OC 3GTMS 4MONA 1RO2A 3CC7Z 1YUKA 1JWHC 3FKII 1YHQZ 3S14I 1Q822 1KC81 4NBHA 4HGYA 4TNUA 4E2XA 3CPWY 3D9XA 2E2II 3I55Z 1RO0A 1R9TI 2JUBA 3RZDI 4BBRI 3J81b 3CPWZ 3EERA 3I561 4A3II 2RT9A 2W03A 1VQNZ 3S17I 5T6BA 5CM2M 3IX0A 1USPB 1YIJZ 3GTPI 1LQLA 1K8A2 2QR1B 1Q7Y1 1TWCI 2PK7A 1TWAI 3CCV1 1ZH1A 4E2ZA 4Y52I 2V8KA 3S1RI 4DGLA 1N2FA 4A3LI 4RVDA 1KD11 1I50I 2O4HA 2G2KA 4E31A 1N8R2 3I56Z 1YUAA 3S16I 4BY7I 3NFZA 5T67A 3MZKB 4BXXI 3G6E1 3T4NB 1VQ7Z 1S7MA 3CXCY 1VQOZ 2BJOA 3BG1B 3CCEZ 4NBAA 3RZOI 3J80f 3J81f 3I07A 1K731 3IF8A 2QREB 3CME1 3G4S1 2OTJ1 1X3ZA 1YITZ 3G711 4E32A 2QA41 2KI7B 1NUIA 3OW2Z 4MD8A 2JA5I 1Q7Y2 5C4JI 2HU9A 2KPIA 1VQO1 3JAMb 1Z02A 2WAQA 2LFUA 4A3DI 1W2BY 4MD7A 3GCFA 5IT9b 3S2DI 3CMA1 4E30A 2PMZA 3NDJA 3CCUZ 3H3VJ 2M6NA 2P3YA 1M1K1 1VLAA 3NH4A 4X6AI 1QVFZ 2RBLA 3CC41 1YIJ1 5T64A 1YI2Z 1VQMZ 1VQ91 2O53A 2OOYB 4E2WA 3JAMf 2V8JA 3CCVZ 5IP9I 1VQP1 2RPRA 1DL6A 5C4XI 1I3QI 2OTLZ 2V8IA 3HKZA 1QVGZ 3CCQZ 2WB1A 2Q4ZA 3J7A4 1Q862 5FLMI 1VQLZ 2R92I 1Z03A 4NB8A 2JNYA 2OTL1 2YU9I 3CQZI 1YHQ1 1VQ81 4DK1A 4S1TA 3LUSA 1TWGI 3MONA 3CCRZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  3CC2 1;  3G6E 1;  1VQ7 Z;  1K9M 2;  3CCR 1;  1JJ2 Z;  1NJI 2;  1VQ4 Z;  3CXC Y;  1VQK Z;  1VQO Z;  1VQ4 1;  1VQ9 Z;  1KQS Z;  3CCE Z;  1VQ5 Z;  3CC2 Z;  3I55 1;  1YJW Z;  1K9M 1;  3CCL Z;  1VQL 1;  1K73 1;  1M90 1;  3CME 1;  3CCS Z;  3G4S 1;  1VQK 1;  3CCL 1;  1VQN 1;  1KD1 2;  1YI2 1;  2OTJ 1;  3CD6 Z;  1YIT Z;  3G71 1;  3CME Z;  2QA4 1;  3OW2 Z;  1YJW 1;  3G71 Z;  1QVF Y;  1Q81 1;  1Q7Y 2;  3CC4 Z;  3CCJ 1;  3CCS 1;  1VQO 1;  2QEX 1;  1JJ2 Y;  3CCM 1;  1K8A 1;  1W2B Y;  1M90 2;  1YJN 1;  1VQP Z;  1KQS Y;  3CCE 1;  1Q81 2;  1VQ8 Z;  3G4S Z;  3CCJ Z;  1YJN Z;  3CMA 1;  3CCQ 1;  1QVG Y;  3CC7 Z;  1VQ6 1;  3CCU Z;  1YHQ Z;  1Q82 2;  1NJI 1;  3G6E Z;  1KC8 1;  1VQ7 1;  1VQ6 Z;  1YJ9 Z;  1M1K 1;  3CPW Y;  2QEX Z;  3I55 Z;  1KC8 2;  1QVF Z;  3CC4 1;  1YIJ 1;  1M1K 2;  1N8R 1;  3CPW Z;  1YI2 Z;  1VQM Z;  1VQ9 1;  1Q82 1;  1YJ9 1;  1W2B Z;  3I56 1;  1S72 Z;  1VQN Z;  3CCV Z;  1VQP 1;  2OTL Z;  1YIJ Z;  3CC7 1;  1QVG Z;  3CCQ Z;  3CCU 1;  1K8A 2;  3CD6 1;  1Q7Y 1;  1Q86 2;  3CCV 1;  1VQL Z;  3CCM Z;  1VQ5 1;  2OTL 1;  1KD1 1;  1Q86 1;  1YIT 1;  2OTJ Z;  1YHQ 1;  1VQ8 1;  1N8R 2;  1K73 2;  3OW2 Y;  1S72 1;  3I56 Z;  3CMA Z;  1VQM 1;  3CXC Z;  3CCR Z; 
