3CCUZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccuZ00
1VQLZ 1Q821 3CCM1 1QVGZ 3CCEZ 1M902 1VQ5Z 3CD61 1VQ71 3CXCY 2QA4Z 2OTJZ 3CCSZ 3CCL1 1S721 1VQ8Z 1W2BZ 1VQL1 3CPWZ 1N8R2 2QEXZ 3CCMZ 1Q862 3CCE1 1YI2Z 1Q812 1VQ51 3CC21 1YJN1 3CCV1 1QVFZ 1VQ7Z 2QA41 3CCLZ 1S72Z 3CCR1 1JJ2Z 2QEX1 1KC81 3G6E1 1M1K1 1YI21 1K731 1Q7Y2 1K9M2 1NJI1 3CC2Z 1YJNZ 3CCVZ 3CXCZ 3I55Z 1VQM1 1K8A1 1VQ41 1VQ91 3CCRZ 1YIJ1 3G6EZ 3CCQ1 2OTLZ 3OW2Y 1YIT1 1YHQ1 1Q822 1KD11 3I551 1VQMZ 3CC71 1VQ4Z 1VQ9Z 1YIJZ 2OTL1 3CCQZ 1YJW1 1M901 1VQOZ 1YITZ 3CC41 1YHQZ 1VQK1 3CC7Z 1N8R1 1Q861 3CMAZ 1Q811 1VQN1 1VQO1 1KQSY 3OW2Z 1YJWZ 3CMEZ 3CCJ1 3CC4Z 3I561 1QVGY 1KC82 1M1K2 1VQKZ 3CCU1 1K732 1NJI2 1VQPZ 1YJ9Z 3G71Z 3CMA1 1Q7Y1 1VQNZ 3CME1 1K9M1 1K8A2 1W2BY 3G4S1 3CCJZ 1VQ61 3CPWY 3I56Z 3CCUZ 1QVFY 3CD6Z 1VQP1 1YJ91 3G711 2OTJ1 1KD12 3CCS1 1KQSZ 1VQ81 3G4SZ 1JJ2Y 1VQ6Z
chains in the Genus database with same CATH superfamily
2LEXA 1Q821 1USPA 2BJOA 4BY7I 1QVGZ 2QRDB 1M902 1X3WA 2M48A 4S1TA 3PO3S 2WB1A 3CCSZ 1PFTA 3VMGA 3CCL1 2NVQI 2E2II 3CPWZ 2QEXZ 3S2DI 3H3VJ 2JA5I 1ML8A 1QVFZ 2E2HI 3FKII 3CCR1 1RNIA 2VF1A 2JNYA 4DQYB 3P5JB 1K731 2YADA 1K9M2 3NFZA 4BY1I 4NBFA 3IFUA 2QREB 4RV9A 2JUBA 5D1OB 2OTLZ 4MD8A 1ZB8A 3J80f 1X0TA 3D6WA 1VQ4Z 2JMOA 1VQ9Z 3EERA 2K3RA 1YIJZ 3CCQZ 1M901 1YITZ 1Z01A 3NDJA 1Y8CA 1VQK1 4QTUA 3U50C 3D2LA 2R6MA 3S2HI 3NH8A 3CC4Z 4EWCA 3K7AI 5D1OA 3VB9A 2KPIA 2B63I 1Y1VI 2HU9A 4X6AI 4RVGA 1VQPZ 4NBAA 4A3LI 2OOYB 3T4NB 3CME1 1K9M1 1K8A2 1VQ61 2JIRA 3GTLI 1WCMI 2PK7A 2W03A 3ESWA 2OOXB 3G711 2JIQA 2OTJ1 1SIWA 3GCFA 3GTMI 4A3DI 1RO0A 4A3GI 1JJ2Y 3QWUA 3CCM1 2E2JI 4NB8A 1Y1VS 5FLMI 3HOYI 2PM9A 3HOZI 3J81b 1VQ71 2J6AA 3CXCY 2JS4A 3MZKB 1VQL1 2WAQA 1TWCI 3EEDA 4HGYA 1Q812 5C44I 1VQ51 3CC21 2IZ3A 2VUMI 3F3FC 4RVHA 1Q16A 5FLXb 3GTMS 3JAMf 2O53A 1FDOA 2K5RA 3GKQA 1S72Z 1JJ2Z 2V8KA 3G6E1 4MXUA 2V8IA 4NB9A 1YJNZ 3CCVZ 1RO4A 3CXCZ 2KI7B 4A3II 1K8A1 4NBBA 3VMIA 1WJ2A 4MD9A 4RVFA 3I551 2EGTA 3J7A4 1VQMZ 3CC71 2V3VA 4BXXI 1Y1WI 3Q87A 1K83I 5LL6f 2DE7A 5T67A 2ZAEB 2GTHA 1R9TI 1YHQZ 2JIPA 1I3QI 1YUAA 4A3KI 2G2KA 3HOUI 2RIQA 