1M902

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m90200
3CC21 1W2BY 2OTJ1 1VQM1 1VQOZ 1KC82 1JJ2Z 3CCSZ 1Q812 3CCMZ 1Q862 3I55Z 3CCLZ 1VQP1 3OW2Z 1S721 1VQLZ 1Q7Y2 3CCR1 3G6E1 1VQ8Z 1VQNZ 1Q811 1YJ9Z 1QVGZ 1Q861 1KQSY 3G71Z 1VQO1 1KD11 3CCQZ 1YI2Z 1YHQZ 1YIJZ 3CCS1 1Q7Y1 1M1K1 3CCM1 3CCJ1 3I551 3CCE1 3CPWZ 3CCL1 3I56Z 1M901 1N8R2 1VQ6Z 1VQL1 1K731 1VQ51 1KD12 1VQ91 1VQ81 1VQN1 1YJWZ 1M1K2 1YJ91 3CCUZ 3OW2Y 1VQ7Z 1W2BZ 2QEXZ 3G711 1M902 3CC7Z 2OTLZ 3CCQ1 1N8R1 1YI21 3CXCZ 1YHQ1 1YIJ1 3CC4Z 1K732 1QVFY 1YITZ 1K8A1 1VQ61 3CMEZ 3CMAZ 3CD6Z 1Q821 1JJ2Y 1YJNZ 3CCU1 1VQ71 1S72Z 1KQSZ 2QA4Z 2QEX1 3G4SZ 1K8A2 2OTL1 3CCRZ 1VQKZ 3G6EZ 1VQ4Z 3CC41 1NJI2 1K9M2 1YIT1 1Q822 3CCVZ 1QVGY 3CC2Z 3CXCY 3I561 2OTJZ 3CME1 3CMA1 1VQMZ 3CCJZ 3CD61 3CCEZ 1YJN1 1NJI1 1K9M1 2QA41 1YJW1 3G4S1 3CPWY 1VQ5Z 1VQPZ 1VQK1 1VQ9Z 1KC81 1VQ41 3CC71 1QVFZ 3CCV1
chains in the Genus database with same CATH superfamily
3CC21 1WCMI 2GU2A 3GTPI 2JIRA 1I3QI 4MD7A 2OTJ1 5C44I 1VQM1 1KC82 4E2XA 1ZB9A 3BG0B 2IV2X 1VQP1 2DE5A 2IZ4A 3NH5A 4BXXI 2QREB 1AA6A 3FKII 5IP9I 1QYPA 1Q811 3GTOI 2OOYB 4RVGA 1YJ9Z 1QVGZ 3U50C 1KQSY 3PO3I 5FLXf 5C4JI 3G71Z 2KPIA 1KD11 3CCQZ 1YHQZ 4A3II 1YIJZ 3VMIA 1Q7Y1 1M1K1 3CCM1 3GKQA 3TDHB 1VQL1 1K731 1TFIA 1KD12 4NBHA 1YJWZ 2O4HA 2PMZA 1M1K2 2QKDA 3CCUZ 3GTLI 1VQ7Z 1WJ2A 4NBGA 1W2BZ 4A3JI 5IP7I 2LEXA 3CC7Z 3H0GI 4E2YA 2M48A 3CXCZ 3KIFA 3S16I 1K732 2E2HI 4MONA 1QVFY 3S15I 4MRIA 4QTTA 1X3ZA 1K83I 1KRLA 2WB1A 2QA4Z 5LL6f 5IT9f 2OTL1 2RBLA 4NBBA 3CC41 5AN9F 5T64A 3J7A4 1K9M2 1YIT1 4DK1A 1SIWA 1SFOI 1S7MA 3T4NB 3GCFA 1QVGY 2WAQA 3CMA1 3M4OI 5D1PA 4A93I 1YJN1 3GTJI 1ZB8A 4BY7I 3G4S1 3I4NI 3J80f 1WIIA 3JAMf 1VQK1 2JIOA 1X0TA 3GTMI 3TE5B 4AYBA 2E2II 3S17I 3P5JB 2Y0SA 3CCV1 2NVQI 4DGLA 2JUBA 1W2BY 1VQOZ 3M3YI 1L1OC 5A2Qf 2NVYI 1USPB 3PO3S 3BG1B 3I55Z 1Y1VI 5FLXb 4A3FI 2F4OA 1S721 2V8IA 2R92I 3CCR1 3G6E1 2VPYA 2DE7A 2BJOA 2GTHA 4MD8A 2W04A 1JWHC 1YI2Z 2EGTA 5FLMI 2JA5I 3CCE1 4MD9A 3EEDA 3CPWZ 2LIYA 3K7AI 2JNYA 2R6MA 1LQLA 1VQ51 3RZOI 1VQ91 4S1TA 1YJ91 2JA6I 2QLVB 3OW2Y 2Q51A 2QEXZ 3G711 1VLAA 3CCQ1 