1M902

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1m90200
1VQM1 1VQMZ 3CPWY 3CC71 2QEX1 3CC7Z 2QEXZ 1QVFY 3CCJ1 3CCS1 3CCSZ 1K8A2 2OTJ1 2OTJZ 1Q7Y2 1NJI2 1Q861 1VQ51 1VQ5Z 3CXCY 1S721 1S72Z 3CCL1 3CCLZ 3CCQ1 1VQO1 3CCQZ 1VQOZ 3CCM1 1Q821 3CXCZ 3CCMZ 1M902 1Q812 1KD11 1VQ71 1VQ7Z 1M1K1 3CD61 3I551 3CD6Z 3I55Z 1K9M2 2QA41 2QA4Z 3CMA1 3CMAZ 1VQN1 1VQNZ 1KC81 3CC41 3CC4Z 1Q7Y1 3I561 3G711 3I56Z 3G71Z 1YIJ1 1YIJZ 3CCV1 3CCVZ 1N8R2 3CCU1 1YHQ1 3CCUZ 1YHQZ 3CCR1 3CCE1 3CCRZ 3CCEZ 1YJ91 1YJ9Z 1K732 1YI21 1Q822 1YI2Z 1VQP1 1VQPZ 1Q811 1QVGZ 3G6E1 3G6EZ 1M1K2 1JJ2Y 3OW2Y 1KQSY 1K8A1 1YJW1 1YJWZ 1JJ2Z 3OW2Z 3CC21 3CC2Z 1NJI1 1KQSZ 3CPWZ 1VQ91 1VQ9Z 1VQ61 1VQ6Z 2OTL1 2OTLZ 3CME1 3CMEZ 1YJN1 3CCJZ 1YJNZ 1Q862 1KC82 1QVFZ 3G4S1 3G4SZ 1QVGY 1YIT1 1YITZ 1N8R1 1VQ41 1VQ4Z 1M901 1VQ81 1W2BY 1VQ8Z 1W2BZ 1KD12 1VQK1 1VQKZ 1VQL1 1VQLZ 1K731 1K9M1
chains in the Genus database with same CATH superfamily
1VQM1 2JIRA 1TWFI 1X3ZA 3GTJI 3CCJ1 3CCSZ 2Q51A 2OTJ1 1Q7Y2 2R93I 3I4NI 4Y52I 1VQ5Z 5C44I 2QLVB 2K3RA 3CCLZ 1VQO1 1ML8A 3CCM1 5T67A 2JNYA 2VPZA 4CL1A 2JS4A 1VQ71 2NVXI 2F4OA 4NBCA 3S1RI 2HF1A 3GTOI 4HGZA 4AYBA 2ZAEB 4DK1A 2QREB 5IP7I 3GTLI 3CMAZ 1TWCI 1RO0A 4DQYB 1RLYA 2OZKA 4HGYA 3I561 1YIJ1 3G71Z 3S1NI 2J6AA 5CM2M 3CCVZ 2V8KA 1TFIA 2YU9I 1YJ91 2JR6A 1YUAA 3S15I 1VQPZ 1Q811 1R9TI 2WAQA 3GTMS 3J80f 2VPXA 1JJ2Z 2IV2X 2V3VA 4Y7NI 2LIYA 2E9HA 3JAMf 3CPWZ 1VQ9Z 1VQ61 5IT9b 2OTL1 1ZH1A 3VMHA 2JIMA 4E32A 4E2ZA 2G2KA 3CCJZ 1Q862 3HOZI 1QVFZ 3G4S1 4X6AI 2YADA 1QVGY 2R7ZI 3IR7A 1VQ4Z 2NAPA 2KPIA 2Q4ZA 1W2BZ 1KD12 1VQK1 1VQL1 3P5JB 3TE5B 2RHBA 1K9M1 3HKZA 2VF1A 3KIHA 4MXUA 2AKLA 2QEX1 3CC7Z 4A3FI 3IFUA 3VMGA 4NBGA 4RV9A 1FDOA 4E2WA 3GTQI 3GTGI 4A3MI 1K83I 2EGTA 5IP9I 1WIIA 4A3JI 4EWCA 3NDJA 1S72Z 3S2HI 4MD8A 3CCQZ 2OOXB 3M4OI 3PO3S 1Q16A 4NBAA 1Y8CA 1M1K1 2W04A 3I55Z 3CD6Z 2QRDB 3HOXI 2GU2A 4NBEA 2JIPA 1K9M2 4NOZA 3J81b 2RT9A 2QA41 4A3GI 2AYDA 3HOYI 2PK7A 1VQN1 4NBHA 1QYPA 5FLXb 1Z01A 2VPWA 3VB9A 3CC4Z 5AN9F 3GCFA 1RQFA 3FQMA 3VTNA 3D2LA 3PO3I 1YHQ1 2LFUA 3CCUZ 3RZOI 3RZDI 3CCRZ 3CCEZ 4MD9A 3BG1B 5C4JI 