4NH1C 1Q811 1VQN1 2I3CA 1VQO1 3VTNA 1YJWZ 3CMEZ 4MONA 2AYDA 5C4JI 1TWFI 3CCJ1 2W04A 1L1OC 3I561 3TE5B 1M1K2 3RZDI 3VMHA 3GTOI 2JA6I 3G71Z 5IP7I 3S17I 3S1QI 1W2BY 3G4S1 2RBLA 4MD7A 3NH5A 2V8JA 2QKDA 1RLYA 3IF8A 3CCUZ 4A3EI 1DL6A 1KD12 3CCS1 1ZH1A 1NUIA 1VQLZ 3D9XA 4RVDA 2E9HA 1VQ5Z 2Y0SA 3FQMA 1Z03A 4E2YA 5T64A 5A2Qb 1VQ8Z 1W2BZ 4NBDA 1N8R2 1Q862 3CCE1 2Q4ZA 3PO2I 2QA41 3GTPI 3MZLB 1WZNA 1S7MA 1NP6A 3CCLZ 4HH4A 1M1K1 1YI21 2R93I 1Q7Y2 3FQQA 3H0GI 4QTTA 3I55Z 2VPYA 1VQ41 1VQ91 3M3YI 3CCRZ 1YIJ1 2NVXI 3CCQ1 3GTGI 1USPB 1YIT1 1JWHC 5IP9I 2E7ZA 4NBGA 1KD11 1N2FA 3GTQI 4BBRI 1TWAI 1TWHI 2QLVB 3MONA 3GTKI 2JIMA 2JA8I 1VQOZ 2LFUA 1FDIA 3CC41 4E31A 2JIOA 1Z02A 2H85A 3I4NI 1QXFA 2OZKA 4E30A 3S15I 3F3PC 3J80b 1WW9A 2V45A 5CM2M 4DK1A 1N8R1 1Q861 2O4HA 1QYPA 5D1PA 3KIHA 1KC82 1VQKZ 3HOVI 3S16I 4BBSI 1NJI2 2YU9I 1RO2A 2VUGA 1LQLA 3CMA1 1Q7Y1 2VPWA 3J81f 3I07A 1I50I 2DE5A 1I6HI 5IT9f 2F4MA 2QR1B 1YJ91 1AA6A 1KRLA 4AYBA 2F4OA 3BG0B 1VQ6Z 2NVYI 2PMZA 5T6BA 2P3YA 3CCEZ 4NBCA 5FLXf 3CD61 4A3CI 2RT9A 2M6NA 4Y7NI 2NVTI 4Y52I 4E2ZA 2QA4Z 2OTJZ 1S721 3M4OI 3HOWI 2RHBA 3CCMZ 2NAPA 1TWGI 1YI2Z 2R7ZI 1YJN1 3I4MI 3CCV1 1VQ7Z 3GTJI 3S1RI 4E2WA 4E32A 3NH4A 2QEX1 1KC81 2JA7I 1NJI1 3CC2Z 2DE6A 1VQM1 3S1MI 3NDIA 2RPRA 2IZ4A 2QRCB 3BG1B 4RS4A 3G6EZ 3JAMb 4E2XA 3OW2Y 3S1NI 3CQZI 1YHQ1 1Q822 5C4XI 2P28A 2AKLA 1QF8A 4NFRA 4NBEA 4CL1A 2OTL1 1YJW1 1P9NA 1SFOI 5AN9F 3KIFA 2HF1A 3CC7Z 4NOZA 2GU2A 1ZB9A 3HKZA 3CMAZ 1KQSY 3OW2Z 4A3FI 5C3EI 4A3MI 1TFIA 2JR6A 4NBHA 1QVGY 4DGLA 4MRIA 3IX0A 3CCU1 2IV2X 3HOXI 1K732 4HGZA 4MH4A 4TNUA 4A93I 1YJ9Z 5IT9b 2LIYA 1VQNZ 3PO3I 4E33A 1VLAA 1RQFA 2VPXA 3CCJZ 3CPWY 3TDHB 3I56Z 4A3BI 1QVFY 5A2Qf 3CD6Z 1VQP1 2R92I 2Q51A 3S14I 3RZOI 1YUKA 1WIIA 2GTIA 2VPZA 4XX2A 3LUSA 3IR7A 1KQSZ 1VQ81 1X3ZA 4A3JI 3G4SZ
chains in the Genus database with same CATH topology
