3CCUZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccuZ00
2QEXZ 1YJ91 1K8A2 1YI2Z 3CPWZ 3CCM1 1Q821 1YIJZ 3CC71 1VQMZ 1W2BZ 1VQN1 3CCV1 3OW2Y 1VQL1 1QVGY 1VQ41 1QVFY 3CCEZ 1VQP1 3CMAZ 3CCU1 1Q822 2QA4Z 1Q7Y1 3CCSZ 2OTJZ 3CC4Z 3CCLZ 1VQO1 1KQSZ 3I561 1K9M1 1YHQZ 3CD61 3G4S1 1VQOZ 1YI21 2OTJ1 1YJWZ 1YJNZ 1KD12 1M902 1VQ71 3CC2Z 1Q811 1VQNZ 3I56Z 3G71Z 1VQKZ 2OTLZ 1VQPZ 1KC81 1VQ51 1QVFZ 1Q861 1QVGZ 1K8A1 3G6E1 1YJW1 3CPWY 1YJ9Z 3OW2Z 1M1K2 2OTL1 3CD6Z 3G711 1VQK1 3CMA1 3CC7Z 3CCMZ 1YITZ 1YJN1 3CCL1 3CCRZ 3G6EZ 2QA41 1YHQ1 1M1K1 3CC21 1S721 1NJI1 3CCE1 1VQ61 1KD11 1M901 1VQ4Z 2QEX1 3CCS1 1K731 1KQSY 3G4SZ 1Q812 1JJ2Z 3CXCZ 3CCJZ 1VQ7Z 3CCQZ 3CC41 3CCUZ 3CCVZ 1VQ6Z 1Q862 1S72Z 1VQ91 1N8R1 1VQ8Z 3CCQ1 1YIT1 1VQM1 1NJI2 1KC82 1YIJ1 3CXCY 1K9M2 1JJ2Y 1VQ81 1VQLZ 3CME1 1N8R2 3CCR1 1VQ9Z 3I55Z 1VQ5Z 1W2BY 3CCJ1 1Q7Y2 3I551 3CMEZ 1K732
chains in the Genus database with same CATH superfamily
1LQLA 4QTTA 2E2HI 1S7MA 3KIHA 1W2BZ 3CCV1 5T67A 2QLVB 1Z03A 1QF8A 1QVFY 1Q16A 1TWGI 1VLAA 3CCEZ 1RO0A 5D1OB 1L1OC 4A93I 2NVXI 3CC4Z 2JMOA 3GTLI 1WCMI 2VUMI 4NBDA 1PFTA 1YJWZ 1Z01A 3PO3S 1VQ71 3GTPI 3I07A 2J6AA 2OTLZ 2W03A 4NFRA 2VPWA 1K8A1 3G6E1 3U50C 4A3CI 4A3BI 2QREB 2F4OA 1VQK1 5CM2M 2R6MA 3J7A4 3CCMZ 4BY7I 1YITZ 3CCL1 1R9TI 3MZLB 2ZAEB 3J80b 3S1QI 5IP7I 1M1K1 3T4NB 1NJI1 2JA6I 4E2WA 1KQSY 2V45A 1K731 1Q812 1JJ2Z 3VB9A 3S2DI 3IR7A 4RVDA 4A3MI 1ZB8A 3CCJZ 4A3LI 3HOWI 2WB1A 5D1OA 2JIPA 1RLYA 2BJOA 1KRLA 2JIOA 3VTNA 4EWCA 3MONA 1RO4A 1VQ6Z 2PM9A 4DK1A 2VPYA 2B63I 1VQ91 3J81b 2IZ4A 2V8IA 1FDOA 4MD8A 4RV9A 2QRDB 3NH5A 1YIT1 1NJI2 4NBFA 1YIJ1 4NBGA 4E30A 1WIIA 1JJ2Y 4BBSI 1AA6A 1NP6A 3CME1 3MZKB 3CCR1 1Y1VI 3EEDA 4HGYA 1VQ5Z 1W2BY 3S16I 3LUSA 3HOZI 4RVGA 1SFOI 2QEXZ 1YJ91 1K8A2 3NH8A 3CCM1 3GTMI 1N2FA 1Q821 3D9XA 3CC71 1VQN1 1Y1VS 3NDIA 2VF1A 1VQ41 4HGZA 2K3RA 2E2II 2V8KA 1DL6A 3CCU1 4BXXI 2QA4Z 3CCSZ 2OTJZ 4E2ZA 4E2XA 4E2YA 2KPIA 2YADA 5C44I 3CD61 3H0GI 1Y8CA 1VQOZ 1YI21 1M902 4A3KI 3CC2Z 4A3EI 4TNUA 3I56Z 1K83I 1VQPZ 5AN9F 1QVFZ 4E32A 3GTJI 4A3DI 3HOYI 2F4MA 5IT9f 1USPB 1YJ9Z 4RVHA 5A2Qb 3NDJA 1M1K2 