#chains in the Genus database with same CATH topology
 2QA4 Z;  3EED A;  2NVQ I;  1NJI 2;  1VQ4 Z;  3GTQ I;  2JIM A;  1ZB8 A;  1Y1W I;  4MH4 A;  1Z01 A;  1KRL A;  3VMH A;  1KQS Z;  3M4O I;  3PO3 S;  2RHB A;  2E2J I;  4NBB A;  1X3W A;  3VTN A;  3I55 1;  2JMO A;  4XX2 A;  2R93 I;  1M90 1;  3S2H I;  2GTH A;  3VB9 A;  2ZAE B;  1VQK 1;  3CCL 1;  5A2Q f;  3CD6 Z;  3GTO I;  1WZN A;  5D1O B;  1TFI A;  2E2H I;  5C3E I;  2VPW A;  3GTG I;  2JIR A;  3TE5 B;  2EGT A;  2QEX 1;  4NB9 A;  2JIQ A;  1AA6 A;  4E2Y A;  1VQ8 Z;  1WW9 A;  2R6M A;  4BY1 I;  4A93 I;  2F4M A;  4Y7N I;  1YJN Z;  1QVG Y;  2K3R A;  3FQM A;  4MXU A;  2VUM I;  2PM9 A;  1NJI 1;  1VQ6 Z;  4A3G I;  4A3F I;  2QEX Z;  1USP A;  1WII A;  1Q16 A;  3NH5 A;  3S1M I;  3HOU I;  1Q82 1;  2QLV B;  1RLY A;  3Q87 A;  1W2B Z;  2AKL A;  2NVT I;  3NDI A;  3CC7 1;  2VUG A;  2JA6 I;  2JIP A;  4NBF A;  2M48 A;  4E33 A;  2I3C A;  3CCM Z;  2E7Z A;  4RVH A;  3MZL B;  1Q86 1;  1YIT 1;  3PO2 I;  2F4O A;  3TDH B;  1K73 2;  3S1N I;  2GU2 A;  3CMA Z;  3VMG A;  3F3F C;  5FLX b;  3CXC Z;  3HOX I;  2E9H A;  4MRI A;  2GTI A;  1JJ2 Z;  3P5J B;  2QRC B;  1VQK Z;  2LIY A;  3GTJ I;  4A3C I;  2B63 I;  2OZK A;  3D6W A;  2R7Z I;  4BBS I;  1QXF A;  3CC2 Z;  1K9M 1;  3IFU A;  1KD1 2;  3D2L A;  4A3J I;  1YI2 1;  3CME Z;  1QYP A;  4RVG A;  2Y0S A;  4CL1 A;  3KIF A;  1Q81 1;  4NH1 C;  4RV9 A;  1Y1V S;  3CC4 Z;  3CCS 1;  3H0G I;  1SFO I;  4A3E I;  1I6H I;  3PO3 I;  4QTT A;  1K83 I;  1VQP Z;  1KQS Y;  3CCE 1;  1Q81 2;  2NVY I;  1QF8 A;  3CCJ Z;  4A3K I;  3CCQ 1;  2VPY A;  1VQ6 1;  3U50 C;  3J80 b;  2Q51 A;  2VF1 A;  3HOV I;  3G6E Z;  5D1P A;  2JR6 A;  1VQ7 1;  3QWU A;  1YJ9 Z;  1Y1V I;  4NBC A;  1KC8 2;  1RNI A;  1PFT A;  3K7A I;  4A3M I;  1M1K 2;  1N8R 1;  3HOW I;  3GTL I;  4QTU A;  1YJ9 1;  2J6A A;  1S72 Z;  1NP6 A;  3CCU 1;  3CD6 1;  4AYB A;  5D1O A;  3I4M I;  2JS4 A;  4NBD A;  2JA7 I;  2W04 A;  1VQ5 1;  2IZ3 A;  1RQF A;  5AN9 F;  1X0T A;  2OTJ Z;  4HH4 A;  3OW2 Y;  1S72 1;  3BG0 B;  3GTM I;  4RS4 A;  1RO4 A;  4DQY B;  5IP7 I;  1VQM 1;  3HOZ I;  3I4N I;  4EWC A;  1FDO A;  