1Q821 1USPA 2BJOA 4BY7I 1QVGZ 2QRDB 1M902 1X3WA 2M48A 4S1TA 3PO3S 2WB1A 3CCSZ 1PFTA 3VMGA 3CCL1 2NVQI 2E2II 3CPWZ 2QEXZ 3S2DI 3H3VJ 2JA5I 1ML8A 1QVFZ 2E2HI 3FKII 3CCR1 1RNIA 2VF1A 2JNYA 4DQYB 3P5JB 1K731 2YADA 1K9M2 3NFZA 4BY1I 4NBFA 3IFUA 2QREB 4RV9A 2JUBA 5D1OB 2OTLZ 4MD8A 1ZB8A 3J80f 1X0TA 3D6WA 1VQ4Z 2JMOA 1VQ9Z 3EERA 2K3RA 1YIJZ 3CCQZ 1M901 1YITZ 1Z01A 3NDJA 1VQK1 4QTUA 3U50C 2R6MA 3S2HI 3NH8A 3CC4Z 4EWCA 3K7AI 5D1OA 3VB9A 2KPIA 2B63I 1Y1VI 2HU9A 4X6AI 4RVGA 1VQPZ 4NBAA 4A3LI 2OOYB 3T4NB 3CME1 1K9M1 1K8A2 1VQ61 3GTLI 1WCMI 2PK7A 2W03A 3ESWA 2OOXB 3G711 2OTJ1 3GCFA 3GTMI 4A3DI 1RO0A 4A3GI 1JJ2Y 3QWUA 3CCM1 2E2JI 4NB8A 1Y1VS 5FLMI 3HOYI 2PM9A 3HOZI 3J81b 1VQ71 2J6AA 3CXCY 2JS4A 3MZKB 1VQL1 2WAQA 1TWCI 3EEDA 4HGYA 1Q812 5C44I 1VQ51 3CC21 2IZ3A 2VUMI 3F3FC 4RVHA 5FLXb 3GTMS 3JAMf 2O53A 2K5RA 1S72Z 3GKQA 1JJ2Z 2V8KA 3G6E1 4MXUA 2V8IA 4NB9A 1YJNZ 3CCVZ 1RO4A 3CXCZ 2KI7B 4A3II 1K8A1 4NBBA 3VMIA 4MD9A 4RVFA 3I551 2EGTA 3J7A4 1VQMZ 3CC71 4BXXI 1Y1WI 3Q87A 1K83I 5LL6f 2DE7A 5T67A 2ZAEB 2GTHA 1R9TI 1YHQZ 1I3QI 1YUAA 4A3KI 2G2KA 3HOUI 2RIQA 4NH1C 1Q811 1VQN1 2I3CA 1VQO1 3VTNA 1YJWZ 3CMEZ 4MONA 5C4JI 1TWFI 3CCJ1 2W04A 1L1OC 3I561 3TE5B 1M1K2 3RZDI 3VMHA 3GTOI 2JA6I 3G71Z 5IP7I 3S17I 3S1QI 1W2BY 3G4S1 2RBLA 4MD7A 3NH5A 2V8JA 2QKDA 1RLYA 3IF8A 3CCUZ 4A3EI 1DL6A 1KD12 3CCS1 1ZH1A 1NUIA 1VQLZ 3D9XA 4RVDA 2E9HA 1VQ5Z 2Y0SA 3FQMA 1Z03A 4E2YA 5T64A 5A2Qb 1VQ8Z 1W2BZ 4NBDA 1N8R2 1Q862 3CCE1 2Q4ZA 3PO2I 2QA41 3GTPI 3MZLB 1S7MA 1NP6A 3CCLZ 4HH4A 1M1K1 1YI21 2R93I 1Q7Y2 3FQQA 3H0GI 4QTTA 3I55Z 1VQ41 1VQ91 3M3YI 3CCRZ 1YIJ1 2NVXI 3CCQ1 3GTGI 1USPB 1YIT1 1JWHC 5IP9I 4NBGA 1KD11 1N2FA 3GTQI 4BBRI 1TWAI 1TWHI 2QLVB 3MONA 3GTKI 2JA8I 1VQOZ 2LFUA 3CC41 4E31A 1Z02A 2H85A 3I4NI 4E30A 2OZKA 3S15I 3F3PC 3J80b 1WW9A 5CM2M 4DK1A 1N8R1 1Q861 2O4HA 1QYPA 5D1PA 3KIHA 1KC82 1VQKZ 3HOVI 3S16I 4BBSI 1NJI2 2YU9I 1RO2A 2VUGA 1LQLA 3CMA1 1Q7Y1 3J81f 3I07A 1I50I 2DE5A 1I6HI 5IT9f 2F4MA 2QR1B 1YJ91 1KRLA 4AYBA 2F4OA 3BG0B 1VQ6Z 2NVYI 2PMZA 5T6BA 2P3YA 3CCEZ 4NBCA 5FLXf 3CD61 4A3CI 2RT9A 2M6NA 4Y7NI 2NVTI 4Y52I 4E2ZA 2QA4Z 2OTJZ 1S721 3M4OI 3HOWI 2RHBA 3CCMZ 1TWGI 1YI2Z 2R7ZI 1YJN1 3I4MI 3CCV1 1VQ7Z 3GTJI 3S1RI 4E2WA 4E32A 3NH4A 2QEX1 1KC81 2JA7I 1NJI1 3CC2Z 2DE6A 1VQM1 3S1MI 3NDIA 2RPRA 2IZ4A 2QRCB 3BG1B 4RS4A 3G6EZ 3JAMb 4E2XA 3OW2Y 3S1NI 3CQZI 1YHQ1 