3CD6Z 2O53A 3FQQA 4XX2A 5IT9b 3S2HI 3GTQI 1X3WA 4E31A 1YJN1 2V8JA 2QA41 2YU9I 2LFUA 1YHQ1 4NBHA 2E9HA 1YUAA 2DE6A 4MRIA 2OZKA 4E33A 1KD11 4X6AI 2V3VA 3G4SZ 3GTGI 4NOZA 1TFIA 2NVTI 4A3II 3CCQZ 2O4HA 2R92I 1TWCI 3CCUZ 3S15I 3M3YI 4A3FI 2QR1B 3NFZA 1Q862 3IFUA 3NH4A 2NAPA 3HOVI 4A3JI 2G2KA 1VQ8Z 1X0TA 3J81f 1TWAI 3VMHA 1K9M2 1SIWA 3HKZA 1VQLZ 5C3EI 3Q87A 3TE5B 2JR6A 1VQ9Z 4BBRI 4Y52I 1USPA 2VUGA 3CCJ1 2IV2X 2JIRA 2E2JI 2RBLA 3D6WA 4CL1A 4NBEA 3BG1B 5FLXf 1YI2Z 3CPWZ 2PK7A 1WJ2A 2NVQI 1YIJZ 3S14I 1VQMZ 5A2Qf 2LIYA 3OW2Y 1P9NA 1VQL1 2K5RA 1WZNA 3P5JB 1VQP1 2GTIA 4NBCA 2GTHA 1Q822 3IX0A 2OOYB 3KIFA 1Q7Y1 2JA5I 2JNYA 3CCLZ 1VQO1 2P28A 2RHBA 4MXUA 1YHQZ 2EGTA 4MH4A 2OTJ1 2Y0SA 4HH4A 1YJNZ 1KD12 1Q811 3IF8A 3G71Z 1VQ51 1ZH1A 3VMGA 1QVGZ 1YJW1 3CPWY 1Z02A 3GTMS 4RVFA 1RQFA 3ESWA 3CC7Z 3I4NI 2JIQA 3EERA 5IP9I 2QKDA 1ML8A 3G6EZ 2HU9A 1YUKA 4S1TA 2IZ3A 3S1NI 3I4MI 3CCE1 1QYPA 2Q51A 5C4JI 1VQ61 1M901 5T64A 3CCS1 3CXCZ 1X3ZA 4MD9A 2H85A 4MD7A 5FLXb 2RT9A 2VPXA 3CC41 1FDIA 2VPZA 2R7ZI 3K7AI 3GKQA 4QTUA 3GTOI 1RO2A 1N8R1 2JUBA 3QWUA 1VQM1 3CXCY 1VQ81 2GU2A 2JIMA 3PO2I 2E7ZA 2PMZA 1N8R2 1Y1WI 3PO3I 3I55Z 1JWHC 2HF1A 4BY1I 2OOXB 1Q7Y2 2LEXA 4NBAA 3F3PC 1K732 1RNIA 3TDHB 2Q4ZA 3S17I 1I6HI 2KI7B 4RS4A 4Y7NI 2JS4A 5C4XI 3D2LA 1QVGY 3J80f 2QRCB 4A3GI 3CMAZ 3FQMA 2NVYI 3RZOI 3S1MI 2M48A 3JAMb 4NB9A 5LL6f 1KQSZ 4AYBA 4NH1C 3JAMf 3I561 1K9M1 3G4S1 3GCFA 3VMIA 5FLMI 1WW9A 1TWFI 3F3FC 4NB8A 4DQYB 2AYDA 1VQNZ 1VQKZ 1ZB9A 1KC81 1Q861 2I3CA 3OW2Z 2WAQA 3S1RI 4NBBA 2OTL1 3G711 3CMA1 2AKLA 1QXFA 3CCRZ 3CQZI 3M4OI 1I50I 2P3YA 3RZDI 3CC21 1S721 1VQ4Z 2JA7I 2QEX1 3GTKI 1VQ7Z 4MONA 2M6NA 3CCVZ 1I3QI 1S72Z 2RPRA 3FKII 2RIQA 3HOXI 3CCQ1 2R93I 4DGLA 1KC82 2DE7A 1NUIA 3BG0B 3H3VJ 2DE5A 5D1PA 3HOUI 5T6BA 1TWHI 3I551 2JA8I 2W04A 3CMEZ
chains in the Genus database with same CATH topology