1K732 1YI21 2V8IA 2DE5A 4BY1I 3F3FC 4A3EI 3T4NB 3K7AI 4MRIA 1RO4A 3G6EZ 3S2DI 1M1K2 1AA6A 1JJ2Y 3Q87A 2LEXA 1K8A1 1YJWZ 3CC2Z 1NJI1 1Y1VS 1KRLA 1QXFA 1ZB8A 4NB9A 1KQSZ 3CME1 5LL6f 1YJN1 2OOYB 2QRCB 2RBLA 4A3II 3D6WA 1YIT1 1N8R1 1M901 2NVQI 1W2BY 1VQ8Z 4RVFA 2Y0SA 5C4XI 2JA8I 5T6BA 1VQMZ 3FQQA 5A2Qb 2KI7B 2O4HA 1RO2A 3NH5A 1S7MA 4E2XA 3GTKI 3VMIA 3GKQA 4A3LI 2JMOA 3CCS1 1SFOI 1K8A2 2OTJZ 1NJI2 1RNIA 4NFRA 1VQ51 1TWAI 4A3BI 3NDIA 3CCL1 1VQOZ 2VUMI 2GTIA 3CXCZ 3CCMZ 3IF8A 4RVDA 1P9NA 3J7A4 2R92I 1M902 3GTMI 1Q812 5D1PA 3S1MI 3I4MI 1VQ7Z 2M6NA 4QTUA 2NVYI 4NB8A 5IT9f 3LUSA 4A3KI 1Z03A 3CMA1 1TWGI 4A3CI 4BBRI 3H3VJ 1WZNA 2JA5I 3NFZA 2E2II 1Q7Y1 3G711 3I56Z 1YIJZ 3CCV1 4A93I 1USPA 4BXXI 3M3YI 1YJ9Z 5D1OA 2R6MA 1WCMI 3U50C 1VQP1 4TNUA 1QVGZ 3ESWA 2JA6I 4E30A 1KQSY 1TWHI 3OW2Z 3MZKB 4E31A 4BY7I 1VQ91 3MONA 1VQ6Z 2OTLZ 3EERA 4RS4A 3CQZI 5FLMI 2QKDA 5C3EI 3G4SZ 2JIOA 5T64A 1VQ41 1NP6A 2NVTI 2I3CA 4MD7A 2V45A 1VQKZ 3J81f 1VQLZ 2JIQA 3BG0B 3S17I 3CPWY 1SIWA 3HOWI 3CC71 2QEXZ 2K5RA 5FLXf 2BJOA 4MH4A 2V8JA 1QVFY 1X0TA 2IZ4A 2E2HI 2E2JI 3I07A 4QTTA 4XX2A 3GTPI 4E2YA 1WJ2A 4NH1C 2WB1A 3J80b 1L1OC 4HH4A 4NBDA 2PM9A 4S1TA 1Q861 1ZB9A 3CXCY 1S721 1LQLA 3FKII 3JAMb 3CCQ1 1Z02A 2JA7I 1Q821 2JUBA 2DE6A 1DL6A 3TDHB 1KD11 1JWHC 1QF8A 2IZ3A 1Y1VI 2HU9A 4DGLA 3CD61 3I551 4NBFA 2VUGA 2QA4Z 1VQNZ 1USPB 1KC81 3S1QI 2P28A 2PMZA 3CC41 3S14I 2RPRA 3MZLB 3NH4A 4A3DI 1VLAA 5D1OB 2RIQA 2VPYA 1N8R2 3NH8A 3S16I 2M48A 3CCU1 1YHQZ 3CCR1 2F4MA 3CCE1 5A2Qf 3QWUA 4NBBA 3PO2I 3EEDA 1FDIA 1X3WA 1Q822 1YUKA 1YI2Z 1I3QI 2P3YA 2QR1B 3HOVI 3G6E1 3OW2Y 1NUIA 4BBSI 4RVHA 3KIFA 1WW9A 3D9XA 1YJW1 3CC21 4E33A 2DE7A 2E7ZA 2GTHA 1I6HI 3CMEZ 1YJNZ 2W03A 1N2FA 1KC82 3HOUI 3F3PC 4MONA 1YITZ 1I50I 2B63I 2H85A 1VQ81 3IX0A 2O53A 1Y1WI 1PFTA 4RVGA 1K731 3H0GI
chains in the Genus database with same CATH topology