2IZ4 A;  3CC2 1;  3VMI A;  1K9M 2;  3CCR 1;  4HGZ A;  5A2Q b;  2DE6 A;  3FQQ A;  1ML8 A;  1VQ4 1;  5C44 I;  1VQ9 Z;  3S15 I;  2OOX B;  4NBE A;  1VQ5 Z;  4NOZ A;  2DE7 A;  2NVX I;  1YJW Z;  3CCL Z;  1VQL 1;  4NBG A;  3KIH A;  3CCS Z;  5IT9 f;  5FLX f;  1VQN 1;  1WCM I;  2QKD A;  1TWH I;  2RIQ A;  3GTK I;  1ZB9 A;  5LL6 f;  4RVF A;  2LEX A;  1YJW 1;  1P9N A;  2H85 A;  3G71 Z;  1QVF Y;  3HOY I;  2JA8 I;  2P28 A;  3M3Y I;  3CCJ 1;  3F3P C;  1JJ2 Y;  3CCM 1;  2DE5 A;  1K8A 1;  1M90 2;  1YJN 1;  3S1Q I;  1TWF I;  2K5R A;  2HF1 A;  2YAD A;  3GKQ A;  3NH8 A;  4NFR A;  4A3B I;  2QRD B;  3G4S Z;  4MD9 A;  3ESW A;  1L1O C;  3GTM S;  3CC7 Z;  4MON A;  1RO2 A;  1YUK A;  1JWH C;  3FKI I;  1YHQ Z;  3S14 I;  1Q82 2;  1KC8 1;  4NBH A;  4HGY A;  4TNU A;  4E2X A;  3CPW Y;  3D9X A;  2E2I I;  3I55 Z;  1RO0 A;  1R9T I;  2VPZ A;  2JUB A;  3RZD I;  4BBR I;  3J81 b;  2VPX A;  3CPW Z;  3EER A;  3I56 1;  4A3I I;  2RT9 A;  2W03 A;  1VQN Z;  3S17 I;  5T6B A;  5CM2 M;  3IX0 A;  1USP B;  1YIJ Z;  2NAP A;  3GTP I;  1LQL A;  1K8A 2;  2QR1 B;  1Q7Y 1;  1TWC I;  2JIO A;  2PK7 A;  1TWA I;  3CCV 1;  1ZH1 A;  4E2Z A;  4Y52 I;  2V8K A;  3S1R I;  4DGL A;  1N2F A;  4A3L I;  4RVD A;  1KD1 1;  1FDI A;  1I50 I;  2O4H A;  2G2K A;  4E31 A;  1N8R 2;  3I56 Z;  1YUA A;  3S16 I;  4BY7 I;  3NFZ A;  5T67 A;  3MZK B;  4BXX I;  3G6E 1;  3T4N B;  1VQ7 Z;  1S7M A;  3CXC Y;  1VQO Z;  2BJO A;  3BG1 B;  3CCE Z;  4NBA A;  3RZO I;  1Y8C A;  3J80 f;  3J81 f;  3I07 A;  1K73 1;  3IF8 A;  2QRE B;  3CME 1;  3G4S 1;  2OTJ 1;  1X3Z A;  1YIT Z;  3G71 1;  4E32 A;  2QA4 1;  2KI7 B;  1NUI A;  3OW2 Z;  4MD8 A;  2JA5 I;  1SIW A;  1Q7Y 2;  5C4J I;  2HU9 A;  2KPI A;  3IR7 A;  1VQO 1;  3JAM b;  1Z02 A;  2WAQ A;  2LFU A;  4A3D I;  1W2B Y;  4MD7 A;  2IV2 X;  3GCF A;  5IT9 b;  3S2D I;  3CMA 1;  4E30 A;  2AYD A;  2PMZ A;  3NDJ A;  3CCU Z;  3H3V J;  2M6N A;  2P3Y A;  1M1K 1;  1VLA A;  3NH4 A;  4X6A I;  1QVF Z;  2V3V A;  2RBL A;  3CC4 1;  1YIJ 1;  5T64 A;  1YI2 Z;  1VQM Z;  1VQ9 1;  2O53 A;  2OOY B;  4E2W A;  3JAM f;  2V8J A;  3CCV Z;  5IP9 I;  1VQP 1;  2RPR A;  1DL6 A;  5C4X I;  1I3Q I;  2OTL Z;  2V8I A;  3HKZ A;  1QVG Z;  3CCQ Z;  2WB1 A;  2Q4Z A;  3J7A 4;  1WJ2 A;  1Q86 2;  5FLM I;  1VQL Z;  2R92 I;  1Z03 A;  4NB8 A;  2JNY A;  2OTL 1;  2V45 A;  2YU9 I;  3CQZ I;  1YHQ 1;  1VQ8 1;  4DK1 A;  4S1T A;  3LUS A;  1TWG I;  3MON A;  3CCR Z; 