1LQLA 4QTTA 2E2HI 1S7MA 3KIHA 1W2BZ 3CCV1 5T67A 2QLVB 1Z03A 1QF8A 1QVFY 1TWGI 1VLAA 3CCEZ 1RO0A 5D1OB 1L1OC 4A93I 2NVXI 3CC4Z 2JMOA 3GTLI 1WCMI 2VUMI 4NBDA 1PFTA 1YJWZ 1Z01A 3PO3S 1VQ71 3GTPI 3I07A 2J6AA 2OTLZ 2W03A 4NFRA 1K8A1 3G6E1 3U50C 4A3CI 4A3BI 2QREB 2F4OA 1VQK1 5CM2M 2R6MA 3J7A4 3CCMZ 4BY7I 1YITZ 3CCL1 1R9TI 3MZLB 2ZAEB 3J80b 3S1QI 5IP7I 1M1K1 3T4NB 1NJI1 2JA6I 4E2WA 1KQSY 1K731 1Q812 1JJ2Z 3VB9A 3S2DI 4RVDA 4A3MI 1ZB8A 3CCJZ 4A3LI 3HOWI 2WB1A 5D1OA 1RLYA 2BJOA 1KRLA 4EWCA 3VTNA 3MONA 1RO4A 1VQ6Z 2PM9A 4DK1A 2B63I 1VQ91 3J81b 2IZ4A 2V8IA 4MD8A 4RV9A 2QRDB 3NH5A 1YIT1 1NJI2 4NBFA 1YIJ1 4NBGA 4E30A 1WIIA 1JJ2Y 4BBSI 1NP6A 3CME1 3MZKB 3CCR1 1Y1VI 3EEDA 4HGYA 1VQ5Z 1W2BY 3S16I 3LUSA 3HOZI 4RVGA 1SFOI 2QEXZ 1YJ91 1K8A2 3NH8A 3CCM1 3GTMI 1N2FA 1Q821 3D9XA 3CC71 1VQN1 1Y1VS 3NDIA 2VF1A 1VQ41 4HGZA 2K3RA 2E2II 2V8KA 1DL6A 3CCU1 4BXXI 2QA4Z 3CCSZ 2OTJZ 4E2ZA 4E2XA 4E2YA 2KPIA 2YADA 5C44I 3CD61 3H0GI 1VQOZ 1YI21 1M902 4A3KI 3CC2Z 4A3EI 4TNUA 3I56Z 1K83I 1VQPZ 5AN9F 1QVFZ 4E32A 3GTJI 4A3DI 3HOYI 2F4MA 5IT9f 1USPB 1YJ9Z 4RVHA 5A2Qb 3NDJA 1M1K2 3CD6Z 2O53A 3FQQA 4XX2A 5IT9b 3S2HI 3GTQI 1X3WA 4E31A 1YJN1 2V8JA 2QA41 2YU9I 2LFUA 1YHQ1 4NBHA 2E9HA 1YUAA 2DE6A 4MRIA 2OZKA 4E33A 1KD11 4X6AI 3G4SZ 3GTGI 4NOZA 1TFIA 2NVTI 4A3II 3CCQZ 2O4HA 2R92I 1TWCI 3CCUZ 3S15I 3M3YI 4A3FI 2QR1B 3NFZA 1Q862 3IFUA 3NH4A 3HOVI 4A3JI 2G2KA 1VQ8Z 1X0TA 3J81f 1TWAI 3VMHA 1K9M2 3HKZA 1VQLZ 5C3EI 3Q87A 3TE5B 2JR6A 1VQ9Z 4BBRI 4Y52I 1USPA 2VUGA 3CCJ1 2E2JI 2RBLA 3D6WA 4CL1A 4NBEA 3BG1B 5FLXf 1YI2Z 3CPWZ 2PK7A 2NVQI 1YIJZ 3S14I 1VQMZ 5A2Qf 2LIYA 3OW2Y 1P9NA 1VQL1 2K5RA 3P5JB 1VQP1 2GTIA 4NBCA 2GTHA 1Q822 3IX0A 2OOYB 3KIFA 1Q7Y1 2JA5I 2JNYA 3CCLZ 1VQO1 2P28A 2RHBA 4MXUA 1YHQZ 2EGTA 4MH4A 2OTJ1 2Y0SA 4HH4A 1YJNZ 1KD12 1Q811 3IF8A 3G71Z 1VQ51 1ZH1A 3VMGA 1QVGZ 1YJW1 3CPWY 1Z02A 3GTMS 4RVFA 1RQFA 3ESWA 3CC7Z 3I4NI 3EERA 5IP9I 2QKDA 1ML8A 3G6EZ 2HU9A 1YUKA 4S1TA 2IZ3A 3S1NI 3I4MI 3CCE1 1QYPA 2Q51A 5C4JI 1VQ61 1M901 5T64A 3CCS1 3CXCZ 1X3ZA 4MD9A 2H85A 4MD7A 5FLXb 2RT9A 3CC41 2R7ZI 3K7AI 3GKQA 4QTUA 3GTOI 1RO2A 1N8R1 2JUBA 3QWUA 1VQM1 3CXCY 1VQ81 2GU2A 3PO2I 1N8R2 2PMZA 1Y1WI 3PO3I 3I55Z 1JWHC 2HF1A 4BY1I 2OOXB 1Q7Y2 4NBAA 3F3PC 1K732 1RNIA 3TDHB 2Q4ZA 3S17I 1I6HI 2KI7B 4RS4A 4Y7NI 2JS4A 5C4XI 1QVGY 3J80f 2QRCB 4A3GI 3CMAZ 3FQMA 2NVYI 3RZOI 3S1MI 2M48A 