1VQM1 1TWFI 1X3ZA 3GTJI 3CCJ1 3CCSZ 2Q51A 2OTJ1 1Q7Y2 2R93I 3I4NI 4Y52I 1VQ5Z 5C44I 2QLVB 2K3RA 3CCLZ 1VQO1 1ML8A 3CCM1 5T67A 2JNYA 4CL1A 2JS4A 1VQ71 2NVXI 2F4OA 4NBCA 3S1RI 2HF1A 3GTOI 4HGZA 4AYBA 2ZAEB 4DK1A 2QREB 5IP7I 3GTLI 3CMAZ 1TWCI 1RO0A 4DQYB 1RLYA 2OZKA 4HGYA 3I561 1YIJ1 3G71Z 3S1NI 2J6AA 5CM2M 3CCVZ 2V8KA 1TFIA 2YU9I 1YJ91 2JR6A 1YUAA 3S15I 1VQPZ 1Q811 1R9TI 2WAQA 3GTMS 3J80f 1JJ2Z 4Y7NI 2LIYA 2E9HA 3JAMf 3CPWZ 1VQ9Z 1VQ61 5IT9b 2OTL1 1ZH1A 3VMHA 4E32A 4E2ZA 2G2KA 3CCJZ 1Q862 3HOZI 1QVFZ 3G4S1 4X6AI 2YADA 1QVGY 2R7ZI 1VQ4Z 2KPIA 2Q4ZA 1W2BZ 1KD12 1VQK1 1VQL1 3P5JB 3TE5B 2RHBA 1K9M1 3HKZA 2VF1A 3KIHA 4MXUA 2AKLA 2QEX1 3CC7Z 4A3FI 3IFUA 3VMGA 4NBGA 4RV9A 4E2WA 3GTQI 3GTGI 4A3MI 1K83I 2EGTA 5IP9I 1WIIA 4A3JI 4EWCA 3NDJA 1S72Z 3S2HI 4MD8A 3CCQZ 2OOXB 3M4OI 3PO3S 4NBAA 1M1K1 2W04A 3I55Z 3CD6Z 2QRDB 3HOXI 2GU2A 4NBEA 1K9M2 4NOZA 3J81b 2RT9A 2QA41 4A3GI 3HOYI 2PK7A 1VQN1 4NBHA 1QYPA 5FLXb 1Z01A 3VB9A 3CC4Z 5AN9F 3GCFA 1RQFA 3FQMA 3VTNA 3PO3I 1YHQ1 2LFUA 3CCUZ 3RZOI 3RZDI 3CCRZ 3CCEZ 4MD9A 3BG1B 5C4JI 1K732 1YI21 2V8IA 2DE5A 4BY1I 3F3FC 4A3EI 3T4NB 3K7AI 4MRIA 1RO4A 3G6EZ 3S2DI 1M1K2 1JJ2Y 3Q87A 1K8A1 1YJWZ 3CC2Z 1NJI1 1Y1VS 1KRLA 4NB9A 1ZB8A 1KQSZ 3CME1 5LL6f 1YJN1 2OOYB 2QRCB 2RBLA 4A3II 3D6WA 1YIT1 1N8R1 1M901 2NVQI 1W2BY 1VQ8Z 4RVFA 2Y0SA 5C4XI 2JA8I 5T6BA 1VQMZ 3FQQA 5A2Qb 2KI7B 2O4HA 1RO2A 3NH5A 1S7MA 4E2XA 3GTKI 3VMIA 3GKQA 4A3LI 2JMOA 3CCS1 1SFOI 1K8A2 2OTJZ 1NJI2 1RNIA 4NFRA 1VQ51 1TWAI 4A3BI 3NDIA 3CCL1 1VQOZ 2VUMI 2GTIA 3CXCZ 3CCMZ 3IF8A 4RVDA 1P9NA 3J7A4 2R92I 1M902 3GTMI 1Q812 5D1PA 3S1MI 3I4MI 1VQ7Z 2M6NA 4QTUA 2NVYI 4NB8A 5IT9f 3LUSA 4A3KI 1Z03A 3CMA1 1TWGI 4A3CI 4BBRI 3H3VJ 2JA5I 3NFZA 2E2II 1Q7Y1 3G711 3I56Z 1YIJZ 3CCV1 4A93I 1USPA 4BXXI 3M3YI 1YJ9Z 5D1OA 2R6MA 1WCMI 3U50C 1VQP1 4TNUA 1QVGZ 3ESWA 2JA6I 4E30A 1KQSY 1TWHI 3OW2Z 3MZKB 4E31A 4BY7I 1VQ91 3MONA 1VQ6Z 2OTLZ 3EERA 4RS4A 3CQZI 5FLMI 2QKDA 5C3EI 3G4SZ 5T64A 1VQ41 1NP6A 2NVTI 2I3CA 4MD7A 1VQKZ 3J81f 1VQLZ 3BG0B 3S17I 3CPWY 3HOWI 3CC71 2QEXZ 2K5RA 5FLXf 2BJOA 4MH4A 2V8JA 1QVFY 1X0TA 2IZ4A 2E2HI 2E2JI 3I07A 4QTTA 4XX2A 3GTPI 4E2YA 4NH1C 2WB1A 3J80b 1L1OC 4HH4A 4NBDA 2PM9A 4S1TA 1Q861 1ZB9A 3CXCY 1S721 1LQLA 3FKII 3JAMb 3CCQ1 1Z02A 2JA7I 1Q821 2JUBA 2DE6A 1DL6A 3TDHB 1KD11 1JWHC 1QF8A 2IZ3A 1Y1VI 2HU9A 4DGLA 3CD61 3I551 4NBFA 2VUGA 2QA4Z 