4BY1I 2K3RA 3IFUA 1YHQ1 2Q4ZA 1YIJ1 3MZLB 4CL1A 2VPXA 3RZDI 4BBRI 5IT9b 3H3VJ 1Z02A 2HF1A 3J81f 4A3EI 2NAPA 3QWUA 3CD6Z 1Q821 3CCU1 1VQ71 4E2WA 1ZH1A 4A3KI 3VMHA 3NH8A 1VQ4Z 2YU9I 2NVXI 1YUKA 1NJI2 2OOXB 1RO0A 3J80b 1RQFA 3JAMb 1Q822 4A3LI 1USPA 2HU9A 4NBAA 3GTMS 3I561 4NB8A 3D2LA 4EWCA 3D9XA 3IR7A 2QRDB 4NB9A 2QA41 1K9M1 4RVHA 1RO2A 2LFUA 3CPWY 4MXUA 5A2Qb 1X3WA 2E2JI 1Y1VS 2O53A 2JR6A 3S14I 2PK7A 4QTUA 2P3YA 3VMGA 1QXFA 1JJ2Z 2JIQA 4HGZA 3CCSZ 1Q862 3S1NI 1TWFI 2M6NA 3CCLZ 2B63I 4A3GI 2JS4A 3OW2Z 4NBFA 1NP6A 4E30A 1VQNZ 1VQ8Z 4A3BI 1Q16A 2YADA 1VQO1 2E7ZA 3Q87A 3KIHA 3VTNA 4HGYA 3HOVI 1TWHI 4TNUA 3CCJ1 3I551 1N8R2 4XX2A 1VQ6Z 3F3PC 3HOUI 2VPWA 3I4MI 3GTQI 4NFRA 3MONA 3FQMA 3J81b 2V8JA 4NBEA 3D6WA 1YI21 4A3DI 3EERA 4X6AI 3PO2I 1TWAI 3NH4A 1K8A1 4E33A 2ZAEB 3CMEZ 2E9HA 3FQQA 1JJ2Y 1FDIA 2GTIA 1S72Z 1PFTA 2R7ZI 2QEX1 1K8A2 2RIQA 2JIPA 3CCRZ 3G6EZ 4DQYB 4HH4A 1RLYA 5D1OB 2G2KA 2AKLA 3S1RI 3CC2Z 4E2ZA 2OTJZ 1P9NA 1VQMZ 2JA7I 3CCEZ 3CD61 2QR1B 3NDJA 3LUSA 1NJI1 2K5RA 1YJW1 3VB9A 3I07A 1VQ5Z 3F3FC 1VQPZ 3S2DI 1VQ9Z 1VQ41 4A3CI 1NUIA 3CC71 1WW9A 1QF8A 1Y8CA 4NOZA 3S2HI 2JA8I 2QRCB 4E31A 4NBCA 1R9TI 2RHBA 1FDOA 4Y7NI 2J6AA 3GTGI 1TWGI 4Y52I 1Q812 1RO4A 3CCMZ 2JMOA 3HOXI 3HOYI 2PM9A 5T6BA 1Z01A 1VQLZ 4A3MI 1Q7Y2 4RVDA 4MH4A 2KI7B 5CM2M 2V45A 1Q861 2IZ3A 2P28A 3ESWA 3CCS1 4BBSI 3GTKI 3NDIA 1ML8A 3MZKB 2V3VA 3CCL1 3I56Z 1M901 2VUMI 2DE6A 4RV9A 3HKZA 4E32A 2F4MA 1VQN1 1VQ81 5D1OA 2R93I 1M902 2OTLZ 3HOZI 1N8R1 2VF1A 3CQZI 2JIMA 2H85A 3CC4Z 2VPZA 1YITZ 1VQ61 2NVTI 3CMAZ 4NH1C 5C3EI 2V8KA 1I6HI 1YJNZ 4RS4A 1KQSZ 1YUAA 3G4SZ 5C4XI 4RVFA 1TWCI 1VQKZ 1Z03A 1RNIA 3HOWI 1DL6A 3CCVZ 2OZKA 3CXCY 2W03A 3CME1 3S1QI 4NBDA 3CCJZ 2RPRA 1N2FA 1Y1WI 2RT9A 2AYDA 3IX0A 1KC81 5T67A 3IF8A 1I50I 2VUGA 1QVFZ 3S1MI 1WZNA 2I3CA 3NFZA
chains in the Genus database with same CATH topology