1Q822 5C4XI 2P28A 2AKLA 1QF8A 4NFRA 4NBEA 4CL1A 2OTL1 1YJW1 1P9NA 1SFOI 5AN9F 3KIFA 2HF1A 3CC7Z 4NOZA 2GU2A 1ZB9A 3HKZA 3CMAZ 1KQSY 3OW2Z 4A3FI 5C3EI 4A3MI 1TFIA 2JR6A 4NBHA 1QVGY 4DGLA 4MRIA 3IX0A 3CCU1 3HOXI 1K732 4HGZA 4MH4A 4TNUA 4A93I 1YJ9Z 5IT9b 2LIYA 1VQNZ 3PO3I 4E33A 1VLAA 1RQFA 3CCJZ 3CPWY 3TDHB 3I56Z 4A3BI 1QVFY 5A2Qf 3CD6Z 1VQP1 2R92I 2Q51A 3S14I 3RZOI 1YUKA 1WIIA 2GTIA 4XX2A 3LUSA 1KQSZ 1VQ81 1X3ZA 4A3JI 3G4SZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Z;  1Q82 1;  3CCM 1;  1QVG Z;  3CCE Z;  1M90 2;  1VQ5 Z;  3CD6 1;  1VQ7 1;  3CXC Y;  2QA4 Z;  2OTJ Z;  3CCS Z;  3CCL 1;  1S72 1;  1VQ8 Z;  1W2B Z;  1VQL 1;  3CPW Z;  1N8R 2;  2QEX Z;  3CCM Z;  1Q86 2;  3CCE 1;  1YI2 Z;  1Q81 2;  1VQ5 1;  3CC2 1;  1YJN 1;  3CCV 1;  1QVF Z;  1VQ7 Z;  2QA4 1;  3CCL Z;  1S72 Z;  3CCR 1;  1JJ2 Z;  2QEX 1;  1KC8 1;  3G6E 1;  1M1K 1;  1YI2 1;  1K73 1;  1Q7Y 2;  1K9M 2;  1NJI 1;  3CC2 Z;  1YJN Z;  3CCV Z;  3CXC Z;  3I55 Z;  1VQM 1;  1K8A 1;  1VQ4 1;  1VQ9 1;  3CCR Z;  1YIJ 1;  3G6E Z;  3CCQ 1;  2OTL Z;  3OW2 Y;  1YIT 1;  1YHQ 1;  1Q82 2;  1KD1 1;  3I55 1;  1VQM Z;  3CC7 1;  1VQ4 Z;  1VQ9 Z;  1YIJ Z;  2OTL 1;  3CCQ Z;  1YJW 1;  1M90 1;  1VQO Z;  1YIT Z;  3CC4 1;  1YHQ Z;  1VQK 1;  3CC7 Z;  1N8R 1;  1Q86 1;  3CMA Z;  1Q81 1;  1VQN 1;  1VQO 1;  1KQS Y;  3OW2 Z;  1YJW Z;  3CME Z;  3CCJ 1;  3CC4 Z;  3I56 1;  1QVG Y;  1KC8 2;  1M1K 2;  1VQK Z;  3CCU 1;  1K73 2;  1NJI 2;  1VQP Z;  1YJ9 Z;  3G71 Z;  3CMA 1;  1Q7Y 1;  1VQN Z;  3CME 1;  1K9M 1;  1K8A 2;  1W2B Y;  3G4S 1;  3CCJ Z;  1VQ6 1;  3CPW Y;  3I56 Z;  3CCU Z;  1QVF Y;  3CD6 Z;  1VQP 1;  1YJ9 1;  3G71 1;  2OTJ 1;  1KD1 2;  3CCS 1;  1KQS Z;  1VQ8 1;  3G4S Z;  1JJ2 Y;  1VQ6 Z; 
#chains in the Genus database with same CATH topology
 2LEX A;  1Q82 1;  1USP A;  2BJO A;  4BY7 I;  1QVG Z;  2QRD B;  1M90 2;  1X3W A;  2M48 A;  4S1T A;  3PO3 S;  2WB1 A;  3CCS Z;  1PFT A;  3VMG A;  3CCL 1;  2NVQ I;  2E2I I;  3CPW Z;  2QEX Z;  3S2D I;  3H3V J;  2JA5 I;  1ML8 A;  1QVF Z;  2E2H I;  3FKI I;  3CCR 1;  1RNI A;  2VF1 A;  2JNY A;  4DQY B;  3P5J B;  1K73 1;  2YAD