1VQNZ 1USPB 1KC81 3S1QI 2P28A 2PMZA 3CC41 3S14I 2RPRA 3MZLB 3NH4A 4A3DI 1VLAA 5D1OB 2RIQA 1N8R2 3NH8A 3S16I 2M48A 3CCU1 1YHQZ 3CCR1 2F4MA 3CCE1 5A2Qf 3QWUA 4NBBA 3PO2I 3EEDA 1X3WA 1Q822 1YUKA 1YI2Z 1I3QI 2P3YA 2QR1B 3HOVI 3G6E1 3OW2Y 1NUIA 4BBSI 4RVHA 3KIFA 1WW9A 3D9XA 1YJW1 3CC21 4E33A 2DE7A 2GTHA 1I6HI 3CMEZ 1YJNZ 2W03A 1N2FA 1KC82 3HOUI 3F3PC 4MONA 1YITZ 1I50I 2B63I 2H85A 1VQ81 3IX0A 2O53A 1Y1WI 1PFTA 4RVGA 1K731 3H0GI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM 1;  1VQM Z;  3CPW Y;  3CC7 1;  2QEX 1;  3CC7 Z;  2QEX Z;  1QVF Y;  3CCJ 1;  3CCS 1;  3CCS Z;  1K8A 2;  2OTJ 1;  2OTJ Z;  1Q7Y 2;  1NJI 2;  1Q86 1;  1VQ5 1;  1VQ5 Z;  3CXC Y;  1S72 1;  1S72 Z;  3CCL 1;  3CCL Z;  3CCQ 1;  1VQO 1;  3CCQ Z;  1VQO Z;  3CCM 1;  1Q82 1;  3CXC Z;  3CCM Z;  1M90 2;  1Q81 2;  1KD1 1;  1VQ7 1;  1VQ7 Z;  1M1K 1;  3CD6 1;  3I55 1;  3CD6 Z;  3I55 Z;  1K9M 2;  2QA4 1;  2QA4 Z;  3CMA 1;  3CMA Z;  1VQN 1;  1VQN Z;  1KC8 1;  3CC4 1;  3CC4 Z;  1Q7Y 1;  3I56 1;  3G71 1;  3I56 Z;  3G71 Z;  1YIJ 1;  1YIJ Z;  3CCV 1;  3CCV Z;  1N8R 2;  3CCU 1;  1YHQ 1;  3CCU Z;  1YHQ Z;  3CCR 1;  3CCE 1;  3CCR Z;  3CCE Z;  1YJ9 1;  1YJ9 Z;  1K73 2;  1YI2 1;  1Q82 2;  1YI2 Z;  1VQP 1;  1VQP Z;  1Q81 1;  1QVG Z;  3G6E 1;  3G6E Z;  1M1K 2;  1JJ2 Y;  3OW2 Y;  1KQS Y;  1K8A 1;  1YJW 1;  1YJW Z;  1JJ2 Z;  3OW2 Z;  3CC2 1;  3CC2 Z;  1NJI 1;  1KQS Z;  3CPW Z;  1VQ9 1;  1VQ9 Z;  1VQ6 1;  1VQ6 Z;  2OTL 1;  2OTL Z;  3CME 1;  3CME Z;  1YJN 1;  3CCJ Z;  1YJN Z;  1Q86 2;  1KC8 2;  1QVF Z;  3G4S 1;  3G4S Z;  1QVG Y;  1YIT 1;  1YIT Z;  1N8R 1;  1VQ4 1;  1VQ4 Z;  1M90 1;  1VQ8 1;  1W2B Y;  1VQ8 Z;  1W2B Z;  1KD1 2;  1VQK 1;  1VQK Z;  1VQL 1;  1VQL Z;  1K73 1;  1K9M 1; 
#chains in the Genus database with same CATH topology
 1VQM 1;  2JIR A;  1TWF I;  1X3Z A;  3GTJ I;  3CCJ 1;  3CCS Z;  2Q51 A;  2OTJ 1;  1Q7Y 2;  2R93 I;  3I4N I;  4Y52 I;  1VQ5 Z;  5C44 I;  2QLV B;  2K3R A;  3CCL Z;  1VQO 1;  1ML8 A;  3CCM 1;  5T67 A;  2JNY A;  2VPZ A;  4CL1 A;  2JS4 A;  1VQ7 1;  2NVX I;  2F4O A;  4NBC A;  3S1R I;  2HF1 A;  3GTO I;  4HGZ A;  4AYB A;  