#chains in the Genus database with same CATH homology
 2QA4 Z;  3EED A;  2NVQ I;  1NJI 2;  1VQ4 Z;  3GTQ I;  1ZB8 A;  1Y1W I;  4MH4 A;  1Z01 A;  1KRL A;  3VMH A;  1KQS Z;  3M4O I;  3PO3 S;  2RHB A;  2E2J I;  4NBB A;  1X3W A;  3VTN A;  3I55 1;  2JMO A;  4XX2 A;  2R93 I;  1M90 1;  3S2H I;  2GTH A;  3VB9 A;  2ZAE B;  1VQK 1;  3CCL 1;  5A2Q f;  3CD6 Z;  3GTO I;  5D1O B;  1TFI A;  2E2H I;  5C3E I;  3GTG I;  3TE5 B;  2EGT A;  2QEX 1;  4NB9 A;  4E2Y A;  1VQ8 Z;  1WW9 A;  2R6M A;  4BY1 I;  4A93 I;  2F4M A;  4Y7N I;  1YJN Z;  1QVG Y;  2K3R A;  3FQM A;  4MXU A;  2VUM I;  2PM9 A;  1NJI 1;  1VQ6 Z;  4A3G I;  4A3F I;  2QEX Z;  1USP A;  1WII A;  3NH5 A;  3S1M I;  3HOU I;  1Q82 1;  2QLV B;  1RLY A;  3Q87 A;  1W2B Z;  2AKL A;  2NVT I;  3NDI A;  3CC7 1;  2VUG A;  2JA6 I;  4NBF A;  2M48 A;  4E33 A;  2I3C A;  3CCM Z;  4RVH A;  3MZL B;  1Q86 1;  1YIT 1;  3PO2 I;  2F4O A;  3TDH B;  1K73 2;  3S1N I;  2GU2 A;  3CMA Z;  3VMG A;  3F3F C;  5FLX b;  3CXC Z;  3HOX I;  2E9H A;  4MRI A;  2GTI A;  1JJ2 Z;  3P5J B;  2QRC B;  1VQK Z;  2LIY A;  3GTJ I;  4A3C I;  2B63 I;  2OZK A;  3D6W A;  2R7Z I;  4BBS I;  3CC2 Z;  1K9M 1;  3IFU A;  1KD1 2;  4A3J I;  1YI2 1;  3CME Z;  1QYP A;  4RVG A;  2Y0S A;  4CL1 A;  3KIF A;  1Q81 1;  4NH1 C;  4RV9 A;  1Y1V S;  3CC4 Z;  3CCS 1;  3H0G I;  1SFO I;  4A3E I;  1I6H I;  3PO3 I;  4QTT A;  1K83 I;  1VQP Z;  1KQS Y;  3CCE 1;  1Q81 2;  2NVY I;  1QF8 A;  3CCJ Z;  4A3K I;  3CCQ 1;  1VQ6 1;  3U50 C;  3J80 b;  2Q51 A;  2VF1 A;  3HOV I;  3G6E Z;  5D1P A;  2JR6 A;  1VQ7 1;  3QWU A;  1YJ9 Z;  1Y1V I;  4NBC A;  1KC8 2;  1RNI A;  1PFT A;  3K7A I;  4A3M I;  1M1K 2;  1N8R 1;  3HOW I;  3GTL I;  4QTU A;  1YJ9 1;  2J6A A;  1S72 Z;  1NP6 A;  3CCU 1;  3CD6 1;  4AYB A;  5D1O A;  3I4M I;  2JS4 A;  4NBD A;  2JA7 I;  2W04 A;  1VQ5 1;  2IZ3 A;  1RQF A;  5AN9 F;  1X0T A;  2OTJ Z;  4HH4 A;  3OW2 Y;  1S72 1;  3BG0 B;  3GTM I;  4RS4 A;  1RO4 A;  4DQY B;  5IP7 I;  1VQM 1;  3HOZ I;  3I4N I;  4EWC A;  2IZ4 A;  3CC2 1;  3VMI A;  1K9M 2;  3CCR 1;  4HGZ A;  5A2Q b;  2DE6 A;  3FQQ A;  