3CC21 1WCMI 2GU2A 3GTPI 4MD7A 1I3QI 2OTJ1 5C44I 1VQM1 1KC82 4E2XA 1ZB9A 3BG0B 1VQP1 2DE5A 2IZ4A 3NH5A 4BXXI 2QREB 3FKII 5IP9I 1QYPA 1Q811 3GTOI 2OOYB 4RVGA 1YJ9Z 1QVGZ 3U50C 1KQSY 3PO3I 5FLXf 5C4JI 3G71Z 2KPIA 1KD11 3CCQZ 1YHQZ 4A3II 1YIJZ 3VMIA 1Q7Y1 1M1K1 3CCM1 3GKQA 3TDHB 1VQL1 1K731 1TFIA 1KD12 4NBHA 1YJWZ 2O4HA 2PMZA 1M1K2 2QKDA 3CCUZ 3GTLI 1VQ7Z 4NBGA 1W2BZ 4A3JI 5IP7I 3CC7Z 3H0GI 4E2YA 2M48A 3CXCZ 3KIFA 3S16I 1K732 2E2HI 4MONA 1QVFY 3S15I 4MRIA 4QTTA 1X3ZA 1K83I 1KRLA 2WB1A 2QA4Z 5LL6f 5IT9f 2OTL1 2RBLA 4NBBA 3CC41 5AN9F 5T64A 3J7A4 1K9M2 1YIT1 4DK1A 1SFOI 1S7MA 3T4NB 3GCFA 1QVGY 2WAQA 3CMA1 3M4OI 5D1PA 4A93I 1YJN1 3GTJI 1ZB8A 4BY7I 3G4S1 3I4NI 3J80f 1WIIA 3JAMf 1VQK1 1X0TA 3GTMI 3TE5B 4AYBA 2E2II 3S17I 3P5JB 2Y0SA 3CCV1 2NVQI 4DGLA 2JUBA 1W2BY 1VQOZ 3M3YI 1L1OC 5A2Qf 2NVYI 1USPB 3PO3S 3BG1B 3I55Z 1Y1VI 5FLXb 4A3FI 2F4OA 1S721 2V8IA 2R92I 3CCR1 3G6E1 2DE7A 2BJOA 2GTHA 4MD8A 2W04A 1JWHC 1YI2Z 2EGTA 5FLMI 2JA5I 3CCE1 4MD9A 3EEDA 3CPWZ 2LIYA 3K7AI 2JNYA 2R6MA 1LQLA 1VQ51 3RZOI 1VQ91 4S1TA 1YJ91 2JA6I 2QLVB 3OW2Y 2Q51A 2QEXZ 3G711 1VLAA 3CCQ1 4BY1I 2K3RA 3IFUA 1YHQ1 2Q4ZA 1YIJ1 3MZLB 4CL1A 3RZDI 4BBRI 5IT9b 3H3VJ 1Z02A 2HF1A 3J81f 4A3EI 3QWUA 3CD6Z 1Q821 3CCU1 1VQ71 4E2WA 1ZH1A 4A3KI 3VMHA 3NH8A 1VQ4Z 2YU9I 2NVXI 1YUKA 1NJI2 2OOXB 1RO0A 3J80b 1RQFA 3JAMb 1Q822 4A3LI 1USPA 2HU9A 4NBAA 3GTMS 3I561 4NB8A 4EWCA 3D9XA 2QRDB 4NB9A 2QA41 1K9M1 4RVHA 1RO2A 2LFUA 3CPWY 4MXUA 5A2Qb 1X3WA 2E2JI 1Y1VS 2O53A 2JR6A 3S14I 2PK7A 4QTUA 2P3YA 3VMGA 1JJ2Z 4HGZA 3CCSZ 1Q862 3S1NI 1TWFI 2M6NA 3CCLZ 2B63I 4A3GI 2JS4A 3OW2Z 4NBFA 1NP6A 4E30A 1VQNZ 1VQ8Z 4A3BI 2YADA 1VQO1 3Q87A 3KIHA 3VTNA 4HGYA 3HOVI 1TWHI 4TNUA 3CCJ1 3I551 1N8R2 4XX2A 1VQ6Z 3F3PC 3HOUI 3I4MI 3GTQI 4NFRA 3MONA 3FQMA 3J81b 2V8JA 4NBEA 3D6WA 1YI21 4A3DI 3EERA 4X6AI 3PO2I 1TWAI 3NH4A 1K8A1 4E33A 2ZAEB 3CMEZ 2E9HA 3FQQA 1JJ2Y 2GTIA 1S72Z 1PFTA 2R7ZI 2QEX1 1K8A2 2RIQA 3CCRZ 3G6EZ 4DQYB 4HH4A 1RLYA 5D1OB 2G2KA 2AKLA 3S1RI 3CC2Z 4E2ZA 2OTJZ 1P9NA 1VQMZ 2JA7I 3CCEZ 3CD61 2QR1B 3NDJA 3LUSA 1NJI1 2K5RA 1YJW1 3VB9A 3I07A 1VQ5Z 3F3FC 1VQPZ 3S2DI 1VQ9Z 1VQ41 4A3CI 1NUIA 3CC71 1WW9A 1QF8A 4NOZA 3S2HI 2JA8I 2QRCB 4E31A 4NBCA 1R9TI 2RHBA 4Y7NI 2J6AA 3GTGI 1TWGI 4Y52I 1Q812 1RO4A 3CCMZ 2JMOA 3HOXI 3HOYI 2PM9A 5T6BA 1Z01A 1VQLZ 4A3MI 1Q7Y2 4RVDA 4MH4A 2KI7B 5CM2M 1Q861 2IZ3A 2P28A 