2ZAE B;  4DK1 A;  2QRE B;  5IP7 I;  3GTL I;  3CMA Z;  1TWC I;  1RO0 A;  4DQY B;  1RLY A;  2OZK A;  4HGY A;  3I56 1;  1YIJ 1;  3G71 Z;  3S1N I;  2J6A A;  5CM2 M;  3CCV Z;  2V8K A;  1TFI A;  2YU9 I;  1YJ9 1;  2JR6 A;  1YUA A;  3S15 I;  1VQP Z;  1Q81 1;  1R9T I;  2WAQ A;  3GTM S;  3J80 f;  2VPX A;  1JJ2 Z;  2IV2 X;  2V3V A;  4Y7N I;  2LIY A;  2E9H A;  3JAM f;  3CPW Z;  1VQ9 Z;  1VQ6 1;  5IT9 b;  2OTL 1;  1ZH1 A;  3VMH A;  2JIM A;  4E32 A;  4E2Z A;  2G2K A;  3CCJ Z;  1Q86 2;  3HOZ I;  1QVF Z;  3G4S 1;  4X6A I;  2YAD A;  1QVG Y;  2R7Z I;  3IR7 A;  1VQ4 Z;  2NAP A;  2KPI A;  2Q4Z A;  1W2B Z;  1KD1 2;  1VQK 1;  1VQL 1;  3P5J B;  3TE5 B;  2RHB A;  1K9M 1;  3HKZ A;  2VF1 A;  3KIH A;  4MXU A;  2AKL A;  2QEX 1;  3CC7 Z;  4A3F I;  3IFU A;  3VMG A;  4NBG A;  4RV9 A;  1FDO A;  4E2W A;  3GTQ I;  3GTG I;  4A3M I;  1K83 I;  2EGT A;  5IP9 I;  1WII A;  4A3J I;  4EWC A;  3NDJ A;  1S72 Z;  3S2H I;  4MD8 A;  3CCQ Z;  2OOX B;  3M4O I;  3PO3 S;  1Q16 A;  4NBA A;  1Y8C A;  1M1K 1;  2W04 A;  3I55 Z;  3CD6 Z;  2QRD B;  3HOX I;  2GU2 A;  4NBE A;  2JIP A;  1K9M 2;  4NOZ A;  3J81 b;  2RT9 A;  2QA4 1;  4A3G I;  2AYD A;  3HOY I;  2PK7 A;  1VQN 1;  4NBH A;  1QYP A;  5FLX b;  1Z01 A;  2VPW A;  3VB9 A;  3CC4 Z;  5AN9 F;  3GCF A;  1RQF A;  3FQM A;  3VTN A;  3D2L A;  3PO3 I;  1YHQ 1;  2LFU A;  3CCU Z;  3RZO I;  3RZD I;  3CCR Z;  3CCE Z;  4MD9 A;  3BG1 B;  5C4J I;  1K73 2;  1YI2 1;  2V8I A;  2DE5 A;  4BY1 I;  3F3F C;  4A3E I;  3T4N B;  3K7A I;  4MRI A;  1RO4 A;  3G6E Z;  3S2D I;  1M1K 2;  1AA6 A;  1JJ2 Y;  3Q87 A;  2LEX A;  1K8A 1;  1YJW Z;  3CC2 Z;  1NJI 1;  1Y1V S;  1KRL A;  1QXF A;  1ZB8 A;  4NB9 A;  1KQS Z;  3CME 1;  5LL6 f;  1YJN 1;  2OOY B;  2QRC B;  2RBL A;  4A3I I;  3D6W A;  1YIT 1;  1N8R 1;  1M90 1;  2NVQ I;  1W2B Y;  1VQ8 Z;  4RVF A;  2Y0S A;  5C4X I;  2JA8 I;  5T6B A;  1VQM Z;  3FQQ A;  5A2Q b;  2KI7 B;  2O4H A;  1RO2 A;  3NH5 A;  1S7M A;  4E2X A;  3GTK I;  3VMI A;  3GKQ A;  4A3L I;  2JMO A;  3CCS 1;  1SFO I;  1K8A 2;  2OTJ Z;  1NJI 2;  1RNI A;  4NFR A;  1VQ5 1;  1TWA I;  4A3B I;  3NDI A;  3CCL 1;  1VQO Z;  