A;  1K9M 2;  3NFZ A;  4BY1 I;  4NBF A;  3IFU A;  2QRE B;  4RV9 A;  2JUB A;  5D1O B;  2OTL Z;  4MD8 A;  1ZB8 A;  3J80 f;  1X0T A;  3D6W A;  1VQ4 Z;  2JMO A;  1VQ9 Z;  3EER A;  2K3R A;  1YIJ Z;  3CCQ Z;  1M90 1;  1YIT Z;  1Z01 A;  3NDJ A;  1Y8C A;  1VQK 1;  4QTU A;  3U50 C;  3D2L A;  2R6M A;  3S2H I;  3NH8 A;  3CC4 Z;  4EWC A;  3K7A I;  5D1O A;  3VB9 A;  2KPI A;  2B63 I;  1Y1V I;  2HU9 A;  4X6A I;  4RVG A;  1VQP Z;  4NBA A;  4A3L I;  2OOY B;  3T4N B;  3CME 1;  1K9M 1;  1K8A 2;  1VQ6 1;  2JIR A;  3GTL I;  1WCM I;  2PK7 A;  2W03 A;  3ESW A;  2OOX B;  3G71 1;  2JIQ A;  2OTJ 1;  1SIW A;  3GCF A;  3GTM I;  4A3D I;  1RO0 A;  4A3G I;  1JJ2 Y;  3QWU A;  3CCM 1;  2E2J I;  4NB8 A;  1Y1V S;  5FLM I;  3HOY I;  2PM9 A;  3HOZ I;  3J81 b;  1VQ7 1;  2J6A A;  3CXC Y;  2JS4 A;  3MZK B;  1VQL 1;  2WAQ A;  1TWC I;  3EED A;  4HGY A;  1Q81 2;  5C44 I;  1VQ5 1;  3CC2 1;  2IZ3 A;  2VUM I;  3F3F C;  4RVH A;  1Q16 A;  5FLX b;  3GTM S;  3JAM f;  2O53 A;  1FDO A;  2K5R A;  3GKQ A;  1S72 Z;  1JJ2 Z;  2V8K A;  3G6E 1;  4MXU A;  2V8I A;  4NB9 A;  1YJN Z;  3CCV Z;  1RO4 A;  3CXC Z;  2KI7 B;  4A3I I;  1K8A 1;  4NBB A;  3VMI A;  1WJ2 A;  4MD9 A;  4RVF A;  3I55 1;  2EGT A;  3J7A 4;  1VQM Z;  3CC7 1;  2V3V A;  4BXX I;  1Y1W I;  3Q87 A;  1K83 I;  5LL6 f;  2DE7 A;  5T67 A;  2ZAE B;  2GTH A;  1R9T I;  1YHQ Z;  2JIP A;  1I3Q I;  1YUA A;  4A3K I;  2G2K A;  3HOU I;  2RIQ A;  4NH1 C;  1Q81 1;  1VQN 1;  2I3C A;  1VQO 1;  3VTN A;  1YJW Z;  3CME Z;  4MON A;  2AYD A;  5C4J I;  1TWF I;  3CCJ 1;  2W04 A;  1L1O C;  3I56 1;  3TE5 B;  1M1K 2;  3RZD I;  3VMH A;  3GTO I;  2JA6 I;  3G71 Z;  5IP7 I;  3S17 I;  3S1Q I;  1W2B Y;  3G4S 1;  2RBL A;  4MD7 A;  3NH5 A;  2V8J A;  2QKD A;  1RLY A;  3IF8 A;  3CCU Z;  4A3E I;  1DL6 A;  1KD1 2;  3CCS 1;  1ZH1 A;  1NUI A;  1VQL Z;  3D9X A;  4RVD A;  2E9H A;  1VQ5 Z;  2Y0S A;  3FQM A;  1Z03 A;  4E2Y A;  5T64 A;  5A2Q b;  1VQ8 Z;  1W2B Z;  4NBD A;  1N8R 2;  1Q86 2;  3CCE 1;  2Q4Z A;  3PO2 I;  2QA4 1;  3GTP I;  3MZL B;  1WZN A;  1S7M A;  1NP6 A;  3CCL Z;  4HH4 A;  1M1K 1;  1YI2 1;  2R93 I;  1Q7Y 2;  