1ML8 A;  1VQ4 1;  5C44 I;  1VQ9 Z;  3S15 I;  2OOX B;  4NBE A;  1VQ5 Z;  4NOZ A;  2DE7 A;  2NVX I;  1YJW Z;  3CCL Z;  1VQL 1;  4NBG A;  3KIH A;  3CCS Z;  5IT9 f;  5FLX f;  1VQN 1;  1WCM I;  2QKD A;  1TWH I;  2RIQ A;  3GTK I;  1ZB9 A;  5LL6 f;  4RVF A;  1YJW 1;  1P9N A;  2H85 A;  3G71 Z;  1QVF Y;  3HOY I;  2JA8 I;  2P28 A;  3M3Y I;  3CCJ 1;  3F3P C;  1JJ2 Y;  3CCM 1;  2DE5 A;  1K8A 1;  1M90 2;  1YJN 1;  3S1Q I;  1TWF I;  2K5R A;  2HF1 A;  2YAD A;  3GKQ A;  3NH8 A;  4NFR A;  4A3B I;  2QRD B;  3G4S Z;  4MD9 A;  3ESW A;  1L1O C;  3GTM S;  4MON A;  1RO2 A;  3CC7 Z;  1YUK A;  1JWH C;  3FKI I;  1YHQ Z;  3S14 I;  1Q82 2;  1KC8 1;  4NBH A;  4HGY A;  4TNU A;  4E2X A;  3CPW Y;  3D9X A;  2E2I I;  3I55 Z;  1RO0 A;  1R9T I;  2JUB A;  3RZD I;  4BBR I;  3J81 b;  3CPW Z;  3EER A;  3I56 1;  4A3I I;  2RT9 A;  2W03 A;  1VQN Z;  3S17 I;  5T6B A;  5CM2 M;  3IX0 A;  1USP B;  1YIJ Z;  3GTP I;  1LQL A;  1K8A 2;  2QR1 B;  1Q7Y 1;  1TWC I;  2PK7 A;  1TWA I;  3CCV 1;  1ZH1 A;  4E2Z A;  4Y52 I;  2V8K A;  3S1R I;  4DGL A;  1N2F A;  4A3L I;  4RVD A;  1KD1 1;  1I50 I;  2O4H A;  2G2K A;  4E31 A;  1N8R 2;  3I56 Z;  1YUA A;  3S16 I;  4BY7 I;  3NFZ A;  5T67 A;  3MZK B;  4BXX I;  3G6E 1;  3T4N B;  1VQ7 Z;  1S7M A;  3CXC Y;  1VQO Z;  2BJO A;  3BG1 B;  3CCE Z;  4NBA A;  3RZO I;  3J80 f;  3J81 f;  3I07 A;  1K73 1;  3IF8 A;  2QRE B;  3CME 1;  3G4S 1;  2OTJ 1;  1X3Z A;  1YIT Z;  3G71 1;  4E32 A;  2QA4 1;  2KI7 B;  1NUI A;  3OW2 Z;  4MD8 A;  2JA5 I;  1Q7Y 2;  5C4J I;  2HU9 A;  2KPI A;  1VQO 1;  3JAM b;  1Z02 A;  2WAQ A;  2LFU A;  4A3D I;  1W2B Y;  4MD7 A;  3GCF A;  5IT9 b;  3S2D I;  3CMA 1;  4E30 A;  2PMZ A;  3NDJ A;  3CCU Z;  3H3V J;  2M6N A;  2P3Y A;  1M1K 1;  1VLA A;  3NH4 A;  4X6A I;  1QVF Z;  2RBL A;  3CC4 1;  1YIJ 1;  5T64 A;  1YI2 Z;  1VQM Z;  1VQ9 1;  2O53 A;  2OOY B;  4E2W A;  3JAM f;  2V8J A;  3CCV Z;  5IP9 I;  1VQP 1;  2RPR A;  1DL6 A;  5C4X I;  1I3Q I;  2OTL Z;  2V8I A;  3HKZ A;  1QVG Z;  3CCQ Z;  2WB1 A;  2Q4Z A;  3J7A 4;  1Q86 2;  5FLM I;  1VQL Z;  2R92 I;  1Z03 A;  4NB8 A;  2JNY A;  2OTL 1;  2YU9 I;  3CQZ I;  1YHQ 1;  1VQ8 1;  4DK1 A;  4S1T A;  3LUS A;  1TWG I;  3MON A;  3CCR Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...