2VUM I;  2GTI A;  3CXC Z;  3CCM Z;  3IF8 A;  4RVD A;  1P9N A;  3J7A 4;  2R92 I;  1M90 2;  3GTM I;  1Q81 2;  5D1P A;  3S1M I;  3I4M I;  1VQ7 Z;  2M6N A;  4QTU A;  2NVY I;  4NB8 A;  5IT9 f;  3LUS A;  4A3K I;  1Z03 A;  3CMA 1;  1TWG I;  4A3C I;  4BBR I;  3H3V J;  1WZN A;  2JA5 I;  3NFZ A;  2E2I I;  1Q7Y 1;  3G71 1;  3I56 Z;  1YIJ Z;  3CCV 1;  4A93 I;  1USP A;  4BXX I;  3M3Y I;  1YJ9 Z;  5D1O A;  2R6M A;  1WCM I;  3U50 C;  1VQP 1;  4TNU A;  1QVG Z;  3ESW A;  2JA6 I;  4E30 A;  1KQS Y;  1TWH I;  3OW2 Z;  3MZK B;  4E31 A;  4BY7 I;  1VQ9 1;  3MON A;  1VQ6 Z;  2OTL Z;  3EER A;  4RS4 A;  3CQZ I;  5FLM I;  2QKD A;  5C3E I;  3G4S Z;  2JIO A;  5T64 A;  1VQ4 1;  1NP6 A;  2NVT I;  2I3C A;  4MD7 A;  2V45 A;  1VQK Z;  3J81 f;  1VQL Z;  2JIQ A;  3BG0 B;  3S17 I;  3CPW Y;  1SIW A;  3HOW I;  3CC7 1;  2QEX Z;  2K5R A;  5FLX f;  2BJO A;  4MH4 A;  2V8J A;  1QVF Y;  1X0T A;  2IZ4 A;  2E2H I;  2E2J I;  3I07 A;  4QTT A;  4XX2 A;  3GTP I;  4E2Y A;  1WJ2 A;  4NH1 C;  2WB1 A;  3J80 b;  1L1O C;  4HH4 A;  4NBD A;  2PM9 A;  4S1T A;  1Q86 1;  1ZB9 A;  3CXC Y;  1S72 1;  1LQL A;  3FKI I;  3JAM b;  3CCQ 1;  1Z02 A;  2JA7 I;  1Q82 1;  2JUB A;  2DE6 A;  1DL6 A;  3TDH B;  1KD1 1;  1JWH C;  1QF8 A;  2IZ3 A;  1Y1V I;  2HU9 A;  4DGL A;  3CD6 1;  3I55 1;  4NBF A;  2VUG A;  2QA4 Z;  1VQN Z;  1USP B;  1KC8 1;  3S1Q I;  2P28 A;  2PMZ A;  3CC4 1;  3S14 I;  2RPR A;  3MZL B;  3NH4 A;  4A3D I;  1VLA A;  5D1O B;  2RIQ A;  2VPY A;  1N8R 2;  3NH8 A;  3S16 I;  2M48 A;  3CCU 1;  1YHQ Z;  3CCR 1;  2F4M A;  3CCE 1;  5A2Q f;  3QWU A;  4NBB A;  3PO2 I;  3EED A;  1FDI A;  1X3W A;  1Q82 2;  1YUK A;  1YI2 Z;  1I3Q I;  2P3Y A;  2QR1 B;  3HOV I;  3G6E 1;  3OW2 Y;  1NUI A;  4BBS I;  4RVH A;  3KIF A;  1WW9 A;  3D9X A;  1YJW 1;  3CC2 1;  4E33 A;  2DE7 A;  2E7Z A;  2GTH A;  1I6H I;  3CME Z;  1YJN Z;  2W03 A;  1N2F A;  1KC8 2;  3HOU I;  3F3P C;  4MON A;  1YIT Z;  1I50 I;  2B63 I;  2H85 A;  1VQ8 1;  3IX0 A;  2O53 A;  1Y1W I;  1PFT A;  4RVG A;  1K73 1;  3H0G I; 
#chains in the Genus database with same CATH homology