3FQQ A;  3H0G I;  4QTT A;  3I55 Z;  2VPY A;  1VQ4 1;  1VQ9 1;  3M3Y I;  3CCR Z;  1YIJ 1;  2NVX I;  3CCQ 1;  3GTG I;  1USP B;  1YIT 1;  1JWH C;  5IP9 I;  2E7Z A;  4NBG A;  1KD1 1;  1N2F A;  3GTQ I;  4BBR I;  1TWA I;  1TWH I;  2QLV B;  3MON A;  3GTK I;  2JIM A;  2JA8 I;  1VQO Z;  2LFU A;  1FDI A;  3CC4 1;  4E31 A;  2JIO A;  1Z02 A;  2H85 A;  3I4N I;  1QXF A;  2OZK A;  4E30 A;  3S15 I;  3F3P C;  3J80 b;  1WW9 A;  2V45 A;  5CM2 M;  4DK1 A;  1N8R 1;  1Q86 1;  2O4H A;  1QYP A;  5D1P A;  3KIH A;  1KC8 2;  1VQK Z;  3HOV I;  3S16 I;  4BBS I;  1NJI 2;  2YU9 I;  1RO2 A;  2VUG A;  1LQL A;  3CMA 1;  1Q7Y 1;  2VPW A;  3J81 f;  3I07 A;  1I50 I;  2DE5 A;  1I6H I;  5IT9 f;  2F4M A;  2QR1 B;  1YJ9 1;  1AA6 A;  1KRL A;  4AYB A;  2F4O A;  3BG0 B;  1VQ6 Z;  2NVY I;  2PMZ A;  5T6B A;  2P3Y A;  3CCE Z;  4NBC A;  5FLX f;  3CD6 1;  4A3C I;  2RT9 A;  2M6N A;  4Y7N I;  2NVT I;  4Y52 I;  4E2Z A;  2QA4 Z;  2OTJ Z;  1S72 1;  3M4O I;  3HOW I;  2RHB A;  3CCM Z;  2NAP A;  1TWG I;  1YI2 Z;  2R7Z I;  1YJN 1;  3I4M I;  3CCV 1;  1VQ7 Z;  3GTJ I;  3S1R I;  4E2W A;  4E32 A;  3NH4 A;  2QEX 1;  1KC8 1;  2JA7 I;  1NJI 1;  3CC2 Z;  2DE6 A;  1VQM 1;  3S1M I;  3NDI A;  2RPR A;  2IZ4 A;  2QRC B;  3BG1 B;  4RS4 A;  3G6E Z;  3JAM b;  4E2X A;  3OW2 Y;  3S1N I;  3CQZ I;  1YHQ 1;  1Q82 2;  5C4X I;  2P28 A;  2AKL A;  1QF8 A;  4NFR A;  4NBE A;  4CL1 A;  2OTL 1;  1YJW 1;  1P9N A;  1SFO I;  5AN9 F;  3KIF A;  2HF1 A;  3CC7 Z;  4NOZ A;  2GU2 A;  1ZB9 A;  3HKZ A;  3CMA Z;  1KQS Y;  3OW2 Z;  4A3F I;  5C3E I;  4A3M I;  1TFI A;  2JR6 A;  4NBH A;  1QVG Y;  4DGL A;  4MRI A;  3IX0 A;  3CCU 1;  2IV2 X;  3HOX I;  1K73 2;  4HGZ A;  4MH4 A;  4TNU A;  4A93 I;  1YJ9 Z;  5IT9 b;  2LIY A;  1VQN Z;  3PO3 I;  4E33 A;  1VLA A;  1RQF A;  2VPX A;  3CCJ Z;  3CPW Y;  3TDH B;  3I56 Z;  4A3B I;  1QVF Y;  5A2Q f;  3CD6 Z;  1VQP 1;  2R92 I;  2Q51 A;  3S14 I;  3RZO I;  1YUK A;  1WII A;  2GTI A;  2VPZ A;  4XX2 A;  3LUS A;  3IR7 A;  1KQS Z;  1VQ8 1;  1X3Z A;  4A3J I;  3G4S Z; 
#chains in the Genus database with same CATH homology