3ESWA 3CCS1 4BBSI 3GTKI 3NDIA 1ML8A 3MZKB 3CCL1 3I56Z 1M901 2VUMI 2DE6A 4RV9A 3HKZA 4E32A 2F4MA 1VQN1 1VQ81 5D1OA 2R93I 1M902 2OTLZ 3HOZI 1N8R1 2VF1A 3CQZI 2H85A 3CC4Z 1YITZ 1VQ61 2NVTI 3CMAZ 4NH1C 5C3EI 2V8KA 1I6HI 1YJNZ 4RS4A 1KQSZ 1YUAA 3G4SZ 5C4XI 4RVFA 1TWCI 1VQKZ 1Z03A 1RNIA 3HOWI 1DL6A 3CCVZ 2OZKA 3CXCY 2W03A 3CME1 3S1QI 4NBDA 3CCJZ 2RPRA 1N2FA 1Y1WI 2RT9A 3IX0A 1KC81 5T67A 3IF8A 1I50I 2VUGA 1QVFZ 3S1MI 2I3CA 3NFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 1;  1W2B Y;  2OTJ 1;  1VQM 1;  1VQO Z;  1KC8 2;  1JJ2 Z;  3CCS Z;  1Q81 2;  3CCM Z;  1Q86 2;  3I55 Z;  3CCL Z;  1VQP 1;  3OW2 Z;  1S72 1;  1VQL Z;  1Q7Y 2;  3CCR 1;  3G6E 1;  1VQ8 Z;  1VQN Z;  1Q81 1;  1YJ9 Z;  1QVG Z;  1Q86 1;  1KQS Y;  3G71 Z;  1VQO 1;  1KD1 1;  3CCQ Z;  1YI2 Z;  1YHQ Z;  1YIJ Z;  3CCS 1;  1Q7Y 1;  1M1K 1;  3CCM 1;  3CCJ 1;  3I55 1;  3CCE 1;  3CPW Z;  3CCL 1;  3I56 Z;  1M90 1;  1N8R 2;  1VQ6 Z;  1VQL 1;  1K73 1;  1VQ5 1;  1KD1 2;  1VQ9 1;  1VQ8 1;  1VQN 1;  1YJW Z;  1M1K 2;  1YJ9 1;  3CCU Z;  3OW2 Y;  1VQ7 Z;  1W2B Z;  2QEX Z;  3G71 1;  1M90 2;  3CC7 Z;  2OTL Z;  3CCQ 1;  1N8R 1;  1YI2 1;  3CXC Z;  1YHQ 1;  1YIJ 1;  3CC4 Z;  1K73 2;  1QVF Y;  1YIT Z;  1K8A 1;  1VQ6 1;  3CME Z;  3CMA Z;  3CD6 Z;  1Q82 1;  1JJ2 Y;  1YJN Z;  3CCU 1;  1VQ7 1;  1S72 Z;  1KQS Z;  2QA4 Z;  2QEX 1;  3G4S Z;  1K8A 2;  2OTL 1;  3CCR Z;  1VQK Z;  3G6E Z;  1VQ4 Z;  3CC4 1;  1NJI 2;  1K9M 2;  1YIT 1;  1Q82 2;  3CCV Z;  1QVG Y;  3CC2 Z;  3CXC Y;  3I56 1;  2OTJ Z;  3CME 1;  3CMA 1;  1VQM Z;  3CCJ Z;  3CD6 1;  3CCE Z;  1YJN 1;  1NJI 1;  1K9M 1;  2QA4 1;  1YJW 1;  3G4S 1;  3CPW Y;  1VQ5 Z;  1VQP Z;  1VQK 1;  1VQ9 Z;  1KC8 1;  1VQ4 1;  3CC7 1;  1QVF Z;  3CCV 1; 
#chains in the Genus database with same CATH topology
 3CC2 1;  1WCM I;  2GU2 A;  3GTP I;  2JIR A;  1I3Q I;  4MD7 A;  2OTJ 1;  5C44 I;  1VQM 1;  1KC8 2;  4E2X A;  1ZB9 A;  3BG0 B;  2IV2 X;  1VQP 1;  2DE5 A;  2IZ4 A;  3NH5 A;  4BXX I;  2QRE B;  1AA6 A;  3FKI I;  5IP9 I;  1QYP A;  1Q81 1;  3GTO I;  2OOY B;  4RVG A;  1YJ9 Z;  1QVG Z;  3U50 C;  1KQS Y;  3PO3 I;  5FLX f;  