3JAMb 4NB9A 5LL6f 1KQSZ 4AYBA 4NH1C 3JAMf 3I561 1K9M1 3G4S1 3GCFA 3VMIA 5FLMI 1WW9A 1TWFI 3F3FC 4NB8A 4DQYB 1VQNZ 1VQKZ 1ZB9A 1KC81 1Q861 2I3CA 3OW2Z 2WAQA 3S1RI 4NBBA 2OTL1 3G711 3CMA1 2AKLA 3CCRZ 3CQZI 3M4OI 1I50I 2P3YA 3RZDI 3CC21 1S721 1VQ4Z 2JA7I 2QEX1 3GTKI 1VQ7Z 4MONA 2M6NA 3CCVZ 1I3QI 1S72Z 2RPRA 3FKII 2RIQA 3HOXI 3CCQ1 2R93I 4DGLA 1KC82 2DE7A 1NUIA 3BG0B 3H3VJ 2DE5A 5D1PA 3HOUI 5T6BA 1TWHI 3I551 2JA8I 2W04A 3CMEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Z;  1YJ9 1;  1K8A 2;  1YI2 Z;  3CPW Z;  3CCM 1;  1Q82 1;  1YIJ Z;  3CC7 1;  1VQM Z;  1W2B Z;  1VQN 1;  3CCV 1;  3OW2 Y;  1VQL 1;  1QVG Y;  1VQ4 1;  1QVF Y;  3CCE Z;  1VQP 1;  3CMA Z;  3CCU 1;  1Q82 2;  2QA4 Z;  1Q7Y 1;  3CCS Z;  2OTJ Z;  3CC4 Z;  3CCL Z;  1VQO 1;  1KQS Z;  3I56 1;  1K9M 1;  1YHQ Z;  3CD6 1;  3G4S 1;  1VQO Z;  1YI2 1;  2OTJ 1;  1YJW Z;  1YJN Z;  1KD1 2;  1M90 2;  1VQ7 1;  3CC2 Z;  1Q81 1;  1VQN Z;  3I56 Z;  3G71 Z;  1VQK Z;  2OTL Z;  1VQP Z;  1KC8 1;  1VQ5 1;  1QVF Z;  1Q86 1;  1QVG Z;  1K8A 1;  3G6E 1;  1YJW 1;  3CPW Y;  1YJ9 Z;  3OW2 Z;  1M1K 2;  2OTL 1;  3CD6 Z;  3G71 1;  1VQK 1;  3CMA 1;  3CC7 Z;  3CCM Z;  1YIT Z;  1YJN 1;  3CCL 1;  3CCR Z;  3G6E Z;  2QA4 1;  1YHQ 1;  1M1K 1;  3CC2 1;  1S72 1;  1NJI 1;  3CCE 1;  1VQ6 1;  1KD1 1;  1M90 1;  1VQ4 Z;  2QEX 1;  3CCS 1;  1K73 1;  1KQS Y;  3G4S Z;  1Q81 2;  1JJ2 Z;  3CXC Z;  3CCJ Z;  1VQ7 Z;  3CCQ Z;  3CC4 1;  3CCU Z;  3CCV Z;  1VQ6 Z;  1Q86 2;  1S72 Z;  1VQ9 1;  1N8R 1;  1VQ8 Z;  3CCQ 1;  1YIT 1;  1VQM 1;  1NJI 2;  1KC8 2;  1YIJ 1;  3CXC Y;  1K9M 2;  1JJ2 Y;  1VQ8 1;  1VQL Z;  3CME 1;  1N8R 2;  3CCR 1;  1VQ9 Z;  3I55 Z;  1VQ5 Z;  1W2B Y;  3CCJ 1;  1Q7Y 2;  3I55 1;  3CME Z;  1K73 2; 
#chains in the Genus database with same CATH topology
 1LQL A;  4QTT A;  2E2H I;  1S7M A;  3KIH A;  1W2B Z;  3CCV 1;  5T67 A;  2QLV B;  1Z03 A;  1QF8 A;  1QVF Y;  1Q16 A;  1TWG I;  1VLA A;  3CCE Z;  1RO0 A;  5D1O B;  1L1O C;  4A93 I;  2NVX I;  3CC4 Z;  2JMO A;  3GTL I;  1WCM I;  2VUM I;  4NBD A;  1PFT A;  1YJW Z;  1Z01 A;  3PO3 S;  1VQ7 1;  3GTP I;  3I07 A;  2J6A A;  2OTL