 1Q82 1;  1USP A;  2BJO A;  4BY7 I;  1QVG Z;  2QRD B;  1M90 2;  1X3W A;  2M48 A;  4S1T A;  3PO3 S;  2WB1 A;  3CCS Z;  1PFT A;  3VMG A;  3CCL 1;  2NVQ I;  2E2I I;  3CPW Z;  2QEX Z;  3S2D I;  3H3V J;  2JA5 I;  1ML8 A;  1QVF Z;  2E2H I;  3FKI I;  3CCR 1;  1RNI A;  2VF1 A;  2JNY A;  4DQY B;  3P5J B;  1K73 1;  2YAD A;  1K9M 2;  3NFZ A;  4BY1 I;  4NBF A;  3IFU A;  2QRE B;  4RV9 A;  2JUB A;  5D1O B;  2OTL Z;  4MD8 A;  1ZB8 A;  3J80 f;  1X0T A;  3D6W A;  1VQ4 Z;  2JMO A;  1VQ9 Z;  3EER A;  2K3R A;  1YIJ Z;  3CCQ Z;  1M90 1;  1YIT Z;  1Z01 A;  3NDJ A;  1VQK 1;  4QTU A;  3U50 C;  2R6M A;  3S2H I;  3NH8 A;  3CC4 Z;  4EWC A;  3K7A I;  5D1O A;  3VB9 A;  2KPI A;  2B63 I;  1Y1V I;  2HU9 A;  4X6A I;  4RVG A;  1VQP Z;  4NBA A;  4A3L I;  2OOY B;  3T4N B;  3CME 1;  1K9M 1;  1K8A 2;  1VQ6 1;  3GTL I;  1WCM I;  2PK7 A;  2W03 A;  3ESW A;  2OOX B;  3G71 1;  2OTJ 1;  3GCF A;  3GTM I;  4A3D I;  1RO0 A;  4A3G I;  1JJ2 Y;  3QWU A;  3CCM 1;  2E2J I;  4NB8 A;  1Y1V S;  5FLM I;  3HOY I;  2PM9 A;  3HOZ I;  3J81 b;  1VQ7 1;  2J6A A;  3CXC Y;  2JS4 A;  3MZK B;  1VQL 1;  2WAQ A;  1TWC I;  3EED A;  4HGY A;  1Q81 2;  5C44 I;  1VQ5 1;  3CC2 1;  2IZ3 A;  2VUM I;  3F3F C;  4RVH A;  5FLX b;  3GTM S;  3JAM f;  2O53 A;  2K5R A;  1S72 Z;  3GKQ A;  1JJ2 Z;  2V8K A;  3G6E 1;  4MXU A;  2V8I A;  4NB9 A;  1YJN Z;  3CCV Z;  1RO4 A;  3CXC Z;  2KI7 B;  4A3I I;  1K8A 1;  4NBB A;  3VMI A;  4MD9 A;  4RVF A;  3I55 1;  2EGT A;  3J7A 4;  1VQM Z;  3CC7 1;  4BXX I;  1Y1W I;  3Q87 A;  1K83 I;  5LL6 f;  2DE7 A;  5T67 A;  2ZAE B;  2GTH A;  1R9T I;  1YHQ Z;  1I3Q I;  1YUA A;  4A3K I;  2G2K A;  3HOU I;  2RIQ A;  4NH1 C;  1Q81 1;  1VQN 1;  2I3C A;  1VQO 1;  3VTN A;  1YJW Z;  3CME Z;  4MON A;  5C4J I;  1TWF I;  3CCJ 1;  2W04 A;  1L1O C;  3I56 1;  3TE5 B;  1M1K 2;  3RZD I;  3VMH A;  3GTO I;  2JA6 I;  3G71 Z;  5IP7 I;  3S17 I;  3S1Q I;  1W2B Y;  3G4S 1;  2RBL A;  4MD7 A;  3NH5 A;  2V8J A;  2QKD A;  1RLY A;  3IF8 A;  3CCU Z;  4A3E I;  1DL6 A;  1KD1 2;  3CCS 1;  1ZH1 A;  1NUI A;  1VQL Z;  3D9X A;  4RVD A;  2E9H A;  1VQ5 Z;  2Y0S A;  3FQM A;  1Z03 A;  4E2Y A;  5T64 A;  5A2Q b;  1VQ8 Z;  