5C4J I;  3G71 Z;  2KPI A;  1KD1 1;  3CCQ Z;  1YHQ Z;  4A3I I;  1YIJ Z;  3VMI A;  1Q7Y 1;  1M1K 1;  3CCM 1;  3GKQ A;  3TDH B;  1VQL 1;  1K73 1;  1TFI A;  1KD1 2;  4NBH A;  1YJW Z;  2O4H A;  2PMZ A;  1M1K 2;  2QKD A;  3CCU Z;  3GTL I;  1VQ7 Z;  1WJ2 A;  4NBG A;  1W2B Z;  4A3J I;  5IP7 I;  2LEX A;  3CC7 Z;  3H0G I;  4E2Y A;  2M48 A;  3CXC Z;  3KIF A;  3S16 I;  1K73 2;  2E2H I;  4MON A;  1QVF Y;  3S15 I;  4MRI A;  4QTT A;  1X3Z A;  1K83 I;  1KRL A;  2WB1 A;  2QA4 Z;  5LL6 f;  5IT9 f;  2OTL 1;  2RBL A;  4NBB A;  3CC4 1;  5AN9 F;  5T64 A;  3J7A 4;  1K9M 2;  1YIT 1;  4DK1 A;  1SIW A;  1SFO I;  1S7M A;  3T4N B;  3GCF A;  1QVG Y;  2WAQ A;  3CMA 1;  3M4O I;  5D1P A;  4A93 I;  1YJN 1;  3GTJ I;  1ZB8 A;  4BY7 I;  3G4S 1;  3I4N I;  3J80 f;  1WII A;  3JAM f;  1VQK 1;  2JIO A;  1X0T A;  3GTM I;  3TE5 B;  4AYB A;  2E2I I;  3S17 I;  3P5J B;  2Y0S A;  3CCV 1;  2NVQ I;  4DGL A;  2JUB A;  1W2B Y;  1VQO Z;  3M3Y I;  1L1O C;  5A2Q f;  2NVY I;  1USP B;  3PO3 S;  3BG1 B;  3I55 Z;  1Y1V I;  5FLX b;  4A3F I;  2F4O A;  1S72 1;  2V8I A;  2R92 I;  3CCR 1;  3G6E 1;  2VPY A;  2DE7 A;  2BJO A;  2GTH A;  4MD8 A;  2W04 A;  1JWH C;  1YI2 Z;  2EGT A;  5FLM I;  2JA5 I;  3CCE 1;  4MD9 A;  3EED A;  3CPW Z;  2LIY A;  3K7A I;  2JNY A;  2R6M A;  1LQL A;  1VQ5 1;  3RZO I;  1VQ9 1;  4S1T A;  1YJ9 1;  2JA6 I;  2QLV B;  3OW2 Y;  2Q51 A;  2QEX Z;  3G71 1;  1VLA A;  3CCQ 1;  4BY1 I;  2K3R A;  3IFU A;  1YHQ 1;  2Q4Z A;  1YIJ 1;  3MZL B;  4CL1 A;  2VPX A;  3RZD I;  4BBR I;  5IT9 b;  3H3V J;  1Z02 A;  2HF1 A;  3J81 f;  4A3E I;  2NAP A;  3QWU A;  3CD6 Z;  1Q82 1;  3CCU 1;  1VQ7 1;  4E2W A;  1ZH1 A;  4A3K I;  3VMH A;  3NH8 A;  1VQ4 Z;  2YU9 I;  2NVX I;  1YUK A;  1NJI 2;  2OOX B;  1RO0 A;  3J80 b;  1RQF A;  3JAM b;  1Q82 2;  4A3L I;  1USP A;  2HU9 A;  4NBA A;  3GTM S;  3I56 1;  4NB8 A;  3D2L A;  4EWC A;  3D9X A;  3IR7 A;  2QRD B;  4NB9 A;  2QA4 1;  1K9M 1;  4RVH A;  1RO2 A;  2LFU A;  3CPW Y;  4MXU A;  5A2Q b;  1X3W A;  2E2J I;  1Y1V S;  2O53 A;  2JR6 A;  3S14 I;  2PK7 A;  4QTU A;  2P3Y A;  3VMG A;  1QXF A;  1JJ2 Z;  2JIQ A;  4HGZ A;  