Z;  2W03 A;  4NFR A;  2VPW A;  1K8A 1;  3G6E 1;  3U50 C;  4A3C I;  4A3B I;  2QRE B;  2F4O A;  1VQK 1;  5CM2 M;  2R6M A;  3J7A 4;  3CCM Z;  4BY7 I;  1YIT Z;  3CCL 1;  1R9T I;  3MZL B;  2ZAE B;  3J80 b;  3S1Q I;  5IP7 I;  1M1K 1;  3T4N B;  1NJI 1;  2JA6 I;  4E2W A;  1KQS Y;  2V45 A;  1K73 1;  1Q81 2;  1JJ2 Z;  3VB9 A;  3S2D I;  3IR7 A;  4RVD A;  4A3M I;  1ZB8 A;  3CCJ Z;  4A3L I;  3HOW I;  2WB1 A;  5D1O A;  2JIP A;  1RLY A;  2BJO A;  1KRL A;  2JIO A;  3VTN A;  4EWC A;  3MON A;  1RO4 A;  1VQ6 Z;  2PM9 A;  4DK1 A;  2VPY A;  2B63 I;  1VQ9 1;  3J81 b;  2IZ4 A;  2V8I A;  1FDO A;  4MD8 A;  4RV9 A;  2QRD B;  3NH5 A;  1YIT 1;  1NJI 2;  4NBF A;  1YIJ 1;  4NBG A;  4E30 A;  1WII A;  1JJ2 Y;  4BBS I;  1AA6 A;  1NP6 A;  3CME 1;  3MZK B;  3CCR 1;  1Y1V I;  3EED A;  4HGY A;  1VQ5 Z;  1W2B Y;  3S16 I;  3LUS A;  3HOZ I;  4RVG A;  1SFO I;  2QEX Z;  1YJ9 1;  1K8A 2;  3NH8 A;  3CCM 1;  3GTM I;  1N2F A;  1Q82 1;  3D9X A;  3CC7 1;  1VQN 1;  1Y1V S;  3NDI A;  2VF1 A;  1VQ4 1;  4HGZ A;  2K3R A;  2E2I I;  2V8K A;  1DL6 A;  3CCU 1;  4BXX I;  2QA4 Z;  3CCS Z;  2OTJ Z;  4E2Z A;  4E2X A;  4E2Y A;  2KPI A;  2YAD A;  5C44 I;  3CD6 1;  3H0G I;  1Y8C A;  1VQO Z;  1YI2 1;  1M90 2;  4A3K I;  3CC2 Z;  4A3E I;  4TNU A;  3I56 Z;  1K83 I;  1VQP Z;  5AN9 F;  1QVF Z;  4E32 A;  3GTJ I;  4A3D I;  3HOY I;  2F4M A;  5IT9 f;  1USP B;  1YJ9 Z;  4RVH A;  5A2Q b;  3NDJ A;  1M1K 2;  3CD6 Z;  2O53 A;  3FQQ A;  4XX2 A;  5IT9 b;  3S2H I;  3GTQ I;  1X3W A;  4E31 A;  1YJN 1;  2V8J A;  2QA4 1;  2YU9 I;  2LFU A;  1YHQ 1;  4NBH A;  2E9H A;  1YUA A;  2DE6 A;  4MRI A;  2OZK A;  4E33 A;  1KD1 1;  4X6A I;  2V3V A;  3G4S Z;  3GTG I;  4NOZ A;  1TFI A;  2NVT I;  4A3I I;  3CCQ Z;  2O4H A;  2R92 I;  1TWC I;  3CCU Z;  3S15 I;  3M3Y I;  4A3F I;  2QR1 B;  3NFZ A;  1Q86 2;  3IFU A;  3NH4 A;  2NAP A;  3HOV I;  4A3J I;  2G2K A;  1VQ8 Z;  1X0T A;  3J81 f;  1TWA I;  3VMH A;  1K9M 2;  1SIW A;  3HKZ A;  1VQL Z;  5C3E I;  3Q87 A;  3TE5 B;  2JR6 A;  1VQ9 Z;  4BBR I;  4Y52 I;  1USP A;  2VUG A;  3CCJ 1;  2IV2 X;  2JIR A;  2E2J I;  2RBL A;  3D6W A;  4CL1 A;  