1W2B Z;  4NBD A;  1N8R 2;  1Q86 2;  3CCE 1;  2Q4Z A;  3PO2 I;  2QA4 1;  3GTP I;  3MZL B;  1S7M A;  1NP6 A;  3CCL Z;  4HH4 A;  1M1K 1;  1YI2 1;  2R93 I;  1Q7Y 2;  3FQQ A;  3H0G I;  4QTT A;  3I55 Z;  1VQ4 1;  1VQ9 1;  3M3Y I;  3CCR Z;  1YIJ 1;  2NVX I;  3CCQ 1;  3GTG I;  1USP B;  1YIT 1;  1JWH C;  5IP9 I;  4NBG A;  1KD1 1;  1N2F A;  3GTQ I;  4BBR I;  1TWA I;  1TWH I;  2QLV B;  3MON A;  3GTK I;  2JA8 I;  1VQO Z;  2LFU A;  3CC4 1;  4E31 A;  1Z02 A;  2H85 A;  3I4N I;  4E30 A;  2OZK A;  3S15 I;  3F3P C;  3J80 b;  1WW9 A;  5CM2 M;  4DK1 A;  1N8R 1;  1Q86 1;  2O4H A;  1QYP A;  5D1P A;  3KIH A;  1KC8 2;  1VQK Z;  3HOV I;  3S16 I;  4BBS I;  1NJI 2;  2YU9 I;  1RO2 A;  2VUG A;  1LQL A;  3CMA 1;  1Q7Y 1;  3J81 f;  3I07 A;  1I50 I;  2DE5 A;  1I6H I;  5IT9 f;  2F4M A;  2QR1 B;  1YJ9 1;  1KRL A;  4AYB A;  2F4O A;  3BG0 B;  1VQ6 Z;  2NVY I;  2PMZ A;  5T6B A;  2P3Y A;  3CCE Z;  4NBC A;  5FLX f;  3CD6 1;  4A3C I;  2RT9 A;  2M6N A;  4Y7N I;  2NVT I;  4Y52 I;  4E2Z A;  2QA4 Z;  2OTJ Z;  1S72 1;  3M4O I;  3HOW I;  2RHB A;  3CCM Z;  1TWG I;  1YI2 Z;  2R7Z I;  1YJN 1;  3I4M I;  3CCV 1;  1VQ7 Z;  3GTJ I;  3S1R I;  4E2W A;  4E32 A;  3NH4 A;  2QEX 1;  1KC8 1;  2JA7 I;  1NJI 1;  3CC2 Z;  2DE6 A;  1VQM 1;  3S1M I;  3NDI A;  2RPR A;  2IZ4 A;  2QRC B;  3BG1 B;  4RS4 A;  3G6E Z;  3JAM b;  4E2X A;  3OW2 Y;  3S1N I;  3CQZ I;  1YHQ 1;  1Q82 2;  5C4X I;  2P28 A;  2AKL A;  1QF8 A;  4NFR A;  4NBE A;  4CL1 A;  2OTL 1;  1YJW 1;  1P9N A;  1SFO I;  5AN9 F;  3KIF A;  2HF1 A;  3CC7 Z;  4NOZ A;  2GU2 A;  1ZB9 A;  3HKZ A;  3CMA Z;  1KQS Y;  3OW2 Z;  4A3F I;  5C3E I;  4A3M I;  1TFI A;  2JR6 A;  4NBH A;  1QVG Y;  4DGL A;  4MRI A;  3IX0 A;  3CCU 1;  3HOX I;  1K73 2;  4HGZ A;  4MH4 A;  4TNU A;  4A93 I;  1YJ9 Z;  5IT9 b;  2LIY A;  1VQN Z;  3PO3 I;  4E33 A;  1VLA A;  1RQF A;  3CCJ Z;  3CPW Y;  3TDH B;  3I56 Z;  4A3B I;  1QVF Y;  5A2Q f;  3CD6 Z;  1VQP 1;  2R92 I;  2Q51 A;  3S14 I;  3RZO I;  1YUK A;  1WII A;  2GTI A;  4XX2 A;  3LUS A;  1KQS Z;  1VQ8 1;  1X3Z A;  4A3J I;  3G4S Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...