 1VQM 1;  1TWF I;  1X3Z A;  3GTJ I;  3CCJ 1;  3CCS Z;  2Q51 A;  2OTJ 1;  1Q7Y 2;  2R93 I;  3I4N I;  4Y52 I;  1VQ5 Z;  5C44 I;  2QLV B;  2K3R A;  3CCL Z;  1VQO 1;  1ML8 A;  3CCM 1;  5T67 A;  2JNY A;  4CL1 A;  2JS4 A;  1VQ7 1;  2NVX I;  2F4O A;  4NBC A;  3S1R I;  2HF1 A;  3GTO I;  4HGZ A;  4AYB A;  2ZAE B;  4DK1 A;  2QRE B;  5IP7 I;  3GTL I;  3CMA Z;  1TWC I;  1RO0 A;  4DQY B;  1RLY A;  2OZK A;  4HGY A;  3I56 1;  1YIJ 1;  3G71 Z;  3S1N I;  2J6A A;  5CM2 M;  3CCV Z;  2V8K A;  1TFI A;  2YU9 I;  1YJ9 1;  2JR6 A;  1YUA A;  3S15 I;  1VQP Z;  1Q81 1;  1R9T I;  2WAQ A;  3GTM S;  3J80 f;  1JJ2 Z;  4Y7N I;  2LIY A;  2E9H A;  3JAM f;  3CPW Z;  1VQ9 Z;  1VQ6 1;  5IT9 b;  2OTL 1;  1ZH1 A;  3VMH A;  4E32 A;  4E2Z A;  2G2K A;  3CCJ Z;  1Q86 2;  3HOZ I;  1QVF Z;  3G4S 1;  4X6A I;  2YAD A;  1QVG Y;  2R7Z I;  1VQ4 Z;  2KPI A;  2Q4Z A;  1W2B Z;  1KD1 2;  1VQK 1;  1VQL 1;  3P5J B;  3TE5 B;  2RHB A;  1K9M 1;  3HKZ A;  2VF1 A;  3KIH A;  4MXU A;  2AKL A;  2QEX 1;  3CC7 Z;  4A3F I;  3IFU A;  3VMG A;  4NBG A;  4RV9 A;  4E2W A;  3GTQ I;  3GTG I;  4A3M I;  1K83 I;  2EGT A;  5IP9 I;  1WII A;  4A3J I;  4EWC A;  3NDJ A;  1S72 Z;  3S2H I;  4MD8 A;  3CCQ Z;  2OOX B;  3M4O I;  3PO3 S;  4NBA A;  1M1K 1;  2W04 A;  3I55 Z;  3CD6 Z;  2QRD B;  3HOX I;  2GU2 A;  4NBE A;  1K9M 2;  4NOZ A;  3J81 b;  2RT9 A;  2QA4 1;  4A3G I;  3HOY I;  2PK7 A;  1VQN 1;  4NBH A;  1QYP A;  5FLX b;  1Z01 A;  3VB9 A;  3CC4 Z;  5AN9 F;  3GCF A;  1RQF A;  3FQM A;  3VTN A;  3PO3 I;  1YHQ 1;  2LFU A;  3CCU Z;  3RZO I;  3RZD I;  3CCR Z;  3CCE Z;  4MD9 A;  3BG1 B;  5C4J I;  1K73 2;  1YI2 1;  2V8I A;  2DE5 A;  4BY1 I;  3F3F C;  4A3E I;  3T4N B;  3K7A I;  4MRI A;  1RO4 A;  3G6E Z;  3S2D I;  1M1K 2;  1JJ2 Y;  3Q87 A;  1K8A 1;  1YJW Z;  3CC2 Z;  1NJI 1;  1Y1V S;  1KRL A;  4NB9 A;  1ZB8 A;  1KQS Z;  3CME 1;  5LL6 f;  1YJN 1;  2OOY B;  2QRC B;  2RBL A;  4A3I I;  3D6W A;  1YIT 1;  1N8R 1;  1M90 1;  2NVQ I;  1W2B Y;  1VQ8 Z;  4RVF A;  2Y0S A;  5C4X I;  2JA8 I;  5T6B A;  1VQM Z;  3FQQ A;  5A2Q b;  2KI7 B;  2O4H A;  1RO2 A;  3NH5 A;  1S7M A;  4E2X A;  3GTK I;  3VMI A;  3GKQ A;  4A3L I;  2JMO A;  