4NBE A;  3BG1 B;  5FLX f;  1YI2 Z;  3CPW Z;  2PK7 A;  1WJ2 A;  2NVQ I;  1YIJ Z;  3S14 I;  1VQM Z;  5A2Q f;  2LIY A;  3OW2 Y;  1P9N A;  1VQL 1;  2K5R A;  1WZN A;  3P5J B;  1VQP 1;  2GTI A;  4NBC A;  2GTH A;  1Q82 2;  3IX0 A;  2OOY B;  3KIF A;  1Q7Y 1;  2JA5 I;  2JNY A;  3CCL Z;  1VQO 1;  2P28 A;  2RHB A;  4MXU A;  1YHQ Z;  2EGT A;  4MH4 A;  2OTJ 1;  2Y0S A;  4HH4 A;  1YJN Z;  1KD1 2;  1Q81 1;  3IF8 A;  3G71 Z;  1VQ5 1;  1ZH1 A;  3VMG A;  1QVG Z;  1YJW 1;  3CPW Y;  1Z02 A;  3GTM S;  4RVF A;  1RQF A;  3ESW A;  3CC7 Z;  3I4N I;  2JIQ A;  3EER A;  5IP9 I;  2QKD A;  1ML8 A;  3G6E Z;  2HU9 A;  1YUK A;  4S1T A;  2IZ3 A;  3S1N I;  3I4M I;  3CCE 1;  1QYP A;  2Q51 A;  5C4J I;  1VQ6 1;  1M90 1;  5T64 A;  3CCS 1;  3CXC Z;  1X3Z A;  4MD9 A;  2H85 A;  4MD7 A;  5FLX b;  2RT9 A;  2VPX A;  3CC4 1;  1FDI A;  2VPZ A;  2R7Z I;  3K7A I;  3GKQ A;  4QTU A;  3GTO I;  1RO2 A;  1N8R 1;  2JUB A;  3QWU A;  1VQM 1;  3CXC Y;  1VQ8 1;  2GU2 A;  2JIM A;  3PO2 I;  2E7Z A;  2PMZ A;  1N8R 2;  1Y1W I;  3PO3 I;  3I55 Z;  1JWH C;  2HF1 A;  4BY1 I;  2OOX B;  1Q7Y 2;  2LEX A;  4NBA A;  3F3P C;  1K73 2;  1RNI A;  3TDH B;  2Q4Z A;  3S17 I;  1I6H I;  2KI7 B;  4RS4 A;  4Y7N I;  2JS4 A;  5C4X I;  3D2L A;  1QVG Y;  3J80 f;  2QRC B;  4A3G I;  3CMA Z;  3FQM A;  2NVY I;  3RZO I;  3S1M I;  2M48 A;  3JAM b;  4NB9 A;  5LL6 f;  1KQS Z;  4AYB A;  4NH1 C;  3JAM f;  3I56 1;  1K9M 1;  3G4S 1;  3GCF A;  3VMI A;  5FLM I;  1WW9 A;  1TWF I;  3F3F C;  4NB8 A;  4DQY B;  2AYD A;  1VQN Z;  1VQK Z;  1ZB9 A;  1KC8 1;  1Q86 1;  2I3C A;  3OW2 Z;  2WAQ A;  3S1R I;  4NBB A;  2OTL 1;  3G71 1;  3CMA 1;  2AKL A;  1QXF A;  3CCR Z;  3CQZ I;  3M4O I;  1I50 I;  2P3Y A;  3RZD I;  3CC2 1;  1S72 1;  1VQ4 Z;  2JA7 I;  2QEX 1;  3GTK I;  1VQ7 Z;  4MON A;  2M6N A;  3CCV Z;  1I3Q I;  1S72 Z;  2RPR A;  3FKI I;  2RIQ A;  3HOX I;  3CCQ 1;  2R93 I;  4DGL A;  1KC8 2;  2DE7 A;  1NUI A;  3BG0 B;  3H3V J;  2DE5 A;  5D1P A;  3HOU I;  5T6B A;  1TWH I;  3I55 1;  2JA8 I;  2W04 A;  3CME Z; 
#chains in the Genus database with same CATH homology