3CCS Z;  1Q86 2;  3S1N I;  1TWF I;  2M6N A;  3CCL Z;  2B63 I;  4A3G I;  2JS4 A;  3OW2 Z;  4NBF A;  1NP6 A;  4E30 A;  1VQN Z;  1VQ8 Z;  4A3B I;  1Q16 A;  2YAD A;  1VQO 1;  2E7Z A;  3Q87 A;  3KIH A;  3VTN A;  4HGY A;  3HOV I;  1TWH I;  4TNU A;  3CCJ 1;  3I55 1;  1N8R 2;  4XX2 A;  1VQ6 Z;  3F3P C;  3HOU I;  2VPW A;  3I4M I;  3GTQ I;  4NFR A;  3MON A;  3FQM A;  3J81 b;  2V8J A;  4NBE A;  3D6W A;  1YI2 1;  4A3D I;  3EER A;  4X6A I;  3PO2 I;  1TWA I;  3NH4 A;  1K8A 1;  4E33 A;  2ZAE B;  3CME Z;  2E9H A;  3FQQ A;  1JJ2 Y;  1FDI A;  2GTI A;  1S72 Z;  1PFT A;  2R7Z I;  2QEX 1;  1K8A 2;  2RIQ A;  2JIP A;  3CCR Z;  3G6E Z;  4DQY B;  4HH4 A;  1RLY A;  5D1O B;  2G2K A;  2AKL A;  3S1R I;  3CC2 Z;  4E2Z A;  2OTJ Z;  1P9N A;  1VQM Z;  2JA7 I;  3CCE Z;  3CD6 1;  2QR1 B;  3NDJ A;  3LUS A;  1NJI 1;  2K5R A;  1YJW 1;  3VB9 A;  3I07 A;  1VQ5 Z;  3F3F C;  1VQP Z;  3S2D I;  1VQ9 Z;  1VQ4 1;  4A3C I;  1NUI A;  3CC7 1;  1WW9 A;  1QF8 A;  1Y8C A;  4NOZ A;  3S2H I;  2JA8 I;  2QRC B;  4E31 A;  4NBC A;  1R9T I;  2RHB A;  1FDO A;  4Y7N I;  2J6A A;  3GTG I;  1TWG I;  4Y52 I;  1Q81 2;  1RO4 A;  3CCM Z;  2JMO A;  3HOX I;  3HOY I;  2PM9 A;  5T6B A;  1Z01 A;  1VQL Z;  4A3M I;  1Q7Y 2;  4RVD A;  4MH4 A;  2KI7 B;  5CM2 M;  2V45 A;  1Q86 1;  2IZ3 A;  2P28 A;  3ESW A;  3CCS 1;  4BBS I;  3GTK I;  3NDI A;  1ML8 A;  3MZK B;  2V3V A;  3CCL 1;  3I56 Z;  1M90 1;  2VUM I;  2DE6 A;  4RV9 A;  3HKZ A;  4E32 A;  2F4M A;  1VQN 1;  1VQ8 1;  5D1O A;  2R93 I;  1M90 2;  2OTL Z;  3HOZ I;  1N8R 1;  2VF1 A;  3CQZ I;  2JIM A;  2H85 A;  3CC4 Z;  2VPZ A;  1YIT Z;  1VQ6 1;  2NVT I;  3CMA Z;  4NH1 C;  5C3E I;  2V8K A;  1I6H I;  1YJN Z;  4RS4 A;  1KQS Z;  1YUA A;  3G4S Z;  5C4X I;  4RVF A;  1TWC I;  1VQK Z;  1Z03 A;  1RNI A;  3HOW I;  1DL6 A;  3CCV Z;  2OZK A;  3CXC Y;  2W03 A;  3CME 1;  3S1Q I;  4NBD A;  3CCJ Z;  2RPR A;  1N2F A;  1Y1W I;  2RT9 A;  2AYD A;  3IX0 A;  1KC8 1;  5T67 A;  3IF8 A;  1I50 I;  2VUG A;  1QVF Z;  3S1M I;  1WZN A;  2I3C A;  3NFZ A; 
#chains in the Genus database with same CATH homology