3CCS 1;  1SFO I;  1K8A 2;  2OTJ Z;  1NJI 2;  1RNI A;  4NFR A;  1VQ5 1;  1TWA I;  4A3B I;  3NDI A;  3CCL 1;  1VQO Z;  2VUM I;  2GTI A;  3CXC Z;  3CCM Z;  3IF8 A;  4RVD A;  1P9N A;  3J7A 4;  2R92 I;  1M90 2;  3GTM I;  1Q81 2;  5D1P A;  3S1M I;  3I4M I;  1VQ7 Z;  2M6N A;  4QTU A;  2NVY I;  4NB8 A;  5IT9 f;  3LUS A;  4A3K I;  1Z03 A;  3CMA 1;  1TWG I;  4A3C I;  4BBR I;  3H3V J;  2JA5 I;  3NFZ A;  2E2I I;  1Q7Y 1;  3G71 1;  3I56 Z;  1YIJ Z;  3CCV 1;  4A93 I;  1USP A;  4BXX I;  3M3Y I;  1YJ9 Z;  5D1O A;  2R6M A;  1WCM I;  3U50 C;  1VQP 1;  4TNU A;  1QVG Z;  3ESW A;  2JA6 I;  4E30 A;  1KQS Y;  1TWH I;  3OW2 Z;  3MZK B;  4E31 A;  4BY7 I;  1VQ9 1;  3MON A;  1VQ6 Z;  2OTL Z;  3EER A;  4RS4 A;  3CQZ I;  5FLM I;  2QKD A;  5C3E I;  3G4S Z;  5T64 A;  1VQ4 1;  1NP6 A;  2NVT I;  2I3C A;  4MD7 A;  1VQK Z;  3J81 f;  1VQL Z;  3BG0 B;  3S17 I;  3CPW Y;  3HOW I;  3CC7 1;  2QEX Z;  2K5R A;  5FLX f;  2BJO A;  4MH4 A;  2V8J A;  1QVF Y;  1X0T A;  2IZ4 A;  2E2H I;  2E2J I;  3I07 A;  4QTT A;  4XX2 A;  3GTP I;  4E2Y A;  4NH1 C;  2WB1 A;  3J80 b;  1L1O C;  4HH4 A;  4NBD A;  2PM9 A;  4S1T A;  1Q86 1;  1ZB9 A;  3CXC Y;  1S72 1;  1LQL A;  3FKI I;  3JAM b;  3CCQ 1;  1Z02 A;  2JA7 I;  1Q82 1;  2JUB A;  2DE6 A;  1DL6 A;  3TDH B;  1KD1 1;  1JWH C;  1QF8 A;  2IZ3 A;  1Y1V I;  2HU9 A;  4DGL A;  3CD6 1;  3I55 1;  4NBF A;  2VUG A;  2QA4 Z;  1VQN Z;  1USP B;  1KC8 1;  3S1Q I;  2P28 A;  2PMZ A;  3CC4 1;  3S14 I;  2RPR A;  3MZL B;  3NH4 A;  4A3D I;  1VLA A;  5D1O B;  2RIQ A;  1N8R 2;  3NH8 A;  3S16 I;  2M48 A;  3CCU 1;  1YHQ Z;  3CCR 1;  2F4M A;  3CCE 1;  5A2Q f;  3QWU A;  4NBB A;  3PO2 I;  3EED A;  1X3W A;  1Q82 2;  1YUK A;  1YI2 Z;  1I3Q I;  2P3Y A;  2QR1 B;  3HOV I;  3G6E 1;  3OW2 Y;  1NUI A;  4BBS I;  4RVH A;  3KIF A;  1WW9 A;  3D9X A;  1YJW 1;  3CC2 1;  4E33 A;  2DE7 A;  2GTH A;  1I6H I;  3CME Z;  1YJN Z;  2W03 A;  1N2F A;  1KC8 2;  3HOU I;  3F3P C;  4MON A;  1YIT Z;  1I50 I;  2B63 I;  2H85 A;  1VQ8 1;  3IX0 A;  2O53 A;  1Y1W I;  1PFT A;  4RVG A;  1K73 1;  3H0G I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...