 1LQL A;  4QTT A;  2E2H I;  1S7M A;  3KIH A;  1W2B Z;  3CCV 1;  5T67 A;  2QLV B;  1Z03 A;  1QF8 A;  1QVF Y;  1TWG I;  1VLA A;  3CCE Z;  1RO0 A;  5D1O B;  1L1O C;  4A93 I;  2NVX I;  3CC4 Z;  2JMO A;  3GTL I;  1WCM I;  2VUM I;  4NBD A;  1PFT A;  1YJW Z;  1Z01 A;  3PO3 S;  1VQ7 1;  3GTP I;  3I07 A;  2J6A A;  2OTL Z;  2W03 A;  4NFR A;  1K8A 1;  3G6E 1;  3U50 C;  4A3C I;  4A3B I;  2QRE B;  2F4O A;  1VQK 1;  5CM2 M;  2R6M A;  3J7A 4;  3CCM Z;  4BY7 I;  1YIT Z;  3CCL 1;  1R9T I;  3MZL B;  2ZAE B;  3J80 b;  3S1Q I;  5IP7 I;  1M1K 1;  3T4N B;  1NJI 1;  2JA6 I;  4E2W A;  1KQS Y;  1K73 1;  1Q81 2;  1JJ2 Z;  3VB9 A;  3S2D I;  4RVD A;  4A3M I;  1ZB8 A;  3CCJ Z;  4A3L I;  3HOW I;  2WB1 A;  5D1O A;  1RLY A;  2BJO A;  1KRL A;  4EWC A;  3VTN A;  3MON A;  1RO4 A;  1VQ6 Z;  2PM9 A;  4DK1 A;  2B63 I;  1VQ9 1;  3J81 b;  2IZ4 A;  2V8I A;  4MD8 A;  4RV9 A;  2QRD B;  3NH5 A;  1YIT 1;  1NJI 2;  4NBF A;  1YIJ 1;  4NBG A;  4E30 A;  1WII A;  1JJ2 Y;  4BBS I;  1NP6 A;  3CME 1;  3MZK B;  3CCR 1;  1Y1V I;  3EED A;  4HGY A;  1VQ5 Z;  1W2B Y;  3S16 I;  3LUS A;  3HOZ I;  4RVG A;  1SFO I;  2QEX Z;  1YJ9 1;  1K8A 2;  3NH8 A;  3CCM 1;  3GTM I;  1N2F A;  1Q82 1;  3D9X A;  3CC7 1;  1VQN 1;  1Y1V S;  3NDI A;  2VF1 A;  1VQ4 1;  4HGZ A;  2K3R A;  2E2I I;  2V8K A;  1DL6 A;  3CCU 1;  4BXX I;  2QA4 Z;  3CCS Z;  2OTJ Z;  4E2Z A;  4E2X A;  4E2Y A;  2KPI A;  2YAD A;  5C44 I;  3CD6 1;  3H0G I;  1VQO Z;  1YI2 1;  1M90 2;  4A3K I;  3CC2 Z;  4A3E I;  4TNU A;  3I56 Z;  1K83 I;  1VQP Z;  5AN9 F;  1QVF Z;  4E32 A;  3GTJ I;  4A3D I;  3HOY I;  2F4M A;  5IT9 f;  1USP B;  1YJ9 Z;  4RVH A;  5A2Q b;  3NDJ A;  1M1K 2;  3CD6 Z;  2O53 A;  3FQQ A;  4XX2 A;  5IT9 b;  3S2H I;  3GTQ I;  1X3W A;  4E31 A;  1YJN 1;  2V8J A;  2QA4 1;  2YU9 I;  2LFU A;  1YHQ 1;  4NBH A;  2E9H A;  1YUA A;  2DE6 A;  4MRI A;  2OZK A;  4E33 A;  1KD1 1;  4X6A I;  3G4S Z;  3GTG I;  4NOZ A;  1TFI A;  2NVT I;  4A3I I;  3CCQ Z;  2O4H A;  2R92 I;  1TWC I;  3CCU Z;  3S15 I;  3M3Y I;  4A3F I;  2QR1 B;  3NFZ A;  1Q86 2;  3IFU A;  3NH4 A;  3HOV I;  4A3J I;  2G2K A;  1VQ8 Z;  1X0T A;  3J81 f;  1TWA I;  3VMH A;  1K9M 2;  