 3CC2 1;  1WCM I;  2GU2 A;  3GTP I;  4MD7 A;  1I3Q I;  2OTJ 1;  5C44 I;  1VQM 1;  1KC8 2;  4E2X A;  1ZB9 A;  3BG0 B;  1VQP 1;  2DE5 A;  2IZ4 A;  3NH5 A;  4BXX I;  2QRE B;  3FKI I;  5IP9 I;  1QYP A;  1Q81 1;  3GTO I;  2OOY B;  4RVG A;  1YJ9 Z;  1QVG Z;  3U50 C;  1KQS Y;  3PO3 I;  5FLX f;  5C4J I;  3G71 Z;  2KPI A;  1KD1 1;  3CCQ Z;  1YHQ Z;  4A3I I;  1YIJ Z;  3VMI A;  1Q7Y 1;  1M1K 1;  3CCM 1;  3GKQ A;  3TDH B;  1VQL 1;  1K73 1;  1TFI A;  1KD1 2;  4NBH A;  1YJW Z;  2O4H A;  2PMZ A;  1M1K 2;  2QKD A;  3CCU Z;  3GTL I;  1VQ7 Z;  4NBG A;  1W2B Z;  4A3J I;  5IP7 I;  3CC7 Z;  3H0G I;  4E2Y A;  2M48 A;  3CXC Z;  3KIF A;  3S16 I;  1K73 2;  2E2H I;  4MON A;  1QVF Y;  3S15 I;  4MRI A;  4QTT A;  1X3Z A;  1K83 I;  1KRL A;  2WB1 A;  2QA4 Z;  5LL6 f;  5IT9 f;  2OTL 1;  2RBL A;  4NBB A;  3CC4 1;  5AN9 F;  5T64 A;  3J7A 4;  1K9M 2;  1YIT 1;  4DK1 A;  1SFO I;  1S7M A;  3T4N B;  3GCF A;  1QVG Y;  2WAQ A;  3CMA 1;  3M4O I;  5D1P A;  4A93 I;  1YJN 1;  3GTJ I;  1ZB8 A;  4BY7 I;  3G4S 1;  3I4N I;  3J80 f;  1WII A;  3JAM f;  1VQK 1;  1X0T A;  3GTM I;  3TE5 B;  4AYB A;  2E2I I;  3S17 I;  3P5J B;  2Y0S A;  3CCV 1;  2NVQ I;  4DGL A;  2JUB A;  1W2B Y;  1VQO Z;  3M3Y I;  1L1O C;  5A2Q f;  2NVY I;  1USP B;  3PO3 S;  3BG1 B;  3I55 Z;  1Y1V I;  5FLX b;  4A3F I;  2F4O A;  1S72 1;  2V8I A;  2R92 I;  3CCR 1;  3G6E 1;  2DE7 A;  2BJO A;  2GTH A;  4MD8 A;  2W04 A;  1JWH C;  1YI2 Z;  2EGT A;  5FLM I;  2JA5 I;  3CCE 1;  4MD9 A;  3EED A;  3CPW Z;  2LIY A;  3K7A I;  2JNY A;  2R6M A;  1LQL A;  1VQ5 1;  3RZO I;  1VQ9 1;  4S1T A;  1YJ9 1;  2JA6 I;  2QLV B;  3OW2 Y;  2Q51 A;  2QEX Z;  3G71 1;  1VLA A;  3CCQ 1;  4BY1 I;  2K3R A;  3IFU A;  1YHQ 1;  2Q4Z A;  1YIJ 1;  3MZL B;  4CL1 A;  3RZD I;  4BBR I;  5IT9 b;  3H3V J;  1Z02 A;  2HF1 A;  3J81 f;  4A3E I;  3QWU A;  3CD6 Z;  1Q82 1;  3CCU 1;  1VQ7 1;  4E2W A;  1ZH1 A;  4A3K I;  3VMH A;  3NH8 A;  1VQ4 Z;  2YU9 I;  2NVX I;  1YUK A;  1NJI 2;  2OOX B;  1RO0 A;  3J80 b;  1RQF A;  3JAM b;  1Q82 2;  4A3L I;  1USP A;  2HU9 A;  4NBA A;  3GTM S;  3I56 1;  4NB8 A;  4EWC A;  3D9X A;  2QRD B;  4NB9 A;  2QA4 1;  1K9M 1;  4RVH