3HKZ A;  1VQL Z;  5C3E I;  3Q87 A;  3TE5 B;  2JR6 A;  1VQ9 Z;  4BBR I;  4Y52 I;  1USP A;  2VUG A;  3CCJ 1;  2E2J I;  2RBL A;  3D6W A;  4CL1 A;  4NBE A;  3BG1 B;  5FLX f;  1YI2 Z;  3CPW Z;  2PK7 A;  2NVQ I;  1YIJ Z;  3S14 I;  1VQM Z;  5A2Q f;  2LIY A;  3OW2 Y;  1P9N A;  1VQL 1;  2K5R A;  3P5J B;  1VQP 1;  2GTI A;  4NBC A;  2GTH A;  1Q82 2;  3IX0 A;  2OOY B;  3KIF A;  1Q7Y 1;  2JA5 I;  2JNY A;  3CCL Z;  1VQO 1;  2P28 A;  2RHB A;  4MXU A;  1YHQ Z;  2EGT A;  4MH4 A;  2OTJ 1;  2Y0S A;  4HH4 A;  1YJN Z;  1KD1 2;  1Q81 1;  3IF8 A;  3G71 Z;  1VQ5 1;  1ZH1 A;  3VMG A;  1QVG Z;  1YJW 1;  3CPW Y;  1Z02 A;  3GTM S;  4RVF A;  1RQF A;  3ESW A;  3CC7 Z;  3I4N I;  3EER A;  5IP9 I;  2QKD A;  1ML8 A;  3G6E Z;  2HU9 A;  1YUK A;  4S1T A;  2IZ3 A;  3S1N I;  3I4M I;  3CCE 1;  1QYP A;  2Q51 A;  5C4J I;  1VQ6 1;  1M90 1;  5T64 A;  3CCS 1;  3CXC Z;  1X3Z A;  4MD9 A;  2H85 A;  4MD7 A;  5FLX b;  2RT9 A;  3CC4 1;  2R7Z I;  3K7A I;  3GKQ A;  4QTU A;  3GTO I;  1RO2 A;  1N8R 1;  2JUB A;  3QWU A;  1VQM 1;  3CXC Y;  1VQ8 1;  2GU2 A;  3PO2 I;  1N8R 2;  2PMZ A;  1Y1W I;  3PO3 I;  3I55 Z;  1JWH C;  2HF1 A;  4BY1 I;  2OOX B;  1Q7Y 2;  4NBA A;  3F3P C;  1K73 2;  1RNI A;  3TDH B;  2Q4Z A;  3S17 I;  1I6H I;  2KI7 B;  4RS4 A;  4Y7N I;  2JS4 A;  5C4X I;  1QVG Y;  3J80 f;  2QRC B;  4A3G I;  3CMA Z;  3FQM A;  2NVY I;  3RZO I;  3S1M I;  2M48 A;  3JAM b;  4NB9 A;  5LL6 f;  1KQS Z;  4AYB A;  4NH1 C;  3JAM f;  3I56 1;  1K9M 1;  3G4S 1;  3GCF A;  3VMI A;  5FLM I;  1WW9 A;  1TWF I;  3F3F C;  4NB8 A;  4DQY B;  1VQN Z;  1VQK Z;  1ZB9 A;  1KC8 1;  1Q86 1;  2I3C A;  3OW2 Z;  2WAQ A;  3S1R I;  4NBB A;  2OTL 1;  3G71 1;  3CMA 1;  2AKL A;  3CCR Z;  3CQZ I;  3M4O I;  1I50 I;  2P3Y A;  3RZD I;  3CC2 1;  1S72 1;  1VQ4 Z;  2JA7 I;  2QEX 1;  3GTK I;  1VQ7 Z;  4MON A;  2M6N A;  3CCV Z;  1I3Q I;  1S72 Z;  2RPR A;  3FKI I;  2RIQ A;  3HOX I;  3CCQ 1;  2R93 I;  4DGL A;  1KC8 2;  2DE7 A;  1NUI A;  3BG0 B;  3H3V J;  2DE5 A;  5D1P A;  3HOU I;  5T6B A;  1TWH I;  3I55 1;  2JA8 I;  2W04 A;  3CME Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...