A;  1RO2 A;  2LFU A;  3CPW Y;  4MXU A;  5A2Q b;  1X3W A;  2E2J I;  1Y1V S;  2O53 A;  2JR6 A;  3S14 I;  2PK7 A;  4QTU A;  2P3Y A;  3VMG A;  1JJ2 Z;  4HGZ A;  3CCS Z;  1Q86 2;  3S1N I;  1TWF I;  2M6N A;  3CCL Z;  2B63 I;  4A3G I;  2JS4 A;  3OW2 Z;  4NBF A;  1NP6 A;  4E30 A;  1VQN Z;  1VQ8 Z;  4A3B I;  2YAD A;  1VQO 1;  3Q87 A;  3KIH A;  3VTN A;  4HGY A;  3HOV I;  1TWH I;  4TNU A;  3CCJ 1;  3I55 1;  1N8R 2;  4XX2 A;  1VQ6 Z;  3F3P C;  3HOU I;  3I4M I;  3GTQ I;  4NFR A;  3MON A;  3FQM A;  3J81 b;  2V8J A;  4NBE A;  3D6W A;  1YI2 1;  4A3D I;  3EER A;  4X6A I;  3PO2 I;  1TWA I;  3NH4 A;  1K8A 1;  4E33 A;  2ZAE B;  3CME Z;  2E9H A;  3FQQ A;  1JJ2 Y;  2GTI A;  1S72 Z;  1PFT A;  2R7Z I;  2QEX 1;  1K8A 2;  2RIQ A;  3CCR Z;  3G6E Z;  4DQY B;  4HH4 A;  1RLY A;  5D1O B;  2G2K A;  2AKL A;  3S1R I;  3CC2 Z;  4E2Z A;  2OTJ Z;  1P9N A;  1VQM Z;  2JA7 I;  3CCE Z;  3CD6 1;  2QR1 B;  3NDJ A;  3LUS A;  1NJI 1;  2K5R A;  1YJW 1;  3VB9 A;  3I07 A;  1VQ5 Z;  3F3F C;  1VQP Z;  3S2D I;  1VQ9 Z;  1VQ4 1;  4A3C I;  1NUI A;  3CC7 1;  1WW9 A;  1QF8 A;  4NOZ A;  3S2H I;  2JA8 I;  2QRC B;  4E31 A;  4NBC A;  1R9T I;  2RHB A;  4Y7N I;  2J6A A;  3GTG I;  1TWG I;  4Y52 I;  1Q81 2;  1RO4 A;  3CCM Z;  2JMO A;  3HOX I;  3HOY I;  2PM9 A;  5T6B A;  1Z01 A;  1VQL Z;  4A3M I;  1Q7Y 2;  4RVD A;  4MH4 A;  2KI7 B;  5CM2 M;  1Q86 1;  2IZ3 A;  2P28 A;  3ESW A;  3CCS 1;  4BBS I;  3GTK I;  3NDI A;  1ML8 A;  3MZK B;  3CCL 1;  3I56 Z;  1M90 1;  2VUM I;  2DE6 A;  4RV9 A;  3HKZ A;  4E32 A;  2F4M A;  1VQN 1;  1VQ8 1;  5D1O A;  2R93 I;  1M90 2;  2OTL Z;  3HOZ I;  1N8R 1;  2VF1 A;  3CQZ I;  2H85 A;  3CC4 Z;  1YIT Z;  1VQ6 1;  2NVT I;  3CMA Z;  4NH1 C;  5C3E I;  2V8K A;  1I6H I;  1YJN Z;  4RS4 A;  1KQS Z;  1YUA A;  3G4S Z;  5C4X I;  4RVF A;  1TWC I;  1VQK Z;  1Z03 A;  1RNI A;  3HOW I;  1DL6 A;  3CCV Z;  2OZK A;  3CXC Y;  2W03 A;  3CME 1;  3S1Q I;  4NBD A;  3CCJ Z;  2RPR A;  1N2F A;  1Y1W I;  2RT9 A;  3IX0 A;  1KC8 1;  5T67 A;  3IF8 A;  1I50 I;  2VUG A;  1QVF Z;  3S1M I;  2I3C A;  3NFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...